Everful

Wholesale art posters

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Art Posters

Find the perfect pieces: wall stickers, window stickers, kitchen stickers and more

All products in art posters

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Linen Christmas Throw Pillow Case Buffalo Plaid Cushion Cover Merry Christmas Letter Print Square Decorative Pillowcase For Sofa Home
Linen Christmas Throw Pillow Case Buffalo Plaid Cushion Cover Merry Christmas Letter Print Square Decorative Pillowcase For Sofa Home
like
Find Similar
Christmas buffalo plaid linen pillow cover featuring festive Leigh Lights holiday patterns - Reindeer And Christmas Tree (Leigh Lights)
Christmas buffalo plaid happy NEW YEAR linen pillow cover for holiday sofa decor - Happy New Year
Christmas buffalo plaid linen pillow cover with Merry Christmas text and holiday elements - Merry Christmas Red Letter With Ornaments
Christmas Buffalo Plaid Pillow Case with Nice Until Proven Naughty Art Print - Nice UNTIL Proven NAUGHTY Quote
+12
Linen Christmas Throw Pillow Case Buffalo Plaid Cushion Cover Merry Christmas Letter Print Square Decorative Pillowcase For Sofa Home
-4%
$1.18
No MOQ
Easter Bunny Rabbit Linen Throw Pillowcase Decorative Cushion Cover For Home Sofa Bed Living Room Nordic Cartoon Pattern
Easter Bunny Rabbit Linen Throw Pillowcase Decorative Cushion Cover For Home Sofa Bed Living Room Nordic Cartoon Pattern
like
Find Similar
Close-up of linen pillowcase texture with heart and hugging Easter bunnies print - Hugging Bunnies
Easter linen pillow cover with folk art rabbit and floral embroidery print - Folk Art Jumping Rabbit
Detail of linen pillowcase with purple bunny print and Bunny Loves You typography - Purple Heart Rabbit
Detailed texture of linen cushion cover featuring Easter cats with bunny ears and egg basket - Cat in Bunny Costume
+16
NewEaster Bunny Rabbit Linen Throw Pillowcase Decorative Cushion Cover For Home Sofa Bed Living Room Nordic Cartoon Pattern
$1.24
Mix MOQ : 2
Easter Bunny Linen Cushion Cover Cartoon Rabbit Floral Print Decorative Pillowcase For Sofa Living Room Home Decor
Easter Bunny Linen Cushion Cover Cartoon Rabbit Floral Print Decorative Pillowcase For Sofa Living Room Home Decor
like
Find Similar
Easter decorative linen pillowcase with cute cartoon rabbit and Happy Easter text - Smiling Rabbit Blue Dots (款式-1)
Easter bunny linen pillowcase with rabbit carrying flower basket and colorful eggs - Rabbit with Flower Basket and Eggs (款式-2)
Easter bunny linen pillowcase with tulip garden design on a white background - Rabbit in Grass with Tulips (款式-3)
Linen Easter pillowcase featuring cartoon rabbits and garden cat illustration print - Gardening Cats Illustration (款式-4)
+16
Easter Bunny Linen Cushion Cover Cartoon Rabbit Floral Print Decorative Pillowcase For Sofa Living Room Home Decor
-4%
$1.18
Mix MOQ : 2
Easter Bunny Cushion Cover Linen Watercolor Rabbit Pillowcase Spring Floral Home Decor Farmhouse
Easter Bunny Cushion Cover Linen Watercolor Rabbit Pillowcase Spring Floral Home Decor Farmhouse
like
Find Similar
Easter linen pillow cover featuring hand-painted artistic watercolor rabbits for home decor - Three Long-eared Hares Watercolor Style (款式-1)
Easter bunny baby linen pillow cover with hand-painted watercolor rabbit and floral pattern - Grey Bunnies BUNNY baby Style (款式-2)
Easter watercolor baby bunny linen pillow cover with floral wreath design for home sofa - Garland Rabbit baby BUNNY Style (款式-3)
Easter Bunny linen pillowcase with watercolor rabbit and floral pattern on white background - Easter Bunny Watercolor Style (款式-4)
+16
Easter Bunny Cushion Cover Linen Watercolor Rabbit Pillowcase Spring Floral Home Decor Farmhouse
$1.24
Mix MOQ : 2
Easter Rabbit Linen Cushion Cover Watercolor Oil Painting Bunny Throw Pillowcase For Sofa Living Room Decor Square
Easter Rabbit Linen Cushion Cover Watercolor Oil Painting Bunny Throw Pillowcase For Sofa Living Room Decor Square
like
Find Similar
Easter bunny linen pillowcase with watercolor rabbit and floral pattern on white base - Watercolor Bunny Floral
Easter linen pillowcase with watercolor rabbit and daisy floral garden pattern - Jumping Rabbit
Linen Easter pillow cover with artistic oil painting rabbit design for sofa decor - Running Hare (3)
Easter rabbit and vintage botanical illustration printed on a linen throw pillow cover - Nature Wildlife Hare (4)
+20
Easter Rabbit Linen Cushion Cover Watercolor Oil Painting Bunny Throw Pillowcase For Sofa Living Room Decor Square
$1.24
No MOQ
Bohemian Linen Throw Pillowcase Geometric Tribal Abstract Patterns Ethnic Cushion Cover For Living Room Sofa Decor
Bohemian Linen Throw Pillowcase Geometric Tribal Abstract Patterns Ethnic Cushion Cover For Living Room Sofa Decor
like
Find Similar
Linen pillow cover with colorful geometric ethnic tribal patterns for sofa decor - Rust Red And Teal Ethnic Geometric Style (1)
Linen cushion cover with geometric tribal pattern in blue and brown on beige background - Blue And Brown Tribal Art Style (2)
Linen cushion cover with geometric tribal patterns in blue and pink on beige fabric - Royal Blue Pink Brown Geometric Style (3)
Linen cushion cover with geometric bohemian patterns on a clean white background - Bright Boho Orange Pink Cyan Style (4)
+14
Bohemian Linen Throw Pillowcase Geometric Tribal Abstract Patterns Ethnic Cushion Cover For Living Room Sofa Decor
$1.24
No MOQ
Linen Square Cushion Case Ethnic Bohemian Mandala Pattern Decorative Pillow Cover For Sofa Living Room Home Decor
Linen Square Cushion Case Ethnic Bohemian Mandala Pattern Decorative Pillow Cover For Sofa Living Room Home Decor
like
Find Similar
Ethnic boho linen pillowcase with colorful mandala floral patterns and geometric stripes - Bohemian Mandala Style 1 (zx132-1)
Ethnic bohemian linen pillowcase featuring colorful mandala and geometric patterns - Ethnic Geometric Style 2 (zx132-2)
Ethnic linen pillowcase with colorful floral mandala patterns on white background - Lotus Geometric Style 3 (zx132-3)
