Everful

Wholesale angel pins

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Angel Pins

Find the perfect pieces: alloy brooches, fashion brooches, crystal brooches and more

Men's Brooches

All products in angel pins

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Cartoon Jesus Enamel Pin Square Alloy Brooch With Motivational Quote Religious Inspirational Badge Jewelry Gift For Clothing
Cartoon Jesus Enamel Pin Square Alloy Brooch With Motivational Quote Religious Inspirational Badge Jewelry Gift For Clothing
like
Find Similar
Square enamel pin with Jesus illustration and I Believe In You motivational quote - I Believe In You Style (QHXZ5195)
Square enamel pin with cartoon Jesus doing a heart gesture and Love you text - Love You Heart Style (QHXZ5196)
Square enamel pin with Jesus holding yellow pom poms and Keep going My child text - Keep Going Style (QHXZ5197)
Cartoon Jesus Enamel Pin Square Alloy Brooch With Motivational Quote Religious Inspirational Badge Jewelry Gift For Clothing
-8%
$0.45
No MOQ
Matcha Enamel Brooch Pin Alloy Cartoon Green Tea Drink Shape Badge Creative Clothing Bag Accessories For Women Men
Matcha Enamel Brooch Pin Alloy Cartoon Green Tea Drink Shape Badge Creative Clothing Bag Accessories For Women Men
like
Find Similar
Cute Matcha Girlie enamel pin in green and pink colors for clothing accessories - Matcha Girlie Cup (QHXZ4855)
Cute matcha drink enamel pin featuring I Love You So Matcha text with pink bow detail - Bowknot Matcha Cup (QHXZ4856)
Enamel pin badge featuring pink matcha latte art and 'BUT FIRST MATCHA' lettering - Matcha Latte Art Round Badge (QHXZ4857)
Creative matcha green tea enamel pin badge with pink circle and blue background - Matcha Leaf Round Badge (QHXZ4858)
Matcha Enamel Brooch Pin Alloy Cartoon Green Tea Drink Shape Badge Creative Clothing Bag Accessories For Women Men
-9%
$0.39
No MOQ
 · 
604 sold recently
Free Shipping
Alloy Enamel Pin Set Cartoon Princess Silhouette Sun Totem Chameleon Magical Flower Rhinestone Brooch For Women Jewelry Gift
Alloy Enamel Pin Set Cartoon Princess Silhouette Sun Totem Chameleon Magical Flower Rhinestone Brooch For Women Jewelry Gift
like
Find Similar
Retro gold-plated zinc alloy brooch with red enamel featuring Princess Belle silhouette - Princess Silhouette Style (QHXZ1635)
Golden enamel sun badge pin with terracotta floral patterns in minimalist style - Sun Totem Style (QHXZ1636)
Cartoon chameleon metal brooch pin in vintage gold finish for clothes and bags - Chameleon Shape (QHXZ1637)
Golden flower brooch with pink and black rhinestones on a minimalist metal pin - Rhinestone Lily Flower Style (QHXZ1638)
Alloy Enamel Pin Set Cartoon Princess Silhouette Sun Totem Chameleon Magical Flower Rhinestone Brooch For Women Jewelry Gift
-9%
$0.50
No MOQ
Cute Cartoon Pickle Duck And Cat Enamel Lapel Pin Funny Dill With It Zinc Alloy Brooch Badge For Clothing Bag Accessories
Cute Cartoon Pickle Duck And Cat Enamel Lapel Pin Funny Dill With It Zinc Alloy Brooch Badge For Clothing Bag Accessories
like
Find Similar
Funny Dill with it enamel cat pickle pin with green enamel finish and metal lettering - Pickle Cat Style (QHXZ5665)
Creative white duck in a green cucumber suit enamel pin with metal texture - Pickle Duck Style (QHXZ5666)
Cute Cartoon Pickle Duck And Cat Enamel Lapel Pin Funny Dill With It Zinc Alloy Brooch Badge For Clothing Bag Accessories
-9%
$0.39
No MOQ
 · 
20 sold recently
Free Shipping
Era Series Enamel Pins Zinc Alloy Brooches For Backpacks Jackets In My Era Cowgirl Cozy Bookish Delulu Idgaf Lapel Pin Gift
Era Series Enamel Pins Zinc Alloy Brooches For Backpacks Jackets In My Era Cowgirl Cozy Bookish Delulu Idgaf Lapel Pin Gift
like
Find Similar
Enamel cowgirl era pin with black base yellow text and orange boots badge - Qhxz2012
Blue enamel pin with In My Cozy Era text featuring coffee and candle icons - Cozy Era Style (QHXZ2013)
Pink and white enamel badge featuring In My Delulu Era text on white background - Delulu Era Style (QHXZ2014)
Colorful enamel pin badge featuring 'IN MY Idgaf ERA' text and fun star motifs - Idgaf Era Style (QHXZ2015)
+1
Era Series Enamel Pins Zinc Alloy Brooches For Backpacks Jackets In My Era Cowgirl Cozy Bookish Delulu Idgaf Lapel Pin Gift
-9%
$0.47
No MOQ
Free Shipping
Alloy Soft Enamel Medal Brooch With Humorous Slogan Funny Reward Badge Pins For Backpacks Jackets Clothes Unisex Jewelry Gift
Alloy Soft Enamel Medal Brooch With Humorous Slogan Funny Reward Badge Pins For Backpacks Jackets Clothes Unisex Jewelry Gift
like
Find Similar
Star-shaped gold enamel pin with Stay Gold lettering and white finish - Stay Gold Star Shape (QHXZ1232)
Golden medal enamel pin with Stay Golden text and ribbon detail for clothing - Stay Golden Medal (QHXZ1233)
Honor medal style enamel pin featuring a yellow star and Only Cried A Little quote - Only Cried A Little Medal (QHXZ1633)
Golden medal enamel brooch featuring orange and yellow ribbon with didn't punch anyone text - Didn't Punch Anyone Orange Medal (QHXZ2607)
+9
Alloy Soft Enamel Medal Brooch With Humorous Slogan Funny Reward Badge Pins For Backpacks Jackets Clothes Unisex Jewelry Gift
-9%
$0.39-0.50
No MOQ
 · 
32 sold recently
Free Shipping
Gothic Purple Enamel Pins Crow Coffin Heart Dagger Alloy Badge Dark Quotes Halloween Personalized Brooches Jewelry For Backpack
Gothic Purple Enamel Pins Crow Coffin Heart Dagger Alloy Badge Dark Quotes Halloween Personalized Brooches Jewelry For Backpack
like
Find Similar
Gothic purple coffin enamel pin with Rot in Hell text and pink heart floral details - Purple Coffin Style (QHXZ1350)
Gothic purple heart enamel pin with dagger and 'Live through the pain' text - Heart Dagger Style (QHXZ1351)
