Everful

Wholesale art posters

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Art Posters

Find the perfect pieces: wall stickers, window stickers, kitchen stickers and more

All products in art posters

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Autumn Wreath Welcome Door Sticker PVC Squirrel Pumpkin Maple Leaf Wall Decal Decorative Warm Home Art For Bedroom Entryway
Autumn Wreath Welcome Door Sticker PVC Squirrel Pumpkin Maple Leaf Wall Decal Decorative Warm Home Art For Bedroom Entryway
like
Find Similar
Welcome autumn wreath wall sticker with squirrel and pumpkin for home decor 30x30cm - 30*30cm
Autumn Wreath Welcome Door Sticker PVC Squirrel Pumpkin Maple Leaf Wall Decal Decorative Warm Home Art For Bedroom Entryway
$0.95
Mix MOQ : 2
Colorful Caterpillar Numbers Wall Sticker PVC Self Adhesive Removable Decor For Kids Room Bedroom Educational Art
Colorful Caterpillar Numbers Wall Sticker PVC Self Adhesive Removable Decor For Kids Room Bedroom Educational Art
like
Find Similar
Colorful number caterpillar wall decal with butterflies and flowers for kids room - Colorful Caterpillar Numbers Style (M18064)
Colorful Caterpillar Numbers Wall Sticker PVC Self Adhesive Removable Decor For Kids Room Bedroom Educational Art
$1.44
Mix MOQ : 2
White Line Art Butterfly Flower Static Window Cling PVC Glass Decals Decorative Stickers For Home Office
White Line Art Butterfly Flower Static Window Cling PVC Glass Decals Decorative Stickers For Home Office
like
Find Similar
White butterfly and floral window static cling stickers with dimensions 30x60cm for home decor - 1 Sheet (Cotton Swab Roll) / White Flower & Bird Line (CJ2621)
White Line Art Butterfly Flower Static Window Cling PVC Glass Decals Decorative Stickers For Home Office
$1.67
No MOQ
Vintage Bronze Female Figure Sculpture Alloy Copper Plated Art Statue For Home Office Desk Decor Fitness Trophy Ornament
Vintage Bronze Female Figure Sculpture Alloy Copper Plated Art Statue For Home Office Desk Decor Fitness Trophy Ornament
like
Find Similar
Artistic bronze female sculpture fitness trophy for desk decor and gym inspiration - Self-disciplined Beauty / Bronze
Vintage Bronze Female Figure Sculpture Alloy Copper Plated Art Statue For Home Office Desk Decor Fitness Trophy Ornament
$3.75
No MOQ
Christmas Reindeer Wreath Wall Sticker PVC Waterproof Self Adhesive Cartoon Floral Art Decal For Living Room Kids Room
Christmas Reindeer Wreath Wall Sticker PVC Waterproof Self Adhesive Cartoon Floral Art Decal For Living Room Kids Room
like
Find Similar
Detail view of Oh Deer Christmas wall sticker with colorful reindeer and wreath patterns - 40*40CM in Bag
Christmas Reindeer Wreath Wall Sticker PVC Waterproof Self Adhesive Cartoon Floral Art Decal For Living Room Kids Room
-5%
$1.04
No MOQ
Christmas Wall Sticker Santa Claus Wreath PVC Removable Decal For Window Door Home Decor Festive Holiday Art
Christmas Wall Sticker Santa Claus Wreath PVC Removable Decal For Window Door Home Decor Festive Holiday Art
like
Find Similar
Christmas Santa Claus wreath wall sticker decoration for doors and windows display - Santa Claus Wreath
Christmas Wall Sticker Santa Claus Wreath PVC Removable Decal For Window Door Home Decor Festive Holiday Art
$0.86
No MOQ
White Resin Krishna Statue Indian God Figurine For Home Decor Desktop Sculpture Spiritual Ornament Religious Art Gift
White Resin Krishna Statue Indian God Figurine For Home Decor Desktop Sculpture Spiritual Ornament Religious Art Gift
like
Find Similar
White Krishna resin statue playing flute, Hindu god decor, 24.5cm height dimension view - Krishna Playing Flute Style
NewWhite Resin Krishna Statue Indian God Figurine For Home Decor Desktop Sculpture Spiritual Ornament Religious Art Gift
-4%
$9.86
No MOQ
3D Pink Rose Toilet Lid Sticker Waterproof Self Adhesive Bathroom Wall Decal Modern Floral PVC Decorative Sticker Home Art