Square linen pillowcase with ethnic geometric floral print and colorful pattern - Ethnic Red Flower Style 4 (zx132-4)
+17
Linen Square Cushion Case Ethnic Bohemian Mandala Pattern Decorative Pillow Cover For Sofa Living Room Home Decor
$1.24
No MOQ
Deer Elk Animal Tapestry Wall Hanging Polyester Printed Celestial Moon Geometric Bohemian Nordic Style Living Room Home Decor
Deer Elk Animal Tapestry Wall Hanging Polyester Printed Celestial Moon Geometric Bohemian Nordic Style Living Room Home Decor
like
Find Similar
Psychic elk forest tapestry with moon and starry sky over a modern sofa in living room - 100x70(Peach Skin) / Mysterious Aurora Deer (Style 1)
Retro psychedelic elk tapestry hanging on wall above a grey sofa for home decor - 100x70(Peach Skin) / Vintage Rock Painting Deer (Style 2)
Psychedelic elk forest tapestry with starry sky and planet hanging above a modern sofa - 100x70(Peach Skin) / Fantasy Starry Sky Deer (Style 3)
Starry night reindeer tapestry with white tree antlers hanging over a modern grey sofa - 100x70(Peach Skin) / Starry Night White Reindeer (Style 4)
+140
Deer Elk Animal Tapestry Wall Hanging Polyester Printed Celestial Moon Geometric Bohemian Nordic Style Living Room Home Decor
-5%
$2.46-9.86
No MOQ
Tropical Plant Leaf Pillowcase Monstera Palm Leaf Cushion Cover Watercolor Peach Skin Velvet Home Decor Sofa Nordic
Tropical Plant Leaf Pillowcase Monstera Palm Leaf Cushion Cover Watercolor Peach Skin Velvet Home Decor Sofa Nordic
like
Find Similar
Watercolor tropical green palm leaf cushion cover made of peach skin fabric - Realistic Palm Leaf Style (1)
Square watercolor tropical green leaves peach skin velvet cushion cover for home decor - Watercolor Mixed Tropical Leaves Style (2)
Tropical green leaves and banana leaf print cushion cover in peach skin fabric - Dark Green Monstera and Palm Style (3)
Watercolor tropical green palm leaf pillowcase on soft peach skin fabric - Fresh Yellow Green Tropical Leaves Style (4)
+33
Tropical Plant Leaf Pillowcase Monstera Palm Leaf Cushion Cover Watercolor Peach Skin Velvet Home Decor Sofa Nordic
$1.09
No MOQ
Tropical Plant Print Cushion Cover Faux Satin Artistic Palm Leaf Bamboo Bird Of Paradise Patterns For Sofa Couch Home Decor
Tropical Plant Print Cushion Cover Faux Satin Artistic Palm Leaf Bamboo Bird Of Paradise Patterns For Sofa Couch Home Decor
like
Find Similar
Artistic tropical palm leaf decorative pillow cover with vintage canvas texture - Tropical Palm Leaves (Style 1)
Vintage tropical bamboo print faux silk cushion cover in minimalist green and white - Minimalist Bamboo (Style 2)
Square cushion cover featuring tropical green bamboo digital print on beige fabric - Emerald Bamboo Forest (Style 3)
Detailed macro view of tropical bamboo leaf print on textured faux silk cushion cover - Artistic Chinese Bamboo (Style 4)
+8
Tropical Plant Print Cushion Cover Faux Satin Artistic Palm Leaf Bamboo Bird Of Paradise Patterns For Sofa Couch Home Decor
-5%
$1.45
No MOQ
Gothic Skull Tapestry Wall Hanging Japanese Samurai Viking Warrior Decoration Polyester Background Cloth For Living Room Bedroom Party Decor
Gothic Skull Tapestry Wall Hanging Japanese Samurai Viking Warrior Decoration Polyester Background Cloth For Living Room Bedroom Party Decor
like
Find Similar
Skull tapestry with Indian feather war bonnet and crossed spears for wall hanging - Indian Feather Skull (Pattern 2) - Peach Skin / 150x100cm
Japanese samurai skeleton peach skin tapestry in modern living room scene - Samurai Skull Crossed Swords (Pattern 4) - Peach Skin / 150x100cm
Japanese samurai tapestry with red sun and katana sword on white peach skin fabric - Samurai Line Art Red Sun (Pattern 6) - Peach Skin / 150x100cm
Japanese samurai skeleton wall tapestry with black and white decorative warrior design - Kabuto Samurai Skull (Pattern 1) - Peach Skin / 150x100cm
+185
Gothic Skull Tapestry Wall Hanging Japanese Samurai Viking Warrior Decoration Polyester Background Cloth For Living Room Bedroom Party Decor
-5%
$2.46-9.86
No MOQ
Gothic Skeleton Tapestry Halloween Wall Hanging Polyester Mushroom Floral Mystery Skull Background Cloth For Living Room Decor
Gothic Skeleton Tapestry Halloween Wall Hanging Polyester Mushroom Floral Mystery Skull Background Cloth For Living Room Decor
like
Find Similar
Halloween skull and roses tapestry with Memento mori lettering for gothic home wall decor - Gold Skull and Roses / 100x70(Peach Skin)
Pastel goth halloween skull tapestry with pink polka dot bows on living room wall - Pastel Goth Pink Bow Skull / 100x70(Peach Skin)
Detail of skull wall tapestry with red headphones over a grey sofa in Halloween decor - Trendy Headphones Skull / 100x70(Peach Skin)
Detail of Halloween pirate skull tapestry with decorative feathers and coins on wall - Pirate Sea Soul Skull / 100x70(Peach Skin)
+104
Gothic Skeleton Tapestry Halloween Wall Hanging Polyester Mushroom Floral Mystery Skull Background Cloth For Living Room Decor
-5%
$2.46-9.86
No MOQ
Floral Pillow Cover Faux Satin Vintage Flower Pattern Square Cushion Case Home Decor Sofa Couch Oil Painting Style Retro
Floral Pillow Cover Faux Satin Vintage Flower Pattern Square Cushion Case Home Decor Sofa Couch Oil Painting Style Retro
like
Find Similar
Vintage floral throw pillow with red roses and musical score print on silk texture - Realistic Red Rose Score (1) / 18x18 Inch
Vintage poppy and rose floral art cushion cover with French perfume label design - French Vintage Rose Perfume Label (2) / 18x18 Inch
Vintage poppy and rose floral square pillowcase in artistic French oil painting style - Oil Painting Pink Floral Hydrangea (3) / 18x18 Inch
Vintage floral cushion cover with peony and typography design on white background - Vintage Pink Peony Purple Hydrangea (4) / 18x18 Inch
+10
Floral Pillow Cover Faux Satin Vintage Flower Pattern Square Cushion Case Home Decor Sofa Couch Oil Painting Style Retro
-5%
$1.45
No MOQ
Watercolor Floral Cushion Cover Faux Satin Vintage Botanical Rose Butterfly Print Decorative Pillowcase For Sofa Home Decor