Gothic raven enamel pin featuring No Mourners No Funerals quote in purple and black - Crow Silhouette Style (QHXZ1352)
Gothic Purple Enamel Pins Crow Coffin Heart Dagger Alloy Badge Dark Quotes Halloween Personalized Brooches Jewelry For Backpack
-10%
$0.52
Mix MOQ : 2
Funny Cartoon Enamel Brooch Pins For Clothing Backpack Funny Cat Duck Goose Possum Metal Badge Jewelry Accessory Decoration
Funny Cartoon Enamel Brooch Pins For Clothing Backpack Funny Cat Duck Goose Possum Metal Badge Jewelry Accessory Decoration
like
Find Similar
Cartoon alloy enamel pin featuring a funny white goose holding a silver knife in its beak - Goose With Knife (qhxz2853)
Creative dachshund hot dog enamel pin featuring a cute sausage dog in a bun accessory - Dachshund Hot Dog (qhxz3079)
Cartoon enamel cat pin with sunglasses and Cool Kids Never Die slogan in white - Cool Cat With Sunglasses (xz5782)
Funny enamel opossum pin with AUR NAUR text quote for bags and clothing decoration - Screaming Possum (qhxz2892)
Funny Cartoon Enamel Brooch Pins For Clothing Backpack Funny Cat Duck Goose Possum Metal Badge Jewelry Accessory Decoration
-8%
$0.42-0.58
No MOQ
Free Shipping
Vintage Cat Brooch For Women Zinc Alloy Animal Pin Rhinestone Enamel Kitty Lapel Pin Fashion Jewelry Accessories Gift
Vintage Cat Brooch For Women Zinc Alloy Animal Pin Rhinestone Enamel Kitty Lapel Pin Fashion Jewelry Accessories Gift
like
Find Similar
Vintage cat brooch with green crystals and blue gem eyes on white silk backdrop - XZ301 Vintage Green Cat
Retro cat brooch in gold finish with vibrant blue pear-cut crystal and multi-color stones - XZ113 Multicolor Gemstone Cat
Vintage silver cat brooch with blue enamel on broomstick with sparkling crystals - XZ301 Silver Broom Cat
Vintage gold brooch with a dark blue enamel cat walking on a crystal-studded broom - XZ301 Gold Broom Cat
+3
Vintage Cat Brooch For Women Zinc Alloy Animal Pin Rhinestone Enamel Kitty Lapel Pin Fashion Jewelry Accessories Gift
-11%
$0.31-0.76
No MOQ
 · 
29 sold recently
Enamel Christmas Brooch Pin Set Snowflake Snowman Christmas Tree Sock Gift Box Candy Cane Alloy Badge For Clothes Backpack Women Jewelry
Enamel Christmas Brooch Pin Set Snowflake Snowman Christmas Tree Sock Gift Box Candy Cane Alloy Badge For Clothes Backpack Women Jewelry
like
Find Similar
Detailed close-up of a Christmas stocking enamel pin with holly on beige satin fabric - Christmas Sock
Detail of Christmas snowman enamel pin with red scarf on champagne satin background - Snowman
Macro detail of snowflake enamel brooch with blue accents on golden metal base - Snowflake
Christmas candy cane enamel pin with green holly leaves on warm beige background - Candy Cane
+2
Enamel Christmas Brooch Pin Set Snowflake Snowman Christmas Tree Sock Gift Box Candy Cane Alloy Badge For Clothes Backpack Women Jewelry
-9%
$0.47
No MOQ
Free Shipping
Cool Sunglasses Dog Enamel Pin Brooch Cartoon Animal Badge Zinc Alloy Golden Retriever Husky German Shepherd Jewelry Gift
Cool Sunglasses Dog Enamel Pin Brooch Cartoon Animal Badge Zinc Alloy Golden Retriever Husky German Shepherd Jewelry Gift
like
Find Similar
Detailed view of enamel dog pin featuring a golden retriever wearing sunglasses - Golden Retriever Style (QHXZ5421)
Cute German Shepherd enamel pin wearing sunglasses and sticking out its tongue - German Shepherd Style (QHXZ5422)
Funny husky dog metal pin with blue sunglasses and playful tongue enamel finish - Husky Style (QHXZ5423)
Cool Sunglasses Dog Enamel Pin Brooch Cartoon Animal Badge Zinc Alloy Golden Retriever Husky German Shepherd Jewelry Gift
-8%
$0.45
No MOQ
 · 
62 sold recently
Funny Cartoon Cat Enamel Brooch Pin Set Zinc Alloy Black White Cat Mom Cat Daddy Badge For Clothing Backpack Jewelry Gift
Funny Cartoon Cat Enamel Brooch Pin Set Zinc Alloy Black White Cat Mom Cat Daddy Badge For Clothing Backpack Jewelry Gift
like
Find Similar
Enamel pin with black cat and MY CAT AND I TALK SHIT ABOUT YOU text design - Humor Slogan Cat Style (QHXZ5102)
Enamel cat pin featuring cool sunglasses and Cat Mom text for fashion accessories - Cat Mom Style (QHXZ5103)
Cartoon cool cat enamel pin badge with black sunglasses and CAT DADDY lettering - Cat Daddy Style (QHXZ5104)
Funny Cartoon Cat Enamel Brooch Pin Set Zinc Alloy Black White Cat Mom Cat Daddy Badge For Clothing Backpack Jewelry Gift
-8%
$0.42
No MOQ
 · 
20 sold recently
Creative Halloween Bat Animal Brooch For Men Women Gothic Zinc Alloy Enamel Drip Oil Pin Badge For Suit Clothing Accessory
Creative Halloween Bat Animal Brooch For Men Women Gothic Zinc Alloy Enamel Drip Oil Pin Badge For Suit Clothing Accessory
like
Find Similar
Halloween bat brooch for men in gold and black enamel finish with red eye accents - Individual Bat Shape (C337-A)
Creative Halloween Bat Animal Brooch For Men Women Gothic Zinc Alloy Enamel Drip Oil Pin Badge For Suit Clothing Accessory
-9%
$1.31
Mix MOQ : 3
 · 
12 sold recently
Free Shipping
Cartoon Butterfly Bat Wing Cat Enamel Brooch Zinc Alloy Cute Animal Badge Pin For Clothing Backpack Decoration Unisex Accessory
Cartoon Butterfly Bat Wing Cat Enamel Brooch Zinc Alloy Cute Animal Badge Pin For Clothing Backpack Decoration Unisex Accessory
like
Find Similar
Cute black cat with blue bat wings enamel pin for backpacks and clothing accessories - Bat Wing Black Cat Style (CZ0298-1)
Cute black cat enamel pin with light blue butterfly wings and an open book accessory - Butterfly Wing Black Cat with Book Style (CZ0298-2)
Cute enamel cat pin with blue butterfly wings and Cat Happy text on white background - Butterfly Wing White Cat Happy Style (CZ0298-3)
Cute butterfly cat enamel pin featuring blue wings and star patterns on a white background - Butterfly Wing White Cat with Stars Style (CZ0298-4)