3D Pink Rose Toilet Lid Sticker Waterproof Self Adhesive Bathroom Wall Decal Modern Floral PVC Decorative Sticker Home Art
like
Find Similar
Pink rose floral toilet lid sticker waterproof self-adhesive home bathroom decoration - Pink Rose (PH_QTB154)
3D Pink Rose Toilet Lid Sticker Waterproof Self Adhesive Bathroom Wall Decal Modern Floral PVC Decorative Sticker Home Art
$0.89
No MOQ
3D Realistic Snake Toilet Sticker Bathroom PVC Removable Waterproof Wall Art Decal Prank Decor Minimalist Style Brown
3D Realistic Snake Toilet Sticker Bathroom PVC Removable Waterproof Wall Art Decal Prank Decor Minimalist Style Brown
like
Find Similar
Scary 3D striped snake toilet lid sticker decorative removable PVC decal 30x30cm - 30*30cm(ZC568) / Brown
Striped snake 3D toilet sticker decal variant showing 30x30cm layout size dimensions - 30*30cm(PE847) / Brown
3D Realistic Snake Toilet Sticker Bathroom PVC Removable Waterproof Wall Art Decal Prank Decor Minimalist Style Brown
$0.81
Mix MOQ : 4
Family Quotes Wall Sticker PVC Floral Vine Bird Decal Removable Home Decor Living Room Bedroom DIY Art Mural
Family Quotes Wall Sticker PVC Floral Vine Bird Decal Removable Home Decor Living Room Bedroom DIY Art Mural
like
Find Similar
Floral Family wall sticker with birds and inspirational quote for home kitchen decor - 30x90cm
Family Quotes Wall Sticker PVC Floral Vine Bird Decal Removable Home Decor Living Room Bedroom DIY Art Mural
$1.53
Mix MOQ : 2
But First Coffee Wall Stickers PVC Coffee Cup Heart Beans Decal For Kitchen Cafe Restaurant Modern Art Decor
But First Coffee Wall Stickers PVC Coffee Cup Heart Beans Decal For Kitchen Cafe Restaurant Modern Art Decor
like
Find Similar
Self-adhesive coffee cup wall sticker with heart smoke design and coffee beans motif - 20x30cm(MS4216-ZC)
But First Coffee Wall Stickers PVC Coffee Cup Heart Beans Decal For Kitchen Cafe Restaurant Modern Art Decor
$0.66
Mix MOQ : 2
Red Rose Flower Vine Butterfly Wall Sticker PVC Self Adhesive Removable Home Art Mural Decor For Living Room Bedroom Background
Red Rose Flower Vine Butterfly Wall Sticker PVC Self Adhesive Removable Home Art Mural Decor For Living Room Bedroom Background
like
Find Similar
Detail showing red rose vine butterfly wall sticker dimensions and layout diagram - MS2208 (30*90cm)
Red Rose Flower Vine Butterfly Wall Sticker PVC Self Adhesive Removable Home Art Mural Decor For Living Room Bedroom Background
$1.44
Mix MOQ : 2
Mermaid Toilet Sticker Waterproof PVC Underwater Seaweed Jellyfish Removable Bathroom Wall Art Decal Cartoon Decor
Mermaid Toilet Sticker Waterproof PVC Underwater Seaweed Jellyfish Removable Bathroom Wall Art Decal Cartoon Decor
like
Find Similar
Mermaid and jellyfish ocean wall stickers for bathroom decor with size dimensions - 30*35cm*2 Sheets
Mermaid Toilet Sticker Waterproof PVC Underwater Seaweed Jellyfish Removable Bathroom Wall Art Decal Cartoon Decor
$1.30
Mix MOQ : 2
Wall Mounted Dinner Bell Cast Iron Vintage European Scroll Pattern Decorative Outdoor Garden Home Rustic Iron Art
Wall Mounted Dinner Bell Cast Iron Vintage European Scroll Pattern Decorative Outdoor Garden Home Rustic Iron Art
like
Find Similar
European vintage bronze iron doorbell with ornate embossed patterns and mounting screws - Retro Pattern Wind Chime Pendant 7506
Wall Mounted Dinner Bell Cast Iron Vintage European Scroll Pattern Decorative Outdoor Garden Home Rustic Iron Art
-5%
$13.41
No MOQ
Christmas Toilet Lid Decals PVC Removable Bathroom Stickers Colorful Ball Pine Branch Holiday Home Decoration Wall Art
Christmas Toilet Lid Decals PVC Removable Bathroom Stickers Colorful Ball Pine Branch Holiday Home Decoration Wall Art
like
Find Similar
Detailed size specifications for Christmas bauble wall stickers with pine branch design - 29*29CM/xmas139