Watercolor Floral Cushion Cover Faux Satin Vintage Botanical Rose Butterfly Print Decorative Pillowcase For Sofa Home Decor
like
Find Similar
Watercolor pink rose and butterfly pillowcase in vintage faux silk fabric with stamps - Pink Rose and Butterfly (1)
Square watercolor rose silk cushion cover with elegant floral print for home sofa decor - Artistic Watercolor Pink Floral (2)
Watercolor rose flower faux silk square cushion cover for sofa home decor - Exquisite Watercolor Rose (3)
Watercolor pink roses on decorative white satin cushion cover with vintage script - Fresh Watercolor Flower Bud (4)
+6
Watercolor Floral Cushion Cover Faux Satin Vintage Botanical Rose Butterfly Print Decorative Pillowcase For Sofa Home Decor
$1.53
No MOQ
Romantic Valentine's Day Throw Pillow Cover Peach Skin Polyester Fabric Heart Bird Truck Print Soft Decorative Cushion Case For Sofa Couch Home Bedroom Living Room
Romantic Valentine's Day Throw Pillow Cover Peach Skin Polyester Fabric Heart Bird Truck Print Soft Decorative Cushion Case For Sofa Couch Home Bedroom Living Room
like
Find Similar
Valentine Peach Skin pillowcase featuring red hearts and romantic hand-drawn icons - Romantic Hand-drawn Elements Style (1)
White Happy Valentine peach skin pillowcase with repeating I love you text and hearts - Repeated Handwritten I Love You Style (2)
White peach skin pillowcase with black I love you text and heart pattern for Valentines - Black Artistic Handwriting Style (3)
Peach skin pillowcase with red Valentine's love heart patterns and romantic text prints - Red All-over Greeting Style (4)
+26
Romantic Valentine's Day Throw Pillow Cover Peach Skin Polyester Fabric Heart Bird Truck Print Soft Decorative Cushion Case For Sofa Couch Home Bedroom Living Room
-4%
$1.04
No MOQ
Wall Tapestry Polyester Digital Printed Beach Sunset Tropical Landscape Mediterranean Style Home Living Room Bedroom Hanging
Wall Tapestry Polyester Digital Printed Beach Sunset Tropical Landscape Mediterranean Style Home Living Room Bedroom Hanging
like
Find Similar
Sunset beach wall tapestry featuring palm tree silhouettes over a grey fabric sofa - 100cmx70cm / Tropical Beach Sunset Theme (1)
Sunset beach wall tapestry with lake view and reeds hanging over a modern sofa - 100cmx70cm / Sunset Lake Scenery (2)
Detailed view of sunset beach tapestry featuring a soccer goal silhouette on a wall - 100cmx70cm / Sunset Football Theme (3)
Detail of beach sunset wall tapestry with yoga silhouette hanging over a modern sofa - 100cmx70cm / Sunset Yoga Silhouette (4)
+116
Wall Tapestry Polyester Digital Printed Beach Sunset Tropical Landscape Mediterranean Style Home Living Room Bedroom Hanging
-5%
$2.46-8.49
No MOQ
Valentine's Day Heart Pattern Peach Skin Pillowcase Decorative Square Cushion Cover For Home Bedroom Sofa Living Room Decor
Valentine's Day Heart Pattern Peach Skin Pillowcase Decorative Square Cushion Cover For Home Bedroom Sofa Living Room Decor
like
Find Similar
Peach skin pillowcase featuring black I love you to the moon and back text print - Moon Confession Style (1) / 18x18 Inch
White peach skin pillowcase with Lucky Day tulip wreath print for Valentine decoration - Lucky Day Wreath Style (2) / 18x18 Inch
Peach skin pillowcase featuring I Love You To The Moon And Back print in artistic brown font - Love to the Moon Mixed Font Style (3) / 18x18 Inch
Peach skin pillowcase featuring I Love You More Than Bacon cartoon print for Valentine's Day - Love You More Than Bacon Cartoon Style (4) / 18x18 Inch
+26
Valentine's Day Heart Pattern Peach Skin Pillowcase Decorative Square Cushion Cover For Home Bedroom Sofa Living Room Decor
-4%
$1.04
No MOQ
Valentine's Day Love Heart Cushion Cover Peach Skin Polyester Pillowcase Romantic Letter Print Sofa Home Decorative
Valentine's Day Love Heart Cushion Cover Peach Skin Polyester Pillowcase Romantic Letter Print Sofa Home Decorative
like
Find Similar
White square peach skin pillowcase with gold glitter With Love script pattern - White with Gold Repeated With Love Print (Style 20)
Square peach skin pillowcase with black and gold I Love You calligraphy print pattern - White with Black Gold Alternate I Love You Text (Style 21)
White peach skin pillowcase with golden hearts and Eiffel Tower love design - Eiffel Tower with Heart Design (Style 22)
Peach skin pillowcase featuring black heart doodle and golden glitter heart design - White with Graffiti Hearts and It Must Be Text (Style 23)
+26
Valentine's Day Love Heart Cushion Cover Peach Skin Polyester Pillowcase Romantic Letter Print Sofa Home Decorative
-4%
$1.04
No MOQ
Peach Skin Polyester Throw Pillow Case Happy Valentine's Day Heart Quote Pattern Square Cushion Cover Photography Theme 45x45 Home Decor
Peach Skin Polyester Throw Pillow Case Happy Valentine's Day Heart Quote Pattern Square Cushion Cover Photography Theme 45x45 Home Decor
like
Find Similar
White peach skin pillow case with In Love With Photography camera print and text - In Love With Photography (17)
Square peach skin pillowcase with black and white romantic couple space illustration - Photography Couple (1)
White peach skin cushion cover with black marriage quote and heart pattern design - Marriage Humor Quote (2)
White peach skin pillowcase with black Husband and Wife print for home decor - Husband and Wife Decor (3)
+26
Peach Skin Polyester Throw Pillow Case Happy Valentine's Day Heart Quote Pattern Square Cushion Cover Photography Theme 45x45 Home Decor
-4%
$1.04
No MOQ
Happy Valentine's Day Peach Skin Pillowcase Love Heart Decorative Square Cushion Cover For Sofa Living Room Bedroom Gift
Happy Valentine's Day Peach Skin Pillowcase Love Heart Decorative Square Cushion Cover For Sofa Living Room Bedroom Gift
like
Find Similar
White peach skin square pillowcase with colorful hearts and Happy Valentine's Day text - Colored Hearts and Vines (1)
Valentine's Day pillow case with couple and red heart balloons on beige peach skin fabric - Stick Figure Couple Balloons (2)
Valentine Peach Skin pillowcase featuring black and white diamond pattern with red hearts - Black and White Diamond Heart (3)