Cartoon Butterfly Bat Wing Cat Enamel Brooch Zinc Alloy Cute Animal Badge Pin For Clothing Backpack Decoration Unisex Accessory
-7%
$0.37
No MOQ
Free Shipping
Punk Enamel Pin Skull Ghost Monstera Plant Leaf Zinc Alloy Badge For Backpack Clothing Decorative Brooch Gift Women Men Jewelry
Punk Enamel Pin Skull Ghost Monstera Plant Leaf Zinc Alloy Badge For Backpack Clothing Decorative Brooch Gift Women Men Jewelry
like
Find Similar
Creative metal enamel pin featuring a skeleton head design with green plants - Skull Design (QHXZ1970)
Pink cartoon ghost enamel pin hiding behind green monstera plant leaves in a pot - Ghost Design (QHXZ1971)
Cute enamel pin badge featuring a green monstera plant with small frogs and a brown pot - Frog Design (QHXZ1972)
Punk Enamel Pin Skull Ghost Monstera Plant Leaf Zinc Alloy Badge For Backpack Clothing Decorative Brooch Gift Women Men Jewelry
-7%
$0.58
No MOQ
 · 
70 sold recently
Free Shipping
Cartoon Enamel Cat Dog Coffee Cup Brooch Pin Paw Power Floral Animal Badge Cute Fashion Alloy Lapel Pin For Backpack Clothing
Cartoon Enamel Cat Dog Coffee Cup Brooch Pin Paw Power Floral Animal Badge Cute Fashion Alloy Lapel Pin For Backpack Clothing
like
Find Similar
Cute white cat in pink floral mug enamel pin with Paw Power engraving for pet lovers - White Cat Style (QHXZ5564)
Enamel lapel pin featuring a cute golden retriever puppy in a white coffee cup - Golden Retriever Style (QHXZ5565)
Cartoon Enamel Cat Dog Coffee Cup Brooch Pin Paw Power Floral Animal Badge Cute Fashion Alloy Lapel Pin For Backpack Clothing
-8%
$0.42
No MOQ
Free Shipping
Vintage Archangel Michael Brooch Saint Michael Religious Badge Alloy Glass Pin For Men Women Classic Decorative Jewelry Gift
Vintage Archangel Michael Brooch Saint Michael Religious Badge Alloy Glass Pin For Men Women Classic Decorative Jewelry Gift
like
Find Similar
Macro detail of Archangel Michael badge showing front art and back safety pin clasp - Saint Michael Defeating Demon Illustration Style (XSWX7955-1)
Vintage Archangel Saint Michael metal brooch pin with detailed religious illustration - Golden Brown Tone Saint Michael Art Style (XSWX7955-2)
Detail view of the round Archangel Michael brooch showing religious glass art and metal pin - Annunciation Stained Glass Style (XSWX7955-3)
Detail of St. Michael archangel brooch with stained glass style and secure safety pin - Warrior Angel Michael Painted Style (XSWX7955-4)
+4
Vintage Archangel Michael Brooch Saint Michael Religious Badge Alloy Glass Pin For Men Women Classic Decorative Jewelry Gift
-8%
$0.45
No MOQ
Cute Cartoon Cat Fruit Enamel Brooch Pin Set Zinc Alloy Avocado Strawberry Watermelon Badge Pins For Clothes Backpack Jewelry Gift
Cute Cartoon Cat Fruit Enamel Brooch Pin Set Zinc Alloy Avocado Strawberry Watermelon Badge Pins For Clothes Backpack Jewelry Gift
like
Find Similar
Peach-shaped enamel brooch with "DO YOUR SQUATS!" motivational text in orange and red - Peach Squat Style (QHXZ174)
Cute red apple enamel brooch with white cartoon cat peeking out from the center - Apple Cat Style (QHXZ309)
Creative pear shaped cat enamel brooch with yellow body and green leaf collar accessory - Pear Cat Style (QHXZ310)
Cute pineapple enamel pin featuring a white cat waving, cartoon style badge in yellow - Pineapple Cat Style (QHXZ311)
+8
Cute Cartoon Cat Fruit Enamel Brooch Pin Set Zinc Alloy Avocado Strawberry Watermelon Badge Pins For Clothes Backpack Jewelry Gift
-9%
$0.45-0.55
No MOQ
Tarot Card Style Enamel Brooch Pins For Women Men Alloy Cartoon Flower Cat Character Pattern Badges Fashion Jewelry Accessory
Tarot Card Style Enamel Brooch Pins For Women Men Alloy Cartoon Flower Cat Character Pattern Badges Fashion Jewelry Accessory
like
Find Similar
Pink tarot card enamel pin with flower pattern and It's Me text decoration - Pink Flower (QHXZ2149)
Tarot The Lover card enamel pin with blonde character and heart eyes in mint green - Qhxz2152
Tarot Card Style Enamel Brooch Pins For Women Men Alloy Cartoon Flower Cat Character Pattern Badges Fashion Jewelry Accessory
-9%
$0.55
No MOQ
Free Shipping
Funny Enamel Brooch Pin Alloy Cartoon Anxiety Cat And Raccoon Looking In Mirror Badge For Clothes Bag Decor Women Men Jewelry
Funny Enamel Brooch Pin Alloy Cartoon Anxiety Cat And Raccoon Looking In Mirror Badge For Clothes Bag Decor Women Men Jewelry
like
Find Similar
Lazy cat enamel pin with round glasses sitting on sofa with anxiety quote - Anxiety Cat On Sofa Style (QHXZ5570)
Cartoon raccoon enamel pin with i am beautiful quote looking in a mirror - Raccoon Looking in Mirror Style (QHXZ5571)
Funny Enamel Brooch Pin Alloy Cartoon Anxiety Cat And Raccoon Looking In Mirror Badge For Clothes Bag Decor Women Men Jewelry
-9%
$0.39
No MOQ
 · 
10 sold recently
Funny Enamel Cat Brooch With Christmas Lights Glitter Sparkling White Cat Animal Lapel Pin For Backpack Clothing Holiday Gift Jewelry
Funny Enamel Cat Brooch With Christmas Lights Glitter Sparkling White Cat Animal Lapel Pin For Backpack Clothing Holiday Gift Jewelry
like
Find Similar
Funny Christmas cat enamel brooch with colorful holiday lights and sparkling glitter finish - White Glitter Cat with Lights Style (CC1636)
Funny Enamel Cat Brooch With Christmas Lights Glitter Sparkling White Cat Animal Lapel Pin For Backpack Clothing Holiday Gift Jewelry
-8%
$0.71
No MOQ
Free Shipping
Inspirational Bible Verse Enamel Brooch God Is Within Her She Will Not Fall Psalm Round Zinc Alloy Religious Badge Pin
Inspirational Bible Verse Enamel Brooch God Is Within Her She Will Not Fall Psalm Round Zinc Alloy Religious Badge Pin
like
Find Similar
White round enamel pin with gold 'God is within her' Bible verse quote for women - Psalm 46:5 Bible Verse Style (QHXZ4114)