Christmas Toilet Lid Decals PVC Removable Bathroom Stickers Colorful Ball Pine Branch Holiday Home Decoration Wall Art
$0.86
No MOQ
Summer Mediterranean Ocean Style Round Wooden Wall Decor Starfish Shell Beach Hollow Art Home Wall Hanging Decor Ornaments
Summer Mediterranean Ocean Style Round Wooden Wall Decor Starfish Shell Beach Hollow Art Home Wall Hanging Decor Ornaments
like
Find Similar
Set of 4 round nautical wooden wall signs with starfish beach prints and hanging hooks - Ocean Theme Style (Y24Y50955_Q) / 20cmx0.5cm (4 Blocks)
Summer Mediterranean Ocean Style Round Wooden Wall Decor Starfish Shell Beach Hollow Art Home Wall Hanging Decor Ornaments
$6.07
Mix MOQ : 2
Waterproof 3D Dolphin Wall Sticker Ocean Animal PVC Decal for Bathroom Bedroom Home Decor Removable Self Adhesive Bubbles Art
Waterproof 3D Dolphin Wall Sticker Ocean Animal PVC Decal for Bathroom Bedroom Home Decor Removable Self Adhesive Bubbles Art
like
Find Similar
Detailed dimension guide for dolphin wall stickers set with size labels in centimeters - Dolphin Bubbles (CT26Y80250T_R) / 60*40cm
Waterproof 3D Dolphin Wall Sticker Ocean Animal PVC Decal for Bathroom Bedroom Home Decor Removable Self Adhesive Bubbles Art
$1.87
Mix MOQ : 2
Mysterious Mystical Hand Moon Stars Eye PVC Toilet Sticker Bohemian Home Decor Wall Decal Waterproof Bathroom Art Mural
Mysterious Mystical Hand Moon Stars Eye PVC Toilet Sticker Bohemian Home Decor Wall Decal Waterproof Bathroom Art Mural
like
Find Similar
Layout and size details of celestial wall stickers featuring eye and moon symbols - TA143 (30x30)
Mysterious Mystical Hand Moon Stars Eye PVC Toilet Sticker Bohemian Home Decor Wall Decal Waterproof Bathroom Art Mural
$0.92
Mix MOQ : 4
Nordic Irregular Layered Acrylic Wall Clock Minimalist Colorful Abstract Art Geometric Decorative Hanging Clock
Nordic Irregular Layered Acrylic Wall Clock Minimalist Colorful Abstract Art Geometric Decorative Hanging Clock
like
Find Similar
1 option
Nordic Irregular Layered Acrylic Wall Clock Minimalist Colorful Abstract Art Geometric Decorative Hanging Clock
-4%
$20.53
No MOQ
Purple Watercolor Flower Butterfly Toilet Sticker Waterproof PVC Removable Decal For Bathroom Home Decor Toilet Lid Art
Purple Watercolor Flower Butterfly Toilet Sticker Waterproof PVC Removable Decal For Bathroom Home Decor Toilet Lid Art
like
Find Similar
1 option
Purple Watercolor Flower Butterfly Toilet Sticker Waterproof PVC Removable Decal For Bathroom Home Decor Toilet Lid Art
$0.86
Mix MOQ : 2
Vintage Red Rose Butterfly Toilet Lid Sticker Waterproof PVC Removable Flower Branch Bathroom Decorative Wall Art Decal
Vintage Red Rose Butterfly Toilet Lid Sticker Waterproof PVC Removable Flower Branch Bathroom Decorative Wall Art Decal
like
Find Similar
Detailed size guide for red rose and butterfly toilet decals showing layout and finish dimensions - 24x24cm
NewVintage Red Rose Butterfly Toilet Lid Sticker Waterproof PVC Removable Flower Branch Bathroom Decorative Wall Art Decal
$0.86
No MOQ
Stained Glass Style Acrylic Bird Desktop Ornaments 7 Birds Sitting On Branch Modern Art Sculpture Home Office Decoration
Stained Glass Style Acrylic Bird Desktop Ornaments 7 Birds Sitting On Branch Modern Art Sculpture Home Office Decoration
like
Find Similar
Colorful stained glass style acrylic seven birds on a branch decor with black base - 7 Birds (With Base)
Stained Glass Style Acrylic Bird Desktop Ornaments 7 Birds Sitting On Branch Modern Art Sculpture Home Office Decoration
$3.60
Mix MOQ : 2
Toilet Rules Bathroom Wall Sticker Removable PVC Decorative Engraved Sign Waterproof Creative Home Art Decal For Washroom Restroom
Toilet Rules Bathroom Wall Sticker Removable PVC Decorative Engraved Sign Waterproof Creative Home Art Decal For Washroom Restroom
like
Find Similar