Square peach skin pillowcase with geometric arrows and colorful heart patterns - Colored Heart Arrows (4)
+16
Happy Valentine's Day Peach Skin Pillowcase Love Heart Decorative Square Cushion Cover For Sofa Living Room Bedroom Gift
-4%
$1.04
No MOQ
Happy Easter Halloween Decorative Tapestry Polyester Wall Hanging Backdrop For Living Room Bedroom Festive Party Ornament
Happy Easter Halloween Decorative Tapestry Polyester Wall Hanging Backdrop For Living Room Bedroom Festive Party Ornament
like
Find Similar
Easter decorative wall tapestry featuring pink rabbit and colorful eggs on peach skin fabric - 150x100(Peach Skin)
Easter wall tapestry with Happy Easter text and colorful eggs hanging above a sofa - 150x100(Peach Skin) / Easter Eggs Pattern (2)
Easter egg decoration tapestry featuring a cartoon bunny painting in a floral garden - 150x100(Peach Skin) / Cartoon Rabbit Pattern (4)
Easter wall tapestry with colorful eggs and Happy Easter text for home decor - 150x100(Peach Skin) / Floral Easter Eggs Pattern (6)
+95
Happy Easter Halloween Decorative Tapestry Polyester Wall Hanging Backdrop For Living Room Bedroom Festive Party Ornament
-5%
$2.46-9.86
No MOQ
Love Heart Valentine Day Throw Pillow Cover Peach Skin Fabric Romantic Printed Cushion Case Home Decor
Love Heart Valentine Day Throw Pillow Cover Peach Skin Fabric Romantic Printed Cushion Case Home Decor
like
Find Similar
Peach skin pillow cover with winged red hearts and I benlieve I can fly text print - 18x18 Inch / Winged Red Heart (1)
White peach skin pillowcase with red heart balloons and Happy Valentine's Day print - 18x18 Inch / Q-version Girl Valentine (2)
White pillowcase with LOVE floral pattern and heart shape in peach skin fabric - 18x18 Inch / Floral Heart Love Letters (3)
Romantic pink heart peach skin pillowcase with 'I Love You Forever' text print - 18x18 Inch / Romantic Handwritten Note Heart (4)
+16
Love Heart Valentine Day Throw Pillow Cover Peach Skin Fabric Romantic Printed Cushion Case Home Decor
-4%
$1.04
No MOQ
Valentine's Day Heart Pillowcase Peach Skin Linen Square Cushion Cover For Home Sofa Decor Romantic Love Pattern Gift
Valentine's Day Heart Pillowcase Peach Skin Linen Square Cushion Cover For Home Sofa Decor Romantic Love Pattern Gift
like
Find Similar
Square peach skin pillowcase with hand-drawn black and gold heart pattern - Black and Gold Hand-drawn Hearts
Square pillowcase featuring red heart graffiti and Me & You romantic doodles - Romantic Hand-drawn Graffiti
Square pillowcase with colorful pink and red heart patterns on white peach skin fabric - Colorful Hearts Grid
Square pillowcase with pink and grey heart arrow pattern on soft white peach skin fabric - Abstract Hearts All-over Print
+26
NewValentine's Day Heart Pillowcase Peach Skin Linen Square Cushion Cover For Home Sofa Decor Romantic Love Pattern Gift
-4%
$1.04
No MOQ
Peach Skin Velvet Pillowcase Cushion Cover Decorative Square Home Sofa For Valentine Day Autumn Floral Animal Patterns
Peach Skin Velvet Pillowcase Cushion Cover Decorative Square Home Sofa For Valentine Day Autumn Floral Animal Patterns
like
Find Similar
White peach skin pillowcase with Kiss Me Under The Light text and gold star pattern - Kiss Me Under Stars (1)
Square peach skin pillow case with Happy Valentine's Day heart design and romantic quote - Love You Forever (2)
Square peach skin pillow case with LOVE never fails text and red heart graphic - Love Never Fails (3)
Valentine's Day pillowcase with I Still Fall For You Everyday text and red hearts - Fall For You Everyday (4)
+26
Peach Skin Velvet Pillowcase Cushion Cover Decorative Square Home Sofa For Valentine Day Autumn Floral Animal Patterns
-4%
$1.04
No MOQ
Happy Valentine's Day Love Heart Pattern Peach Skin Velvet Throw Pillow Cover Square Cushion Case For Home Sofa Decor
Happy Valentine's Day Love Heart Pattern Peach Skin Velvet Throw Pillow Cover Square Cushion Case For Home Sofa Decor
like
Find Similar
Pink Valentine's Day pillowcase featuring red rose petals and Happy Valentine's Day text - Pink Rose Petals (1)
White peach skin pillowcase with Happy Valentine's Day cheese and macaroni cartoon print - Macaroni and Cheese Cartoon (2)
Light green peach skin pillowcase with cute cartoon elephant and rabbit illustrations - Elephant and Rabbit Cartoon (3)
White peach skin pillowcase featuring minimalist black love text and heart graphic - Doodle Heart Sketch (4)
+16
Happy Valentine's Day Love Heart Pattern Peach Skin Velvet Throw Pillow Cover Square Cushion Case For Home Sofa Decor
-4%
$1.04
No MOQ
Happy Valentine's Day Heart Pattern Peach Skin Pillowcase Square Black White Striped Romantic Love Throw Pillow Cover Home Decor
Happy Valentine's Day Heart Pattern Peach Skin Pillowcase Square Black White Striped Romantic Love Throw Pillow Cover Home Decor
like
Find Similar
Peach skin pillowcase with black and white stripes, colorful hearts and love text - Striped Colorful Heart (Style 1)
Striped peach skin pillowcase with red hearts and Happy Valentine's Day text - Bold Stripe Holiday Greeting (Style 2)
Peach skin pillowcase featuring red lips pattern over black and white horizontal stripes - Pop Art Red Lips Stripe (Style 3)
Square peach skin pillowcase with red watercolor hearts and black stripes for Valentine's Day - Hand-painted Stripe Red Heart (Style 4)
+16
NewHappy Valentine's Day Heart Pattern Peach Skin Pillowcase Square Black White Striped Romantic Love Throw Pillow Cover Home Decor
-4%
$1.04
No MOQ
Valentine Day Heart Peach Skin Pillowcase Decorative Cushion Cover Romantic Love Pattern Home Decor Square Throw Pillow Case
Valentine Day Heart Peach Skin Pillowcase Decorative Cushion Cover Romantic Love Pattern Home Decor Square Throw Pillow Case
like
Find Similar
Square peach skin pillowcase with romantic red and black heart patterns for Valentine's Day - Heart Collection (1)
White square peach skin pillowcase with romantic red heart and love bird patterns - Cartoon Birds And Hearts (2)
Square peach skin pillowcase with dense red and white heart patterns for Valentines Day - Dense Heart Pattern (3)