Inspirational Bible Verse Enamel Brooch God Is Within Her She Will Not Fall Psalm Round Zinc Alloy Religious Badge Pin
-8%
$0.42
No MOQ
Creative Cute Alpaca Brooch Pin For Women Alloy Enamel Animal Shape Anti-Exposure Accessory Cartoon Sheep Lapel Pin Gift
Creative Cute Alpaca Brooch Pin For Women Alloy Enamel Animal Shape Anti-Exposure Accessory Cartoon Sheep Lapel Pin Gift
like
Find Similar
Creative pink and white enamel sheep brooch with golden alloy base and curly hair texture - Pink
Cute white alpaca enamel brooch with curly wool texture on minimalist background - White
Creative Cute Alpaca Brooch Pin For Women Alloy Enamel Animal Shape Anti-Exposure Accessory Cartoon Sheep Lapel Pin Gift
-9%
$1.70
Mix MOQ : 3
 · 
24 sold recently
Free Shipping
Cute Cartoon Animal Enamel Brooch Pin Alloy Lacquer Polar Bear Pug Dog Unicorn Shape Clothing Bag Decoration Jewelry Gift
Cute Cartoon Animal Enamel Brooch Pin Alloy Lacquer Polar Bear Pug Dog Unicorn Shape Clothing Bag Decoration Jewelry Gift
like
Find Similar
Cartoon unicorn enamel pin with blue hair and yellow rubber duck for summer vacation look - Unicorn Cat With Rubber Duck (CC2343)
Creative enamel pin featuring a cute pug wearing a blue polka dot swimming ring - Pug Dog With Blue Swim Ring (CC2344)
Cartoon white cat enamel pin with sunglasses and swimming ring for beach vacation - Polar Bear With Yellow Swim Ring (CC2345)
Cute Cartoon Animal Enamel Brooch Pin Alloy Lacquer Polar Bear Pug Dog Unicorn Shape Clothing Bag Decoration Jewelry Gift
-9%
$0.65
No MOQ
Free Shipping
Funny Cartoon Black Cat Enamel Pin Set Humorous English Quotes Zinc Alloy Brooch Badge For Clothing Backpack Jewelry Gift
Funny Cartoon Black Cat Enamel Pin Set Humorous English Quotes Zinc Alloy Brooch Badge For Clothing Backpack Jewelry Gift
like
Find Similar
Yellow enamel cat pin featuring black cat playing with yarn and Caution Cat at Play text - Yellow Caution Sign (QHXZ2300)
Black cat enamel brooch with Are You Kitten Me lettering on white rectangle background - Are You Kitten Me (QHXZ2302)
Enamel pin featuring a black cat and 'Never trust a man who doesn't like cats' quote - Never Trust A Man (QHXZ2303)
Pink heart enamel pin featuring black and white cats and 'HOPE YOU LIKE CATS' text - Hope You Like Cats (QHXZ2304)
Funny Cartoon Black Cat Enamel Pin Set Humorous English Quotes Zinc Alloy Brooch Badge For Clothing Backpack Jewelry Gift
-9%
$0.47
No MOQ
 · 
13 views
Cute Christmas Black Cat Enamel Brooch Pin Alloy Snowman Tree Candy Cane Badges For Holiday Party Accessories Jewelry Gift
Cute Christmas Black Cat Enamel Brooch Pin Alloy Snowman Tree Candy Cane Badges For Holiday Party Accessories Jewelry Gift
like
Find Similar
Detail view of cartoon black cat Christmas brooch with dimensions 25mm x 24mm and 4g weight - Black Cat With Santa Hat (XZ3354-1)
Detail of cartoon black cat hugging Christmas tree enamel pin with size and weight specs - Black Cat With Christmas Tree (XZ3354-2)
Cartoon Christmas snowman enamel pin brooch with dimensions 30mm x 21mm and 3.5g weight - Christmas Snowman (XZ3354-3)
Detail of cartoon black cat enamel pin holding a candy cane with 30mm dimensions - Black Cat With Candy Cane (XZ3354-4)
Cute Christmas Black Cat Enamel Brooch Pin Alloy Snowman Tree Candy Cane Badges For Holiday Party Accessories Jewelry Gift
-8%
$0.34
Mix MOQ : 2
Free Shipping
Festive Christmas Enamel Brooch Pins Cute Snowman Gingerbread Man Reindeer Cup Shape Alloy Badge Gift For Clothing Decoration
Festive Christmas Enamel Brooch Pins Cute Snowman Gingerbread Man Reindeer Cup Shape Alloy Badge Gift For Clothing Decoration
like
Find Similar
Cute Christmas enamel mug brooch featuring a gingerbread man and marshmallow design - Gingerbread Man White Cup (QHXZ5028)
Christmas hot cocoa enamel pin featuring a marshmallow snowman and holly leaf design - Snowman Green Cup (QHXZ5029)
Festive Christmas Enamel Brooch Pins Cute Snowman Gingerbread Man Reindeer Cup Shape Alloy Badge Gift For Clothing Decoration
-8%
$0.45
No MOQ
Gothic Enamel Brooch Set Dark Punk Zinc Alloy Baphomet Goat Head Hail Satan Heart Star Pins For Backpack Clothing Unisex Jewelry Accessory
Gothic Enamel Brooch Set Dark Punk Zinc Alloy Baphomet Goat Head Hail Satan Heart Star Pins For Backpack Clothing Unisex Jewelry Accessory
like
Find Similar
Black and pink enamel pin with Hail Satan text and pentagram subculture design - Pink Text Style (QHXZ4940)
Gothic Enamel Brooch Set Dark Punk Zinc Alloy Baphomet Goat Head Hail Satan Heart Star Pins For Backpack Clothing Unisex Jewelry Accessory
-9%
$0.39
No MOQ
 · 
10 views
Free Shipping
Cartoon Jesus Square Enamel Brooch Pin Creative Inspirational Character Zinc Alloy Badge Jewelry Accessory For Clothing Bag
Cartoon Jesus Square Enamel Brooch Pin Creative Inspirational Character Zinc Alloy Badge Jewelry Accessory For Clothing Bag
like
Find Similar
Square enamel pin with Jesus illustration and I Believe In You motivational quote - Believe In You Style (QHXZ5195)
Square enamel pin with cartoon Jesus doing a heart gesture and Love you text - Love You Style (QHXZ5196)
Square enamel pin with Jesus holding yellow pom poms and Keep going My child text - Keep Going Style (QHXZ5197)
Cartoon Jesus Square Enamel Brooch Pin Creative Inspirational Character Zinc Alloy Badge Jewelry Accessory For Clothing Bag
-8%
$0.45
No MOQ
Cute Cat Shape Alloy Rhinestone Brooch Pin For Women Elegant Animal Design Gold Silver Plated Fashion Jewelry Accessory Gift
Cute Cat Shape Alloy Rhinestone Brooch Pin For Women Elegant Animal Design Gold Silver Plated Fashion Jewelry Accessory Gift
like
Find Similar
Golden alloy cat brooch with champagne rhinestones and size dimensions 3.1x2.0cm - Gold