Detailed dimension layout for Toilet Rules wall decal, measuring 35cm by 42cm black print - 42*33CM
Toilet Rules Bathroom Wall Sticker Removable PVC Decorative Engraved Sign Waterproof Creative Home Art Decal For Washroom Restroom
-4%
$1.37
No MOQ
Wall Stickers PVC Waterproof Romantic Girl On Flower Bicycle Butterflies Love Art Decals For Bedroom Living Room Decor
Wall Stickers PVC Waterproof Romantic Girl On Flower Bicycle Butterflies Love Art Decals For Bedroom Living Room Decor
like
Find Similar
Size chart for floral bicycle girl wall stickers set of 4 waterproof PVC sheets - Flower Bicycle Girl(Y1802)
Wall Stickers PVC Waterproof Romantic Girl On Flower Bicycle Butterflies Love Art Decals For Bedroom Living Room Decor
$1.73
Mix MOQ : 2
Luminous Toilet Sticker Glow In The Dark The Best Seat In The House PVC Waterproof Removable Bathroom Home Decor Wall Art
Luminous Toilet Sticker Glow In The Dark The Best Seat In The House PVC Waterproof Removable Bathroom Home Decor Wall Art
like
Find Similar
Luminous colorful throne slogans toilet stickers set with stars and crown patterns - 28*22cm
Luminous Toilet Sticker Glow In The Dark The Best Seat In The House PVC Waterproof Removable Bathroom Home Decor Wall Art
$3.08
Mix MOQ : 2
Kitchen Rules Wall Decals PVC Vinyl Removable Stickers Coffee Cup Butterfly Quote Wall Art Decor For Home Dining Room Cafe
Kitchen Rules Wall Decals PVC Vinyl Removable Stickers Coffee Cup Butterfly Quote Wall Art Decor For Home Dining Room Cafe
like
Find Similar
Creative Kitchen Rules wall sticker with coffee cup and flower motifs 45x55cm - 25*70cm
Kitchen Rules Wall Decals PVC Vinyl Removable Stickers Coffee Cup Butterfly Quote Wall Art Decor For Home Dining Room Cafe
$1.24
Mix MOQ : 2
Octopus Tentacles Toilet Lid Sticker Waterproof PVC Bathroom Wall Decal Creative Self Adhesive Restroom Decor Black Line Art
Octopus Tentacles Toilet Lid Sticker Waterproof PVC Bathroom Wall Decal Creative Self Adhesive Restroom Decor Black Line Art
like
Find Similar
Detailed view of octopus tentacle wall sticker dimensions 25x30cm for home decor - 25*30cm
NewOctopus Tentacles Toilet Lid Sticker Waterproof PVC Bathroom Wall Decal Creative Self Adhesive Restroom Decor Black Line Art
$0.86
Mix MOQ : 2
Flower Toilet Sticker Black Line Art Peony Floral PVC Removable Waterproof Bathroom Wall Decor Decal Modern Home Ornament
Flower Toilet Sticker Black Line Art Peony Floral PVC Removable Waterproof Bathroom Wall Decor Decal Modern Home Ornament
like
Find Similar
Floral black and white line art wall sticker with peony pattern for bathroom decoration - Black Line Floral (MS3069-YL) / 30*30cm*1 Sheet
Flower Toilet Sticker Black Line Art Peony Floral PVC Removable Waterproof Bathroom Wall Decor Decal Modern Home Ornament
$0.86
Mix MOQ : 2
Hollow Butterfly Wall Stickers PVC Self Adhesive Rose Red Lace Pattern DIY Home Art Decals For Bedroom Living Room
Hollow Butterfly Wall Stickers PVC Self Adhesive Rose Red Lace Pattern DIY Home Art Decals For Bedroom Living Room
like
Find Similar
Pink hollow butterfly wall sticker with detailed size chart for home wall decoration - Pink Hollow Butterfly (30*90cm)
Hollow Butterfly Wall Stickers PVC Self Adhesive Rose Red Lace Pattern DIY Home Art Decals For Bedroom Living Room
$1.44
Mix MOQ : 2
Christmas Tree Garden Stakes Black Metal Iron Art Silhouette Reindeer Hollow Design Outdoor Yard Lawn Ornaments Decor
Christmas Tree Garden Stakes Black Metal Iron Art Silhouette Reindeer Hollow Design Outdoor Yard Lawn Ornaments Decor
like
Find Similar
Black metal Christmas tree garden stake with hollow reindeer and forest patterns - Christmas Tree
Christmas Tree Garden Stakes Black Metal Iron Art Silhouette Reindeer Hollow Design Outdoor Yard Lawn Ornaments Decor
$3.03
Mix MOQ : 20