Square peach skin pillow case featuring red and white heart patterns for Valentine's Day - Red White Patchwork Heart (4)
+16
Valentine Day Heart Peach Skin Pillowcase Decorative Cushion Cover Romantic Love Pattern Home Decor Square Throw Pillow Case
$1.09
No MOQ
Square Pillowcase Peach Skin Velvet Cushion Cover Valentine Day Love Heart Cartoon Decorative For Sofa Home Office
Square Pillowcase Peach Skin Velvet Cushion Cover Valentine Day Love Heart Cartoon Decorative For Sofa Home Office
like
Find Similar
Valentine's Day peach skin pillowcase featuring pink watercolor hearts and foliage - Pink Polka Dot Heart with Black Text (1)
Square peach skin pillowcase with red multilingual love confession print - Multilingual Love Confession Red Heart (2)
Valentine Peach Skin pillowcase with Love You script and red hearts arrow design - Horizontal Stripe Double Hearts Arrow (3)
Cyan Valentine's Day peach skin pillowcase with red bicycle and heart balloons design - Cyan Background Retro Bicycle (4)
+16
Square Pillowcase Peach Skin Velvet Cushion Cover Valentine Day Love Heart Cartoon Decorative For Sofa Home Office
$1.09
No MOQ
Valentine's Day Heart Love Gold Glitter Peach Skin Velvet Pillow Case Decorative Square Cushion Cover For Home Decor
Valentine's Day Heart Love Gold Glitter Peach Skin Velvet Pillow Case Decorative Square Cushion Cover For Home Decor
like
Find Similar
Square peach skin pillowcase with golden glitter text You Are My Love and heart design - You Are My Love Gold Powder Design (9)
Golden Happy Valentine's Day peach skin pillowcase with pink heart balloons - Heart Balloon Gold Ribbon Design (13)
Golden I LOVE YOU heart pattern on white peach skin pillowcase with glitter detail - Dotted Heart Gold Powder Design (1)
Golden peach skin pillowcase with I love you to the moon and back text and stars - Moon Star Lettering Design (2)
+26
Valentine's Day Heart Love Gold Glitter Peach Skin Velvet Pillow Case Decorative Square Cushion Cover For Home Decor
-4%
$1.04
No MOQ
Valentine Day Heart Printed Cushion Cover Peach Skin Polyester Romantic Decorative Pillowcase For Sofa Bed Home
Valentine Day Heart Printed Cushion Cover Peach Skin Polyester Romantic Decorative Pillowcase For Sofa Bed Home
like
Find Similar
Square peach skin pillowcase with Eiffel Tower and black heart patterns on white - Heart and Colorful Eiffel Tower Style (18)
Minimalist peach skin pillowcase featuring decorative black and white hand-drawn heart patterns - Black and White Hand-drawn Heart Style (1)
Square peach skin pillowcase with vibrant pink and red heart graffiti patterns - Pink Red Black Doodle Heart Style (2)
Pink peach skin pillowcase with artistic doodle heart patterns for Valentine's Day decor - Pink Base Black Red Line Heart Style (3)
+26
Valentine Day Heart Printed Cushion Cover Peach Skin Polyester Romantic Decorative Pillowcase For Sofa Bed Home
$1.09
No MOQ
Valentine's Day Heart Pattern Peach Skin Cushion Cover Romantic Rose Flower Letter Print Decorative Throw Pillow Case For Sofa Home Decor
Valentine's Day Heart Pattern Peach Skin Cushion Cover Romantic Rose Flower Letter Print Decorative Throw Pillow Case For Sofa Home Decor
like
Find Similar
Valentine Peach Skin pillowcase featuring hanging heart patterns on light blue clouds - Hanging Hearts Style (Style A)
Square Valentine pillowcase with colorful splatter design and I love you heart print - Watercolor Splash Heart (Style B)
Peach skin Valentine's Day pillowcase with Happy Valentine's Day text and heart arrow design - Cupid Arrow Double Hearts (Style C)
Valentine Peach Skin pillowcase featuring a red geometric heart with I Love You text - Geometric Patchwork Heart (Style D)
+16
Valentine's Day Heart Pattern Peach Skin Cushion Cover Romantic Rose Flower Letter Print Decorative Throw Pillow Case For Sofa Home Decor
-4%
$1.04
No MOQ
Christmas Tapestry Wall Hanging Polyester Winter Snow Scene Santa Reindeer Forest Landscape Holiday Home Decor
Christmas Tapestry Wall Hanging Polyester Winter Snow Scene Santa Reindeer Forest Landscape Holiday Home Decor
like
Find Similar
Winter snow sunset landscape tapestry wall hanging for cozy living room home decor - 150x100(Peach Skin) / Purple Sunset Snow Scene(2)
Detail of Christmas tapestry featuring Santa and reindeer over a cozy sofa setting - 150x100(Peach Skin) / Red Background Santa and Reindeer(4)
Detailed interior view of a Christmas wall tapestry featuring Santa Claus and snow - 150x100(Peach Skin) / Dark Blue Winter Starry Night Cabin(6)
Detailed view of winter snow cabin wall tapestry hanging in a cozy modern living room - 150x100(Peach Skin) / Winter Snow Cabin(1)
+104
Christmas Tapestry Wall Hanging Polyester Winter Snow Scene Santa Reindeer Forest Landscape Holiday Home Decor
-5%
$2.46-9.86
No MOQ
Floral Animal Print Peach Skin Velvet Cushion Cover Artistic Square Pillowcase For Living Room Sofa Christmas Holiday Decor
Floral Animal Print Peach Skin Velvet Cushion Cover Artistic Square Pillowcase For Living Room Sofa Christmas Holiday Decor
like
Find Similar
Square peach skin pillowcase featuring festive cardinal and Merry Christmas floral design - Christmas Cardinal Wreath Style (1)
Close-up of owl and pine branch illustration on soft peach skin fabric cushion cover - Light Blue Dual Owls Style (2)
Peach skin pillowcase featuring artistic owls on pine branches with blue background - Blue Background Vintage Owls Style (3)
Detail of owl and botanical pine cone print on soft square throw pillow cover - Botanical Card Owls Style (4)
+36
Floral Animal Print Peach Skin Velvet Cushion Cover Artistic Square Pillowcase For Living Room Sofa Christmas Holiday Decor
$1.09
No MOQ
Christmas Cushion Cover Peach Skin Fabric Reindeer Snowman Print Decorative Pillowcase For Sofa Home Decor Simple Square
Christmas Cushion Cover Peach Skin Fabric Reindeer Snowman Print Decorative Pillowcase For Sofa Home Decor Simple Square
like
Find Similar
Vintage Christmas cushion cover with deer and flower print on peach skin fabric - Retro Deer (1)