Sparkly silver cat brooch with white rhinestones and black eyes for women's fashion - Silver
Cute Cat Shape Alloy Rhinestone Brooch Pin For Women Elegant Animal Design Gold Silver Plated Fashion Jewelry Accessory Gift
-9%
$1.18
No MOQ
 · 
11 sold recently
Cartoon Animal Enamel Pins Cute Cat Whale Pufferfish Jellyfish Brooches For Backpack Clothes Jacket Hat Alloy Jewelry Decor
Cartoon Animal Enamel Pins Cute Cat Whale Pufferfish Jellyfish Brooches For Backpack Clothes Jacket Hat Alloy Jewelry Decor
like
Find Similar
Cute blue whale enamel pin with golden metal outline for bags and clothing accessory - Deep Blue Spotted Whale Style (C1537-1)
Cute blue cartoon enamel dolphin pin with pink heart details and golden metal plating - Blue Anthropomorphic Jellyfish Style (C1537-2)
Cute yellow tabby cat in white heart teacup enamel pin badge for clothes and bags - Yellow Cat In Cup Style (C1537-3)
Cute pufferfish enamel pin in yellow and red with blue eyes and gold plating - Yellow Spotted Pufferfish Style (C1537-4)
Cartoon Animal Enamel Pins Cute Cat Whale Pufferfish Jellyfish Brooches For Backpack Clothes Jacket Hat Alloy Jewelry Decor
-21%
$0.41
No MOQ
Cute Cartoon Alloy Enamel Pin Set Pretzel Beetroot Teacup Shaped Badge For Clothing Bags Jacket Decoration Brooches Pins Jewelry Gift
Cute Cartoon Alloy Enamel Pin Set Pretzel Beetroot Teacup Shaped Badge For Clothing Bags Jacket Decoration Brooches Pins Jewelry Gift
like
Find Similar
Enamel pretzel brooch with Live Everyday Like Pretzel Day text in orange and beige finish - Pretzel Style (QHXZ2578)
Schrute Farms beet enamel pin with green leaves and red tuber on a white background - Beetroot Style (QHXZ2579)
Cute blue teacup enamel pin badge with pink tea and white text on a white background - Qhxz2580
Cute Cartoon Alloy Enamel Pin Set Pretzel Beetroot Teacup Shaped Badge For Clothing Bags Jacket Decoration Brooches Pins Jewelry Gift
-9%
$0.47
No MOQ
Free Shipping
Creative Cute Unicorn Horse Brooch Enamel Animal Lapel Pin Rhinestone Embellished Fashion Jewelry For Women Clothing Accessories Gift
Creative Cute Unicorn Horse Brooch Enamel Animal Lapel Pin Rhinestone Embellished Fashion Jewelry For Women Clothing Accessories Gift
like
Find Similar
Vintage carousel horse brooch with white enamel and sparkling rhinestones on golden alloy - White Unicorn (B092-A)
Detailed macro view of black enamel horse brooch with sparkling rhinestones and pink saddle - Black Running Horse (B092-B)
Creative Cute Unicorn Horse Brooch Enamel Animal Lapel Pin Rhinestone Embellished Fashion Jewelry For Women Clothing Accessories Gift
-13%
$1.72
Mix MOQ : 3
 · 
16 sold recently
Free Shipping
Creative Cartoon Black Cat Reading Books Enamel Pin Cute Kitten On Teacup Stacked Books Badge Zinc Alloy Brooch For Women Men
Creative Cartoon Black Cat Reading Books Enamel Pin Cute Kitten On Teacup Stacked Books Badge Zinc Alloy Brooch For Women Men
like
Find Similar
Cartoon enamel pin featuring a black cat lying on books with blue tones - Cat Lying On Books Style (QHXZ4326)
Cartoon black cat in blue coffee cup enamel pin brooch with creative reading book design - Cat In Teacup Reading Style (QHXZ4327)
Cartoon black cat reading a book enamel pin with yellow eyes and black metal outline - Cat Squatting On Open Book Style (QHXZ4328)
Cartoon black cat on blue books enamel pin, cute animal badge for book lovers - Cat Lying On Stacked Books Style (QHXZ4329)
Creative Cartoon Black Cat Reading Books Enamel Pin Cute Kitten On Teacup Stacked Books Badge Zinc Alloy Brooch For Women Men
-8%
$0.42
No MOQ
Free Shipping
Starry Sky Blue Ocean Creatures Enamel Brooch Shark Ray Whale Shark Glazed Alloy Pin Badge For Unisex Bag Jacket Jewelry
Starry Sky Blue Ocean Creatures Enamel Brooch Shark Ray Whale Shark Glazed Alloy Pin Badge For Unisex Bag Jacket Jewelry
like
Find Similar
Blue shark enamel brooch with colorful glitter and white wave pattern for bags - Shark Style (QHXZ5220)
Deep sea shark enamel pin badge with navy blue waves and sparkling moon design - Manta Ray Style (QHXZ5221)
Blue whale shark enamel brooch with ocean wave patterns and silver metallic edges - Whale Shark Style (QHXZ5222)
Starry Sky Blue Ocean Creatures Enamel Brooch Shark Ray Whale Shark Glazed Alloy Pin Badge For Unisex Bag Jacket Jewelry
-8%
$0.45
Mix MOQ : 2
 · 
11 sold recently
Free Shipping
Cute Cartoon Animal Plush Brooch Pin Handmade Embroidery For Women Kids Christmas Gift Small Bear Dog Alpaca Star Red New Year Fashion Brooch
Cute Cartoon Animal Plush Brooch Pin Handmade Embroidery For Women Kids Christmas Gift Small Bear Dog Alpaca Star Red New Year Fashion Brooch
like
Find Similar
Detail of star-shaped embroidery brooch on beige openwork knit vest and red sweater - Snowflake Star Style
Cute teddy bear brooch wearing a red heart sweater and green scarf on a wool coat - Scarf Bear Style
Navy blue knitted cardigan featuring colorful pom-pom buttons and a cute puppy embroidery - Dog With Hat Style
Detail of red cable-knit sweater with a cute plush alpaca brooch and small star embroidery - Beige Alpaca Style
+2
Cute Cartoon Animal Plush Brooch Pin Handmade Embroidery For Women Kids Christmas Gift Small Bear Dog Alpaca Star Red New Year Fashion Brooch
-14%
$1.05-1.29
No MOQ
Free Shipping
Cartoon Cute Corgi Dog Enamel Pin Set Alloy Animal Brooch Badge For Backpack Clothing Funny Letter Decoration Gift
Cartoon Cute Corgi Dog Enamel Pin Set Alloy Animal Brooch Badge For Backpack Clothing Funny Letter Decoration Gift
like
Find Similar
Cartoon corgi dog enamel pin with butterfly wings and golden metal plating finish - Corgi with Butterfly Wings (QHXZ106)