Purple Pink Rose Peony Flower Toilet Sticker PVC Waterproof Self Adhesive Bathroom Wall Decal Floral Home Decor Art
Purple Pink Rose Peony Flower Toilet Sticker PVC Waterproof Self Adhesive Bathroom Wall Decal Floral Home Decor Art
like
Find Similar
Detail view of purple floral toilet sticker with 29x26cm dimensions and watercolor peony - 26*29CM (M-210)
Purple Pink Rose Peony Flower Toilet Sticker PVC Waterproof Self Adhesive Bathroom Wall Decal Floral Home Decor Art
$0.72
No MOQ
3D Embossed Gold White Flower Toilet Lid Sticker Waterproof PVC Floral Wall Decal For Bathroom Toilet Home Decor Art
3D Embossed Gold White Flower Toilet Lid Sticker Waterproof PVC Floral Wall Decal For Bathroom Toilet Home Decor Art
like
Find Similar
Detailed size chart for golden flower toilet sticker showing receive and finished dimensions - PH_QTA485 Toilet Sticker
3D Embossed Gold White Flower Toilet Lid Sticker Waterproof PVC Floral Wall Decal For Bathroom Toilet Home Decor Art
-4%
$0.88
No MOQ
White Flower Butterfly Window Sticker Minimalist Line Art PVC Static Cling Decal For Home Decoration Glass Surfaces
White Flower Butterfly Window Sticker Minimalist Line Art PVC Static Cling Decal For Home Decoration Glass Surfaces
like
Find Similar
Detail view of 25pcs white floral wall stickers with dimensions and layout specifications - Standard Spec / White
White Flower Butterfly Window Sticker Minimalist Line Art PVC Static Cling Decal For Home Decoration Glass Surfaces
$2.45
Mix MOQ : 2
Purple Mushroom Flower Toilet Sticker PVC Self Adhesive Bathroom Wall Decal Cartoon Decorative Art Sticker For Kids Bedroom
Purple Mushroom Flower Toilet Sticker PVC Self Adhesive Bathroom Wall Decal Cartoon Decorative Art Sticker For Kids Bedroom
like
Find Similar
Detail view of purple mushroom wall sticker with size specifications 29cm x 25cm - 25*29cm
Purple Mushroom Flower Toilet Sticker PVC Self Adhesive Bathroom Wall Decal Cartoon Decorative Art Sticker For Kids Bedroom
$0.86
No MOQ
Christmas Wooden Santa Tray For Milk And Cookies Reindeer Snacks Round Wood Plaque Decorative Wall Art Hanging Sign Gift
Christmas Wooden Santa Tray For Milk And Cookies Reindeer Snacks Round Wood Plaque Decorative Wall Art Hanging Sign Gift
like
Find Similar
Detail view of 29cm Christmas wooden tray showing HD printing and 0.5cm thickness - Santa Snack Tray (M24Y50594_Q)
Christmas Wooden Santa Tray For Milk And Cookies Reindeer Snacks Round Wood Plaque Decorative Wall Art Hanging Sign Gift
$3.17
Mix MOQ : 2
Glow In The Dark Toilet Sticker Humorous Piss Quote Luminous Green Bathroom Decal Flush Instruction Home Wall Art Decor
Glow In The Dark Toilet Sticker Humorous Piss Quote Luminous Green Bathroom Decal Flush Instruction Home Wall Art Decor
like
Find Similar
Detailed size specifications for a glow-in-the-dark humor bathroom sticker 30x20cm - 30x20cm / Humorous Quote (YCG6049-NL)
Detailed view of glow-in-the-dark toilet sticker with black icon and 15x15cm size markers - 15x15cm / Flush Instruction (YCG6048-NL)
Glow In The Dark Toilet Sticker Humorous Piss Quote Luminous Green Bathroom Decal Flush Instruction Home Wall Art Decor
$1.07-1.35
Mix MOQ : 2
Christmas Wall Stickers PVC Reindeer Christmas Tree Pattern Removable Self Adhesive Decals Holiday Home Decor Wall Art
Christmas Wall Stickers PVC Reindeer Christmas Tree Pattern Removable Self Adhesive Decals Holiday Home Decor Wall Art
like
Find Similar
Set of 4 self-adhesive Christmas wall stickers with reindeer and tree designs, 30x20cm - Standard Style
Christmas Wall Stickers PVC Reindeer Christmas Tree Pattern Removable Self Adhesive Decals Holiday Home Decor Wall Art
$1.59
Mix MOQ : 2
Peach Fruit Blossom Wall Stickers PVC Self Adhesive DIY Kitchen Bedroom Decor Modern Watercolor Mural Art Decals
Peach Fruit Blossom Wall Stickers PVC Self Adhesive DIY Kitchen Bedroom Decor Modern Watercolor Mural Art Decals