Christmas pillowcase featuring vintage bells and red ribbon on linen texture fabric - Christmas Bells Music (2)
Detail of Christmas pillowcase with Merry Christmas text, bells and red bow design - Light Blue Christmas Bells (3)
Detailed view of Christmas pillowcase texture with golden bells and festive holiday print - Love Peace Doves (4)
+36
Christmas Cushion Cover Peach Skin Fabric Reindeer Snowman Print Decorative Pillowcase For Sofa Home Decor Simple Square
$1.09
No MOQ
Holiday Theme Pillowcase Peach Skin Velvet Cushion Cover Home Decor Square Festive Printed Sofa Throw Case
Holiday Theme Pillowcase Peach Skin Velvet Cushion Cover Home Decor Square Festive Printed Sofa Throw Case
like
Find Similar
Christmas red throw pillow case with green string lights and chill text design - Red Christmas Lights Style (1)
Festive red Christmas pillowcase with Happy Christmas text and colorful holiday icons - Red Santa Claus Reindeer Cartoon Style (2)
Close-up of Christmas pillowcase with festive red guitar and Merry Christmas text - Red Guitar Christmas Tree Style (3)
Red Merry Christmas pillowcase with decorative ornaments on peach skin fabric - Red Christmas Ball Decoration Style (4)
+35
Holiday Theme Pillowcase Peach Skin Velvet Cushion Cover Home Decor Square Festive Printed Sofa Throw Case
-4%
$1.04
No MOQ
Christmas Reindeer Snowman Santa Claus Print Peach Skin Velvet Square Pillowcase Winter Holiday Decorative Throw Cushion Cover
Christmas Reindeer Snowman Santa Claus Print Peach Skin Velvet Square Pillowcase Winter Holiday Decorative Throw Cushion Cover
like
Find Similar
Christmas deer peach skin pillowcase with winter scene and gold accents on white background - Winter Fairytale Deer Style (1)
Christmas deer pillowcase with watercolor reindeer and festive golden ornaments print - Winter Cuddly Deer Style (2)
Detail of Christmas reindeer pillowcase showing vintage watercolor angel and rabbit print - Angel and Rabbit Style (3)
Square peach skin pillowcase featuring Christmas deer and forest animals art print - Winter Forest Animals Style (4)
+36
Christmas Reindeer Snowman Santa Claus Print Peach Skin Velvet Square Pillowcase Winter Holiday Decorative Throw Cushion Cover
$1.09
No MOQ
Christmas Pillowcase Peach Skin Polyester Digital Print Xmas Decor Cushion Cover For Home Living Room Sofa No Insert
Christmas Pillowcase Peach Skin Polyester Digital Print Xmas Decor Cushion Cover For Home Living Room Sofa No Insert
like
Find Similar
Christmas decorative square pillowcase featuring festive ornaments and pine branches - Christmas Ball and Pine Branch Style (1)
Christmas watercolor cushion cover featuring festive stockings and gift box on white - Christmas Stocking and Gift Box Style (2)
Christmas watercolor cushion cover featuring festive holly vase and gift box patterns - Polka Dot Gift Box and Dessert Style (3)
Close-up of linen cushion cover with two turtle doves and red poinsettia pattern - White Dove and Poinsettia Style (4)
+36
Christmas Pillowcase Peach Skin Polyester Digital Print Xmas Decor Cushion Cover For Home Living Room Sofa No Insert
-4%
$1.04
No MOQ
Christmas Pillowcase Decorative Cushion Cover Peach Skin Velvet Square Xmas Holiday Decor Happy New Year Soft Home Sofa Throw
Christmas Pillowcase Decorative Cushion Cover Peach Skin Velvet Square Xmas Holiday Decor Happy New Year Soft Home Sofa Throw
like
Find Similar
Detail of Christmas pillowcase featuring reindeer, holiday wreath, and festive elements - Off-white Christmas Wreath Reindeer Illustration Style (23)
Christmas pillowcase with black background and golden snowflake tree design - Black Gold Silver Snowflake Tree Style (1)
Blue Christmas pillowcase with golden reindeer and Merry Christmas print on white background - Dark Blue Gold Reindeer Snowflake Style (2)
Macro detail of navy blue Christmas pillowcase with snowflakes and festive text - Dark Blue Gold Silver New Year Wishes Style (3)
+35
Christmas Pillowcase Decorative Cushion Cover Peach Skin Velvet Square Xmas Holiday Decor Happy New Year Soft Home Sofa Throw
-4%
$1.04
No MOQ
Christmas Elk Reindeer Peach Skin Throw Pillowcase Square Cushion Cover For Home Decor Living Room Happy New Year Gift
Christmas Elk Reindeer Peach Skin Throw Pillowcase Square Cushion Cover For Home Decor Living Room Happy New Year Gift
like
Find Similar
Detailed view of blue snowman cushion cover with reindeer silhouette and festive text - Sky Blue Background White Reindeer Silhouette
Blue Christmas pillowcase with white reindeer silhouette and Happy New Year text - Dark Blue Background White Reindeer Silhouette
Green Christmas reindeer cushion cover with Happy New Year text and festive patterns - Bright Green Background White Reindeer Silhouette
Square peach skin pillowcase with green geometric elk design and Happy New Year text - White and Green Geometric Reindeer
+36
Christmas Elk Reindeer Peach Skin Throw Pillowcase Square Cushion Cover For Home Decor Living Room Happy New Year Gift
-4%
$1.04
No MOQ
Tropical Floral Satin Cushion Cover Square Throw Pillow Case With Invisible Zipper For Home Sofa Decor Artistic Botanical Print
Tropical Floral Satin Cushion Cover Square Throw Pillow Case With Invisible Zipper For Home Sofa Decor Artistic Botanical Print
like
Find Similar
Tropical style decorative pillow case with pink floral pattern on faux silk fabric - Pink Peony Style (1)
Tropical silk pillowcase with vibrant pink lilies and green leaves on white background - Pink Lily Style (2)
Square pillowcase with tropical flowers and pink roses on white faux silk fabric - Tropical Plants Letter Style (3)
Tropical silk pillowcase with vintage red peony and orange dahlia floral print - Vintage Red Flower Drawing Style (4)
+20
Tropical Floral Satin Cushion Cover Square Throw Pillow Case With Invisible Zipper For Home Sofa Decor Artistic Botanical Print
$1.53
No MOQ
African Dancer Cushion Cover Faux Satin Ethnic Style Throw Pillowcase For Living Room Sofa Home Decor
African Dancer Cushion Cover Faux Satin Ethnic Style Throw Pillowcase For Living Room Sofa Home Decor
like
Find Similar