Cute cartoon corgi dog sitting in a flower pot enamel pin with daisy floral details - Corgi in Flower Pot (QHXZ689)
Cartoon Corgi hot dog enamel pin with red flames on a clean white background - Hot Dog Corgi (QHXZ868)
Cute enamel corgi butt badge with I Love You heart design for dog lovers jewelry - Corgi Butt Heart (QHXZ1442)
+4
Cartoon Cute Corgi Dog Enamel Pin Set Alloy Animal Brooch Badge For Backpack Clothing Funny Letter Decoration Gift
-10%
$0.45-0.52
No MOQ
Free Shipping
Cute Cartoon Cat Enamel Brooch Pins For Women Men Nurse Scientist Cat Metal Badge Jewelry Gift For Bag Clothes Accessories
Cute Cartoon Cat Enamel Brooch Pins For Women Men Nurse Scientist Cat Metal Badge Jewelry Gift For Bag Clothes Accessories
like
Find Similar
Cute enamel cat pin wearing lab coat and goggles conducting a science experiment - Scientist Cat Style (QHXZ5266)
Funny cat enamel pin featuring a white kitten in a pink nurse outfit with medical tools - Nurse Cat Style (QHXZ5267)
Cute Cartoon Cat Enamel Brooch Pins For Women Men Nurse Scientist Cat Metal Badge Jewelry Gift For Bag Clothes Accessories
-8%
$0.42
No MOQ
Free Shipping
Enamel Flower Brooch Pin I Can Do All Things Through Christ Bible Verse Alloy White Gold Floral Badge Jewelry Accessory
Enamel Flower Brooch Pin I Can Do All Things Through Christ Bible Verse Alloy White Gold Floral Badge Jewelry Accessory
like
Find Similar
White flower metal brooch with gold trim and I Can Do All Things Through Christ engraving - White Floral Quote Style (QHXZ1223)
Enamel Flower Brooch Pin I Can Do All Things Through Christ Bible Verse Alloy White Gold Floral Badge Jewelry Accessory
-8%
$0.42
No MOQ
Festive Christmas Enamel Brooch Pin Cartoon Santa Claus Reindeer Christmas Tree Gingerbread House Alloy Badge Jewelry For Party
Festive Christmas Enamel Brooch Pin Cartoon Santa Claus Reindeer Christmas Tree Gingerbread House Alloy Badge Jewelry For Party
like
Find Similar
Christmas reindeer sleigh brooch in colorful enamel for holiday season outfit decoration - Deer Style
Christmas Santa Claus in a colorful gift box enamel brooch with festive details - Santa Gift Box Style
Christmas tree enamel brooch pin with colorful holiday ornaments and golden star - Christmas Tree Style
Christmas Gingerbread House Brooch with Warm Orange Enamel and Festive Bow Detail - Gingerbread House Style
+2
Festive Christmas Enamel Brooch Pin Cartoon Santa Claus Reindeer Christmas Tree Gingerbread House Alloy Badge Jewelry For Party
-7%
$0.58
No MOQ
Free Shipping
Overstimulated Slogan Enamel Pin Alloy Lettering Brooch Sorry If I Am Mean Quote Badge For Backpack Clothing Accessory Unisex
Overstimulated Slogan Enamel Pin Alloy Lettering Brooch Sorry If I Am Mean Quote Badge For Backpack Clothing Accessory Unisex
like
Find Similar
Enamel metal pin badge with black text sorry if i'm mean on a silver base and white background - Emotional Slogan Style (QHXZ3087)
Overstimulated Slogan Enamel Pin Alloy Lettering Brooch Sorry If I Am Mean Quote Badge For Backpack Clothing Accessory Unisex
-9%
$0.47
No MOQ
 · 
26 sold recently
Free Shipping
Christmas Gingerbread Man Enamel Brooch Pin Zinc Alloy Cartoon House Cat Bow Badge For Party Clothes Backpack Accessories
Christmas Gingerbread Man Enamel Brooch Pin Zinc Alloy Cartoon House Cat Bow Badge For Party Clothes Backpack Accessories
like
Find Similar
Christmas gingerbread style bow enamel pin with icing details and festive colorful dots - Christmas Bow Style (QHXZ4922)
Christmas gingerbread house enamel brooch pin with cute candy cane and cookies - Gingerbread House Style (QHXZ4923)
Cute gingerbread man enamel pin with Christmas hat and coffee cup holiday badge - Gingerbread Man Style (QHXZ4924)
Detail of gingerbread cat enamel pin with festive icing patterns and candy cane tail - Gingerbread Cat Style (QHXZ4925)
Christmas Gingerbread Man Enamel Brooch Pin Zinc Alloy Cartoon House Cat Bow Badge For Party Clothes Backpack Accessories
-8%
$0.42
No MOQ
Free Shipping
Cartoon Dabbing Jesus Sheep Enamel Brooch Pin Alloy Lacquer Lapel Pins For Clothing Backpack Unisex Decorative Jewelry
Cartoon Dabbing Jesus Sheep Enamel Brooch Pin Alloy Lacquer Lapel Pins For Clothing Backpack Unisex Decorative Jewelry
like
Find Similar
Detailed view of Jesus enamel pin in trendy dab pose with vibrant colors and gold outline - Dabbing Cartoon Figure Style (W7811)
Macro detail of cute cartoon sheep brooch with colorful enamel finish and gold plated edges - Cute Cartoon Sheep Style (W7812)
Cartoon Dabbing Jesus Sheep Enamel Brooch Pin Alloy Lacquer Lapel Pins For Clothing Backpack Unisex Decorative Jewelry
-9%
$0.39
Mix MOQ : 2
Free Shipping
Alloy Enamel Rhinestone Brooch Pin Stacked Books And Glasses Design Vintage Creative Clothing Accessory For Women Men Gift
Alloy Enamel Rhinestone Brooch Pin Stacked Books And Glasses Design Vintage Creative Clothing Accessory For Women Men Gift
like
Find Similar
Creative enamel book and glasses brooch with rhinestones for men and women 3.9cm - Colorful
Enamel book stack and eyeglasses brooch with rhinestones for men and women - Blue
Alloy Enamel Rhinestone Brooch Pin Stacked Books And Glasses Design Vintage Creative Clothing Accessory For Women Men Gift
-9%
$2.10
No MOQ
Free Shipping
Alloy Enamel Brooch Personalized Heart Round Shape Slogan Badge For Clothing Backpack Decoration Unisex Fashion Accessory
Alloy Enamel Brooch Personalized Heart Round Shape Slogan Badge For Clothing Backpack Decoration Unisex Fashion Accessory
like
Find Similar
Black heart enamel pin featuring I Love Lying text with a red heart icon - I LYING Style (xz8411)
Black heart enamel pin featuring I Love Emo Boys text with polished silver metal edges - I EMO BOYS Style (xz8412)