like
Find Similar
Self-adhesive peach and cherry blossom wall sticker set 60x30cm for kitchen decor - Peach and Peach Blossom Style (MS529-YW)
Peach Fruit Blossom Wall Stickers PVC Self Adhesive DIY Kitchen Bedroom Decor Modern Watercolor Mural Art Decals
$1.82
Mix MOQ : 2
Wall Sticker 3D Broken Wall Effect Tropical Beach Sunset Island PVC Waterproof Self Adhesive Home Decor Mural Art
Wall Sticker 3D Broken Wall Effect Tropical Beach Sunset Island PVC Waterproof Self Adhesive Home Decor Mural Art
like
Find Similar
3D broken wall beach sunset wall sticker with self-adhesive PVC landscape design - Tropical Island Sunset Style (30*90cm*2Pcs)
Wall Sticker 3D Broken Wall Effect Tropical Beach Sunset Island PVC Waterproof Self Adhesive Home Decor Mural Art
$2.10
Mix MOQ : 2
Purple Flower Butterfly Toilet Lid Sticker PVC Waterproof Removable Bathroom Decal Art Home Decor
Purple Flower Butterfly Toilet Lid Sticker PVC Waterproof Removable Bathroom Decal Art Home Decor
like
Find Similar
Self-adhesive purple flower and butterfly wall stickers with detailed product dimensions - Purple Flower Butterfly (25*30cm)
NewPurple Flower Butterfly Toilet Lid Sticker PVC Waterproof Removable Bathroom Decal Art Home Decor
$0.86
Mix MOQ : 2
Purple Hummingbird Floral Bathroom Wall Sticker Removable PVC Door Decal Waterproof Washroom Home Decoration Art Mural Sign
Purple Hummingbird Floral Bathroom Wall Sticker Removable PVC Door Decal Waterproof Washroom Home Decoration Art Mural Sign
like
Find Similar
Detailed sheet and finish size dimensions for hummingbird and morning glory wall sticker - 29*29CM (fun-f443)
Purple Hummingbird Floral Bathroom Wall Sticker Removable PVC Door Decal Waterproof Washroom Home Decoration Art Mural Sign
$0.86
No MOQ
Gaming Wall Decal Eat Sleep Game Controller Wall Sticker For Gamer Room Bedroom Vinyl Waterproof DIY Home Decor Wall Art
Gaming Wall Decal Eat Sleep Game Controller Wall Sticker For Gamer Room Bedroom Vinyl Waterproof DIY Home Decor Wall Art
like
Find Similar
Detail view of video game wall sticker with SLEEP GAME EAT text and controller, 58cm x 24cm - EAT SLEEP GAME Slogan (Z-5) / Packaged in Bag
Gaming Wall Decal Eat Sleep Game Controller Wall Sticker For Gamer Room Bedroom Vinyl Waterproof DIY Home Decor Wall Art
$1.15
No MOQ
3D Dinosaur Wall Stickers Set Realistic PVC Animal World Removable Wall Decals For Kids Room Bedroom Home Decor Art
3D Dinosaur Wall Stickers Set Realistic PVC Animal World Removable Wall Decals For Kids Room Bedroom Home Decor Art
like
Find Similar
Detailed dimensions of 80x40cm dinosaur wall stickers with T-Rex and various species - 40*80CM (Set of 9)
3D Dinosaur Wall Stickers Set Realistic PVC Animal World Removable Wall Decals For Kids Room Bedroom Home Decor Art
-4%
$1.62
No MOQ
Christmas Tree Wall Sticker Removable PVC Decal With Red Gold Balls Bows Stars Decoration For Living Room Home Wall Art
Christmas Tree Wall Sticker Removable PVC Decal With Red Gold Balls Bows Stars Decoration For Living Room Home Wall Art
like
Find Similar
Self-adhesive Christmas tree wall sticker with ornaments and red bows for home decor - Christmas Tree And Baubles Style (SD-101)
NewChristmas Tree Wall Sticker Removable PVC Decal With Red Gold Balls Bows Stars Decoration For Living Room Home Wall Art
$1.38
No MOQ
3D Submarine Porthole Sea Turtle Underwater World Bathroom Toilet Sticker Waterproof PVC Home Decor Wall Art Decal
3D Submarine Porthole Sea Turtle Underwater World Bathroom Toilet Sticker Waterproof PVC Home Decor Wall Art Decal
like
Find Similar
Detail of 3D sea turtle porthole wall sticker with specific product dimensions and sizing - 29*29cm (HY-M321)
3D Submarine Porthole Sea Turtle Underwater World Bathroom Toilet Sticker Waterproof PVC Home Decor Wall Art Decal
$0.86
No MOQ