Detailed view of African female art illustration and Shani Kelly signature on pillowcase - African Dancer Art Style 1(1)
Detail of silk-texture cushion cover with African female dancers artistic print - African Dancer Art Style 2(2)
Detail view of African dancer art printed on high-quality white decorative pillowcase - African Dancer Art Style 3(3)
Detailed view of African dancer art print on faux silk square decorative cushion cover - African Dancer Art Style 4(4)
+4
African Dancer Cushion Cover Faux Satin Ethnic Style Throw Pillowcase For Living Room Sofa Home Decor
-5%
$1.45
No MOQ
Pastoral Style Satin Decorative Throw Pillow Cover Vintage Floral Bird Paris Pattern Cushion Case For Home Sofa Decor
Pastoral Style Satin Decorative Throw Pillow Cover Vintage Floral Bird Paris Pattern Cushion Case For Home Sofa Decor
like
Find Similar
French retro style square pillowcase featuring Eiffel Tower and butterfly print - Paris Eiffel Tower (1) / 45x45cm
French retro silk cushion cover with Arc de Triomphe and butterfly motifs in beige - Arc de Triomphe (2) / 45x45cm
Faux silk pillow cover with vintage nature illustration of blue birds and nests - Nature Blue Bird (3) / 45x45cm
Faux silk pillow cover with French countryside bee and floral honeycomb pattern - Hive and Bee (4) / 45x45cm
+12
Pastoral Style Satin Decorative Throw Pillow Cover Vintage Floral Bird Paris Pattern Cushion Case For Home Sofa Decor
$1.53
No MOQ
Modern Geometric Satin Throw Pillow Cover Square Cushion Case For Sofa Living Room Bedroom Home Decor Soft Pillowcase
Modern Geometric Satin Throw Pillow Cover Square Cushion Case For Sofa Living Room Bedroom Home Decor Soft Pillowcase
like
Find Similar
Square cushion cover with black and white geometric diamond triangle pattern - Nested Triangles Pattern (1)
Faux silk cushion cover with modern black, white and gold geometric triangle patterns - Black White Gold Honeycomb Triangle Pattern (2)
Square pillowcase with black, white, and gold geometric triangles in modern Nordic style - Black White Gold Nordic Triangle Pattern (3)
Square pillow cover featuring geometric black and white triangles with golden accents - Gold Core Triangle Pattern (4)
+17
NewModern Geometric Satin Throw Pillow Cover Square Cushion Case For Sofa Living Room Bedroom Home Decor Soft Pillowcase
-5%
$1.45
No MOQ
Watercolor Animal Print Satin Cushion Cover Square Decorative Pillowcase Without Insert For Sofa Living Room Home Decor
Watercolor Animal Print Satin Cushion Cover Square Decorative Pillowcase Without Insert For Sofa Living Room Home Decor
like
Find Similar
Silk texture square cushion cover with artistic blue purple Cheshire Cat print - Purple Art Cat Style (We're all Mad Here)
White satin cushion cover featuring a colorful watercolor lion with artistic feathers - Lion Tai Chi Peace Sign Style
Faux silk pillowcase featuring watercolor fox with Indian feather headdress art - Indian Feather Headdress Fox Style
Square faux silk cushion cover featuring artistic watercolor cat with antlers print - Cat with Antlers Style
+11
NewWatercolor Animal Print Satin Cushion Cover Square Decorative Pillowcase Without Insert For Sofa Living Room Home Decor
-5%
$1.45
No MOQ
Christmas Decorative Pillowcase Peach Skin Velvet Throw Pillow Cover Merry Christmas Happy New Year Lettering Snowflakes Festive Home Decor
Christmas Decorative Pillowcase Peach Skin Velvet Throw Pillow Cover Merry Christmas Happy New Year Lettering Snowflakes Festive Home Decor
like
Find Similar
Detail of Christmas word cloud printed on soft peach skin fabric square pillowcase - Christmas Word Cloud Design
Detail of square pillow featuring red Merry Christmas word cloud typography art - Merry Artistic Word Cloud
White square peach skin pillowcase featuring Joyeux NOEL text and black Christmas trees - French Joyeux NOEL
Festive Christmas peach skin pillow cover with colorful Santa and Noel typography designs - Colorful Handwritten Santa Noel
+36
NewChristmas Decorative Pillowcase Peach Skin Velvet Throw Pillow Cover Merry Christmas Happy New Year Lettering Snowflakes Festive Home Decor
$1.09
No MOQ
Watercolor Butterfly Flower Pattern Cushion Cover Short Plush Square Decorative Throw Pillow Case For Sofa Home Office
Watercolor Butterfly Flower Pattern Cushion Cover Short Plush Square Decorative Throw Pillow Case For Sofa Home Office
like
Find Similar
Watercolor butterfly throw pillow cover with flowers and Be Strong text in soft plush - Pink Purple Butterfly (BE STRONG)
Short plush pillow case featuring a yellow watercolor butterfly and pink flowers - Yellow Butterfly (BE HAPPY)
White square cushion cover with watercolor butterfly, sunflower and BE YOU print - Blue Butterfly (BE YOU)
Watercolor blue butterfly and flowers pillow cover with BE BRAVE text on white fabric - Blue Purple Butterfly (BE BRAVE)
+36
Watercolor Butterfly Flower Pattern Cushion Cover Short Plush Square Decorative Throw Pillow Case For Sofa Home Office
-4%
$1.10
No MOQ
Decorative Cushion Cover Faux Satin Nordic Elk Deer Print Square Sofa Pillowcase For Home Living Room Decor
Decorative Cushion Cover Faux Satin Nordic Elk Deer Print Square Sofa Pillowcase For Home Living Room Decor
like
Find Similar
Detailed close-up of a decorative faux silk pillow cover featuring a painted elk elk motif - 45cmx45cm / Oil Painting Style Elk (1)
Macro view of artistic reindeer print on smooth white faux silk cushion cover - 45cmx45cm / Watercolor Hand-painted Deer Head (2)
Macro detail of silk decorative cushion cover showing artistic colorful elk head pattern - 45cmx45cm / Colorful Dotted Gradient Deer Head (3)
Detail of faux silk pillow cover featuring realistic elk print and snowflake accents - 45cmx45cm / Realistic Elk with Snowflakes (4)
+6
Decorative Cushion Cover Faux Satin Nordic Elk Deer Print Square Sofa Pillowcase For Home Living Room Decor
-5%
$1.45
No MOQ
Nativity Religious Oil Painting Cushion Cover Renaissance Angel Peace Dove Classical Christian Home Decor Throw Pillow Case
Nativity Religious Oil Painting Cushion Cover Renaissance Angel Peace Dove Classical Christian Home Decor Throw Pillow Case