Alloy Enamel Brooch Personalized Heart Round Shape Slogan Badge For Clothing Backpack Decoration Unisex Fashion Accessory
-9%
$0.50
No MOQ
Cartoon Ghost Enamel Pin Living The Dream One Nightmare At A Time Alloy Round Brooch Badge For Bags Clothing Halloween Gift
Cartoon Ghost Enamel Pin Living The Dream One Nightmare At A Time Alloy Round Brooch Badge For Bags Clothing Halloween Gift
like
Find Similar
Round enamel pin featuring a smiling ghost with butterflies and stars decoration - Ghost Slogan Round Brooch (QHXZ3772)
Cartoon Ghost Enamel Pin Living The Dream One Nightmare At A Time Alloy Round Brooch Badge For Bags Clothing Halloween Gift
-8%
$0.42
No MOQ
 · 
10 sold recently
Funny Cartoon Opossum Fairy Godpossum Enamel Pin With Wings Wand Alloy Lacquer Brooch Badge For Clothing Bag Decoration
Funny Cartoon Opossum Fairy Godpossum Enamel Pin With Wings Wand Alloy Lacquer Brooch Badge For Clothing Bag Decoration
like
Find Similar
Cute Fairy Godpossum enamel pin with wings and magic wand featuring humorous text - Fairy Godmother Opossum Style(QHXZ4419)
Funny Cartoon Opossum Fairy Godpossum Enamel Pin With Wings Wand Alloy Lacquer Brooch Badge For Clothing Bag Decoration
-9%
$0.47
No MOQ
Cute Cartoon Black Cat Enamel Brooch Pin Creative Plant Coffee Book Series Alloy Badge For Clothes Backpack Accessories Gift Unisex
Cute Cartoon Black Cat Enamel Brooch Pin Creative Plant Coffee Book Series Alloy Badge For Clothes Backpack Accessories Gift Unisex
like
Find Similar
Cute black enamel cat pin with yellow eyes and pink flowers on top, cartoon style badge - Black Cat With Pink Flowers (xz5258)
Cute black soot sprite enamel pin featuring colorful flowers and vibrant green leaves - Black Soot Sprite With Flowers (xz8259)
Cartoon black cat enamel pin with large yellow eyes and a small green sprout on its head - Black Cat Head With Sprout (xz8252)
Cute black cat enamel pin with big yellow eyes and minimalist polished metal finish - Minimalist Big Eye Black Cat (xz8254)
+10
Cute Cartoon Black Cat Enamel Brooch Pin Creative Plant Coffee Book Series Alloy Badge For Clothes Backpack Accessories Gift Unisex
-9%
$0.47-0.60
No MOQ
Free Shipping
Cute Cartoon Cat Enamel Brooch Pins Zinc Alloy Cat Head Biscuit And Pink Candy Bag Lapel Pin Badge For Bags Clothing Women
Cute Cartoon Cat Enamel Brooch Pins Zinc Alloy Cat Head Biscuit And Pink Candy Bag Lapel Pin Badge For Bags Clothing Women
like
Find Similar
Cat-shaped chocolate biscuit enamel brooch with cute pink filling detail - Cat Biscuit Style (QHXZ3977)
Cute Cartoon Cat Enamel Brooch Pins Zinc Alloy Cat Head Biscuit And Pink Candy Bag Lapel Pin Badge For Bags Clothing Women
-8%
$0.42
No MOQ
Free Shipping
Elegant Enamel Hummingbird Brooch For Women Alloy Rhinestone Bird Pin Jewelry Accessories For Suits Sweaters Party Gifts
Elegant Enamel Hummingbird Brooch For Women Alloy Rhinestone Bird Pin Jewelry Accessories For Suits Sweaters Party Gifts
like
Find Similar
Exquisite hummingbird brooch with blue enamel and yellow gemstone on a jewelry stand - Blue
Exquisite hummingbird brooch with orange enamel and green wings inlaid with colorful gems - Green
Elegant Enamel Hummingbird Brooch For Women Alloy Rhinestone Bird Pin Jewelry Accessories For Suits Sweaters Party Gifts
-7%
$0.58
No MOQ
 · 
100 sold recently
Gothic Movie Style Enamel Brooch Pin Set Zinc Alloy Striped Rose Spider Web Planchette Badge For Halloween Party Clothing Accessories
Gothic Movie Style Enamel Brooch Pin Set Zinc Alloy Striped Rose Spider Web Planchette Badge For Halloween Party Clothing Accessories
like
Find Similar
Stay Weird enamel pin with black and white stripes and green wavy edge for apparel decoration - Heart Stay Weird Style (QHXZ2960)
Ghost With the Most enamel pin featuring a green medallion design and striped ribbons - Ghost With the Most Medal Style (QHXZ2961)
Gothic Movie Style Enamel Brooch Pin Set Zinc Alloy Striped Rose Spider Web Planchette Badge For Halloween Party Clothing Accessories
-8%
$0.45
No MOQ
 · 
10 views
Vintage Poodle Dog Brooch Pin For Women Alloy Rhinestone Animal Breastpin Fashion Suit Coat Accessories Banquet Jewelry Gift
Vintage Poodle Dog Brooch Pin For Women Alloy Rhinestone Animal Breastpin Fashion Suit Coat Accessories Banquet Jewelry Gift
like
Find Similar
Sparkling vintage poodle dog brooch with amber and pink crystals on golden metal base - Champagne Poodle Style (XZ0249-1)
Sparkling pink rhinestone poodle brooch in gold plating for elegant suit decoration - Pink Poodle Style (XZ0249-2)
Vintage Poodle Dog Brooch Pin For Women Alloy Rhinestone Animal Breastpin Fashion Suit Coat Accessories Banquet Jewelry Gift
-8%
$1.47
No MOQ
 · 
1 reviews
Free Shipping
Cartoon Purple Magic Cat Enamel Brooch Pin Butterfly Wings Bat Wizard Hat For Backpack Clothes Decoration Jewelry Gift
Cartoon Purple Magic Cat Enamel Brooch Pin Butterfly Wings Bat Wizard Hat For Backpack Clothes Decoration Jewelry Gift
like
Find Similar
Cartoon purple wizard cat enamel pin with magic book and hat for clothing decoration - Wizard Cat Style / Black Cat Wizard (XZ7090)
Detail of enamel cat pin with purple butterfly wings and celestial star pattern - Side Butterfly Cat Style / White Cat with Butterfly Wings (XZ7091)
Detail of enamel pin featuring a wizard cat with purple butterfly wings and star accents - Back Butterfly Cat Style / Cow Cat with Butterfly Wings (XZ7092)
Detail of a black and white enamel cat brooch with purple butterfly wings for Halloween - Spreading Wings Butterfly Cat Style / Sitting Butterfly Cat (XZ7093)
+1
Cartoon Purple Magic Cat Enamel Brooch Pin Butterfly Wings Bat Wizard Hat For Backpack Clothes Decoration Jewelry Gift
-9%
$0.60
No MOQ
Free Shipping
Humorous Art Duck Enamel Pin Set Alloy Cartoon Famous Painting Parody Brooch Badge For Backpack Clothing Hat Jacket Accessories Unisex