Handmade Bohemian Macrame Wall Hanging Woven Cotton Rope Tapestry With Wood Rod Long Fringe For Living Room Bedroom Art Decor
Handmade Bohemian Macrame Wall Hanging Woven Cotton Rope Tapestry With Wood Rod Long Fringe For Living Room Bedroom Art Decor
like
Find Similar
Handmade cream macramé wall hanging with tassels and wooden bar, 80x90cm bohemian decor - 80x90CM / Beige
Handmade Bohemian Macrame Wall Hanging Woven Cotton Rope Tapestry With Wood Rod Long Fringe For Living Room Bedroom Art Decor
-4%
$13.69
No MOQ
Modern Minimalist Moon Phase Tapestry Polyester Cotton Black White Wall Hanging Home Bedroom Living Room Decor Art
Modern Minimalist Moon Phase Tapestry Polyester Cotton Black White Wall Hanging Home Bedroom Living Room Decor Art
like
Find Similar
Modern Nordic lunar eclipse phases wall art on black background for home decor - As Shown / 30x120cm
Modern Minimalist Moon Phase Tapestry Polyester Cotton Black White Wall Hanging Home Bedroom Living Room Decor Art
-4%
$2.74
Mix MOQ : 2
Cute Cat Pink Flower Toilet Sticker PVC Waterproof Removable Wall Decal For Bathroom Home Decor DIY Art Mural Accessory
Cute Cat Pink Flower Toilet Sticker PVC Waterproof Removable Wall Decal For Bathroom Home Decor DIY Art Mural Accessory
like
Find Similar
Detailed wall sticker size guide showing a cat in flowers with 29x29cm dimensions - 29*29cm/HY-M349
Cute Cat Pink Flower Toilet Sticker PVC Waterproof Removable Wall Decal For Bathroom Home Decor DIY Art Mural Accessory
$0.86
No MOQ
Floral Butterfly Toilet Tank Stickers Waterproof PVC Self Adhesive Flower Decals For Bathroom Home Decoration Wall Art
Floral Butterfly Toilet Tank Stickers Waterproof PVC Self Adhesive Flower Decals For Bathroom Home Decoration Wall Art
like
Find Similar
Self-adhesive floral toilet stickers with colorful sunflowers and butterflies 30x25cm - Ms8716（25*30cm）
NewFloral Butterfly Toilet Tank Stickers Waterproof PVC Self Adhesive Flower Decals For Bathroom Home Decoration Wall Art
$0.86
Mix MOQ : 2
Colorful Watercolor Daisy Butterfly Toilet Lid Sticker Removable PVC Floral Wall Decal For Bathroom Home Decor Art Mural
Colorful Watercolor Daisy Butterfly Toilet Lid Sticker Removable PVC Floral Wall Decal For Bathroom Home Decor Art Mural
like
Find Similar
Detailed view of daisy and butterfly wall decals with size dimensions of 29cm by 29cm - Multicolor/29cmx29cm (MG-M011)
Colorful Watercolor Daisy Butterfly Toilet Lid Sticker Removable PVC Floral Wall Decal For Bathroom Home Decor Art Mural
$0.72
No MOQ
Pink Christmas Snow House Wall Stickers PVC Watercolor Angel Xmas Tree Decor For Window Bathroom Removable Art
Pink Christmas Snow House Wall Stickers PVC Watercolor Angel Xmas Tree Decor For Window Bathroom Removable Art
like
Find Similar
Pink watercolor Christmas house wall sticker with angel and tree, size 36x42cm - Colorful / Medium
Pink Christmas Snow House Wall Stickers PVC Watercolor Angel Xmas Tree Decor For Window Bathroom Removable Art
$0.92
No MOQ
2026 Minimalist Alphabet Floral Paper Calendar Cards Aesthetic Ins Style Wall Decor Photo Props Art Postcards
2026 Minimalist Alphabet Floral Paper Calendar Cards Aesthetic Ins Style Wall Decor Photo Props Art Postcards
like
Find Similar
1 option
2026 Minimalist Alphabet Floral Paper Calendar Cards Aesthetic Ins Style Wall Decor Photo Props Art Postcards
$1.01
Mix MOQ : 2
3D Luminous Butterfly Wall Stickers Glow In The Dark Butterfly Decals For Bedroom Living Room Home Decoration PVC DIY Art Wall Murals
3D Luminous Butterfly Wall Stickers Glow In The Dark Butterfly Decals For Bedroom Living Room Home Decoration PVC DIY Art Wall Murals
like
Find Similar
Luminous colorful butterfly wall stickers set for bedroom decoration with glowing effect - Mixed Size Style / Fluorescent Green
3D Luminous Butterfly Wall Stickers Glow In The Dark Butterfly Decals For Bedroom Living Room Home Decoration PVC DIY Art Wall Murals
$2.36
Mix MOQ : 2
Watercolor Flower Vine Bird Butterfly Toilet Lid Sticker Waterproof Removable PVC Bathroom Wall Decal Home Art Decor
Watercolor Flower Vine Bird Butterfly Toilet Lid Sticker Waterproof Removable PVC Bathroom Wall Decal Home Art Decor
like
Find Similar
Floral wall sticker with pink flowers, hummingbird, and butterfly design, size 30x20cm - 30*20cm
Watercolor Flower Vine Bird Butterfly Toilet Lid Sticker Waterproof Removable PVC Bathroom Wall Decal Home Art Decor
$0.58
Mix MOQ : 2
Colorful Mosaic Elephant Hanging Ornament Round PVC Wall Decor For Garden Home Patio Art Ethnic Style
Colorful Mosaic Elephant Hanging Ornament Round PVC Wall Decor For Garden Home Patio Art Ethnic Style
like
Find Similar
Colorful mosaic elephant garden hanging decoration with 20cm diameter and 2D design - Colorful Elephant Pattern (DC11007-ZY)
Colorful Mosaic Elephant Hanging Ornament Round PVC Wall Decor For Garden Home Patio Art Ethnic Style
$3.60
Mix MOQ : 2
Free Shipping
Modern American Graffiti Horse Statue Creative Synthetic Resin Animal Sculpture For Home Office Desktop Art Decoration Gift
Modern American Graffiti Horse Statue Creative Synthetic Resin Animal Sculpture For Home Office Desktop Art Decoration Gift
like
Find Similar
Graffiti horse resin sculpture showing dimensions 19cm by 16.5cm for office decor - Galloping Horse Graffiti
Modern American Graffiti Horse Statue Creative Synthetic Resin Animal Sculpture For Home Office Desktop Art Decoration Gift
-4%
$9.86
No MOQ
Watercolor Flowers Butterflies Bird Toilet Lid Decal PVC Waterproof Removable Wall Sticker For Bathroom Home Art Decor Floral Toilet Seat Cover Decal
Watercolor Flowers Butterflies Bird Toilet Lid Decal PVC Waterproof Removable Wall Sticker For Bathroom Home Art Decor Floral Toilet Seat Cover Decal
like
Find Similar
1 option
Watercolor Flowers Butterflies Bird Toilet Lid Decal PVC Waterproof Removable Wall Sticker For Bathroom Home Art Decor Floral Toilet Seat Cover Decal
$1.01
Mix MOQ : 2
Waterproof PVC Toilet Door Sticker Green Plant Wreath Gold Geometric Frame Wall Decal For Bathroom Home Decor Wall Art
Waterproof PVC Toilet Door Sticker Green Plant Wreath Gold Geometric Frame Wall Decal For Bathroom Home Decor Wall Art
like
Find Similar
Golden botanical toilet wall sticker with green leaves and 30x30cm dimension markers - Model MS3082-YL
Waterproof PVC Toilet Door Sticker Green Plant Wreath Gold Geometric Frame Wall Decal For Bathroom Home Decor Wall Art
$0.86
Mix MOQ : 2
Stained Glass Art Window Film Static Cling Privacy Window Sticker Floral Beauty Face Pattern For Home Bathroom Decoration
Stained Glass Art Window Film Static Cling Privacy Window Sticker Floral Beauty Face Pattern For Home Bathroom Decoration
like
Find Similar
Detail showing the 85x38cm floral embossed glass window film with feminine relief art - Beautiful Relief Flower Style (fun-JD138) / 38*85cm
Stained Glass Art Window Film Static Cling Privacy Window Sticker Floral Beauty Face Pattern For Home Bathroom Decoration
$2.88
No MOQ
Floral Bathroom Wall Sticker Pink Rose Wreath PVC Waterproof Self Adhesive Sign For Door Home Decoration Background Wall Art
Floral Bathroom Wall Sticker Pink Rose Wreath PVC Waterproof Self Adhesive Sign For Door Home Decoration Background Wall Art
like
Find Similar
Detailed dimension guide for pink floral bathroom wall sticker showing sheet and finish sizes - 22*29cm (fun-f462)
Floral Bathroom Wall Sticker Pink Rose Wreath PVC Waterproof Self Adhesive Sign For Door Home Decoration Background Wall Art
$0.86
No MOQ
Go to

More in home & kitchen

Explore more in art posters

wallhangingdecorativepolyestertasselsheartgirlsdesignsunparty
roomkidsstylecardsdisplayframelessmagneticfacewomancolor

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access