Humorous Art Duck Enamel Pin Set Alloy Cartoon Famous Painting Parody Brooch Badge For Backpack Clothing Hat Jacket Accessories Unisex
like
Find Similar
Funny agent duck enamel pin in a black suit with sunglasses and yellow pistols - Agent Duck With Guns (XZ6923)
Cute white cartoon duck enamel pin featuring a shy pose with yellow beak and feet - Shy Duck (XZ6925)
Enamel pin featuring a cartoon white duck mimicking The Scream painting in a square frame - The Scream Duck (XZ6929)
Humorous Art Duck Enamel Pin Set Alloy Cartoon Famous Painting Parody Brooch Badge For Backpack Clothing Hat Jacket Accessories Unisex
-9%
$0.65
No MOQ
Free Shipping
Magic Potion Bottle Enamel Pin Set Mushroom Botanical Alloy Brooch For Backpack Jacket Clothes Decoration Unisex Jewelry Gift
Magic Potion Bottle Enamel Pin Set Mushroom Botanical Alloy Brooch For Backpack Jacket Clothes Decoration Unisex Jewelry Gift
like
Find Similar
Cartoon pink potion bottle enamel pin featuring mushrooms and Wonder text label - Wonder Style (QHXZ849)
Cartoon potion bottle enamel pin with mint green mushrooms and a DREAM tag - DREAM Style (QHXZ850)
Cartoon magic potion bottle enamel pin with mushrooms and Made of Magic lettering - MADE OF MAGIC Style (QHXZ851)
Cute mushroom potion bottle enamel pin with 'Drink Up' tag and pink liquid detail - DRINK UP Style (QHXZ852)
+1
Magic Potion Bottle Enamel Pin Set Mushroom Botanical Alloy Brooch For Backpack Jacket Clothes Decoration Unisex Jewelry Gift
-9%
$0.60
No MOQ
 · 
11 sold recently
Free Shipping
Humorous Slogan Enamel Pin Set Alloy Lettering Brooch Always Right Badge For Backpack Clothing Decor Personality Jewelry Gift
Humorous Slogan Enamel Pin Set Alloy Lettering Brooch Always Right Badge For Backpack Clothing Decor Personality Jewelry Gift
like
Find Similar
Square enamel pin with white text 'YES I AM ALWAYS RIGHT' on a sleek black background - YES I AM ALWAYS RIGHT Slogan Style (QHXZ2668)
Enamel brooch with I'M ALWAYS WRITE slogan featuring a creative pen nib design - I'M ALWAYS WRITE Slogan Style (QHXZ2669)
Humorous Slogan Enamel Pin Set Alloy Lettering Brooch Always Right Badge For Backpack Clothing Decor Personality Jewelry Gift
-9%
$0.47
No MOQ
Cartoon Enamel Brooch Pin Sun Moon Candy Heart Gesture Zinc Alloy Badge Accessories For Backpack Clothing Kids Gift
Cartoon Enamel Brooch Pin Sun Moon Candy Heart Gesture Zinc Alloy Badge Accessories For Backpack Clothing Kids Gift
like
Find Similar
Creative enamel pin featuring hand heart gesture with red crab claw and yellow bell - Heart Gesture (QHXZ4977)
Cute candy-shaped enamel pin with sun pattern in orange and white finish - Sun Candy (QHXZ4978)
Cute candy-shaped enamel pin with blue crescent moon and yellow wrapper patterns - Moon Candy (QHXZ4979)
+4
Cartoon Enamel Brooch Pin Sun Moon Candy Heart Gesture Zinc Alloy Badge Accessories For Backpack Clothing Kids Gift
-8%
$0.42
No MOQ
Free Shipping
Cute Pink White Ghost Enamel Pin Cartoon Halloween Alloy Brooch Funny Spooky Ghost Badge For Bags Clothing Hat Accessories
Cute Pink White Ghost Enamel Pin Cartoon Halloween Alloy Brooch Funny Spooky Ghost Badge For Bags Clothing Hat Accessories
like
Find Similar
Cute white ghost enamel pin with Little Lonely Soul ribbon detail for Halloween - Little Lonely Soul Pattern (QHXZ1274)
Funny ghost enamel pin badge with 'I SEE REAL PEOPLE' text and pink cheeks details - I See Real People Pattern (QHXZ1276)
Funny ghost enamel pin wearing sunglasses with This Is Boo Sheet text decoration - Tongue Out Ghost Pattern (QHXZ1278)
Cute white ghost enamel pin with pink sunglasses and FAB-BOO-LOUS text for Halloween - Pink Sunglasses Ghost Pattern (QHXZ1279)
+1
Cute Pink White Ghost Enamel Pin Cartoon Halloween Alloy Brooch Funny Spooky Ghost Badge For Bags Clothing Hat Accessories
-9%
$0.50
No MOQ
Free Shipping
Pink Butterfly Bow Stethoscope Enamel Pin Cute Medical Nursing Brooch Badge For Nurse Doctor Gift Professional Accessory
Pink Butterfly Bow Stethoscope Enamel Pin Cute Medical Nursing Brooch Badge For Nurse Doctor Gift Professional Accessory
like
Find Similar
Pink ribbon bow with stethoscope enamel brooch pin for medical professionals - Stethoscope Bowknot Style (QHXZ4184)
Pink bow medical brooch with stethoscope and pill bottle icon on white background - Medical Elements Bowknot Style (QHXZ4185)
Pink Butterfly Bow Stethoscope Enamel Pin Cute Medical Nursing Brooch Badge For Nurse Doctor Gift Professional Accessory
-9%
$0.39-0.47
No MOQ
 · 
12 views
Creative Laboratory Glassware Enamel Pin Collection Alloy Botanical Daisy Rose Flower Brooch Cartoon Badge For Women Gift
Creative Laboratory Glassware Enamel Pin Collection Alloy Botanical Daisy Rose Flower Brooch Cartoon Badge For Women Gift
like
Find Similar
Cartoon test tube enamel pin with pink liquid and golden finish for accessory - Pink Test Tube Star Heart Style (WY1456)
Cartoon beaker enamel pin featuring a white bong design with a green leaf and gold trim - Cannabis Leaf Bong Shape (WY1457)
Pink heart and green botanical motif on laboratory flask enamel pin with gold plating - Green Plant Bud Flask (WY1458)
Pink rose flowers in blue flask enamel pin with gold plating for women's clothing - Pink Rose Round Bottom Flask (WY1459)
+1
Creative Laboratory Glassware Enamel Pin Collection Alloy Botanical Daisy Rose Flower Brooch Cartoon Badge For Women Gift
-9%
$0.50
Mix MOQ : 2
Free Shipping
Go to

More in accessories

Explore more in angel pins

alloyartificial pearlheartgirlstylepartyshapedecorativedesigngold plated rhinestone
goldsuitinlaideyewhitemetalkidsplated rhinestonestarsphone

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access