like
Find Similar
Christmas peace dove pillowcase in purple with olive branch and starry sky city pattern - Peace Dove Flying Over Ancient City Style (1) / 45x45cm Cushion Cover
Merry Christmas square pillow cover featuring Holy Family religious art on peach skin fabric - Winter Holy Family Style (2) / 45x45cm Cushion Cover
Merry Christmas square throw pillow featuring a nativity scene on light blue fabric - Adoration of Shepherds Style (3) / 45x45cm Cushion Cover
Religious Christmas pillow case showing Mary and Joseph's journey on peach skin fabric - Journey to Bethlehem Style (4) / 45x45cm Cushion Cover
+76
Nativity Religious Oil Painting Cushion Cover Renaissance Angel Peace Dove Classical Christian Home Decor Throw Pillow Case
-4%
$1.10-2.68
No MOQ
Decorative Wall Tapestry Polyester Abstract Geometric 3D Printed Nordic Morandi Style Hanging Fabric For Home Decor
Decorative Wall Tapestry Polyester Abstract Geometric 3D Printed Nordic Morandi Style Hanging Fabric For Home Decor
like
Find Similar
Modern abstract tapestry with olive green geometric shapes and white leaf patterns - Pink Plant Geometric (2) / 150x100(Peach Skin)
Modern Morandi tapestry with orange sun and moth design hanging over a gray sofa - Red Sun Moth (4) / 150x100(Peach Skin)
Minimalist lion line art tapestry with yellow sun background hanging over a sofa - Lion Sun (6) / 150x100(Peach Skin)
Nordic abstract geometric tapestry with wavy lines and circle dots on ivory fabric - Abstract Geometric Waves (1) / 150x100(Peach Skin)
+122
Decorative Wall Tapestry Polyester Abstract Geometric 3D Printed Nordic Morandi Style Hanging Fabric For Home Decor
$2.59-10.37
No MOQ
Watercolor Artistic Female Portrait Wall Hanging Tapestry Abstract Woman Face Decorative Tapestry For Living Room Bedroom Decor
Watercolor Artistic Female Portrait Wall Hanging Tapestry Abstract Woman Face Decorative Tapestry For Living Room Bedroom Decor
like
Find Similar
Elegant watercolor woman portrait tapestry in deep blue hues for living room wall decor - 150cmx150cm / Deep Blue Hair Art (2)
Pop art wall tapestry with blue-haired woman and Shine typography for home decor - 150cmx150cm / Blue Short Hair Sunglasses (4)
Vibrant watercolor portrait tapestry hanging above a modern sofa for wall decor - 150cmx150cm / Colorful Watercolor Art (6)
Artistic watercolor portrait tapestry with floral afro design in modern living room setting - 150cmx150cm / Afro Red Flower Woman Portrait (1)
+100
Watercolor Artistic Female Portrait Wall Hanging Tapestry Abstract Woman Face Decorative Tapestry For Living Room Bedroom Decor
-5%
$2.46-9.86
No MOQ
Merry Christmas Peach Skin Cushion Cover Square Decorative Throw Pillow Case Santa Claus Reindeer Patterns Home Decor
Merry Christmas Peach Skin Cushion Cover Square Decorative Throw Pillow Case Santa Claus Reindeer Patterns Home Decor
like
Find Similar
Minimalist white Merry Christmas pillow cover with Santa and reindeer silhouette - Black and White Sleigh Santa (1)
Merry Christmas peach skin pillowcase with black reindeer and Santa sleigh silhouette - Christmas is Coming Text Silhouette (2)
Navy blue Santa and reindeer print on white square peach skin fabric pillowcase - Blue and White Sleigh Reindeer (3)
Christmas pillowcase with red Santa Claus and reindeer silhouette on white peach skin fabric - Red and White Sleigh Silhouette (4)
+36
Merry Christmas Peach Skin Cushion Cover Square Decorative Throw Pillow Case Santa Claus Reindeer Patterns Home Decor
$1.09
No MOQ
Christmas Santa Claus Cushion Cover Peach Skin Velvet Decorative Throw Pillow Case For Sofa Home Xmas Party Holiday Decor
Christmas Santa Claus Cushion Cover Peach Skin Velvet Decorative Throw Pillow Case For Sofa Home Xmas Party Holiday Decor
like
Find Similar
Merry Christmas Santa pillowcase with orange polka dots and festive illustration - Orange Santa Claus Style
Christmas pillowcase with Santa Claus, gift boxes, and trees on red polka dot background - Red Polka Dot Santa Holding Bird Style
Vintage Christmas throw pillow cover with Santa and reindeer patterns on peach skin fabric - Beige Vintage Christmas Tree Gift Box Style
Retro cartoon boy Christmas cushion cover in soft peach skin fabric with festive patterns - Warm Yellow Blue Hat Boy Hot Air Balloon Style
+36
NewChristmas Santa Claus Cushion Cover Peach Skin Velvet Decorative Throw Pillow Case For Sofa Home Xmas Party Holiday Decor
-4%
$1.04
No MOQ
Watercolor Lighthouse Nautical Wall Hanging Tapestry Home Decor Polyester Fabric Background Cloth Coastal Sea Landscape
Watercolor Lighthouse Nautical Wall Hanging Tapestry Home Decor Polyester Fabric Background Cloth Coastal Sea Landscape
like
Find Similar
Lighthouse tapestry hanging above a grey sofa creating a warm coastal home atmosphere - 150x100cm / Realistic Road Lighthouse (Peach Skin)
Detail of nautical tapestry featuring a lighthouse and sailboat design over a grey sofa - 150x100cm / Cartoon Nautical Sailboat (Peach Skin)
Watercolor nautical tapestry featuring a lighthouse, waves, and sun above a gray sofa - 150x100cm / Illustration Wave Lighthouse (Peach Skin)
Watercolor nautical tapestry featuring a coastal lighthouse and house over a sofa - 150x100cm / Neutral Coastal House (Peach Skin)
+167
Watercolor Lighthouse Nautical Wall Hanging Tapestry Home Decor Polyester Fabric Background Cloth Coastal Sea Landscape
$2.59-10.37
No MOQ
Free Shipping
Sunset Beach Tapestry Wall Hanging Polyester Decorative For Living Room Bedroom Tropical Palm Tree Silhouette Aesthetic Decor
Sunset Beach Tapestry Wall Hanging Polyester Decorative For Living Room Bedroom Tropical Palm Tree Silhouette Aesthetic Decor
like
Find Similar
Sunset beach wall tapestry with lake view and reeds hanging over a modern sofa - Lake Sunset (2) / 150x100(Peach Skin)
Detail of beach sunset wall tapestry with yoga silhouette hanging over a modern sofa - Yoga Silhouette (4) / 150x100(Peach Skin)
Detail of tropical sunset tapestry with palm tree silhouette over a modern gray sofa - Golden Beach Sunset (6) / 150x100(Peach Skin)
Sunset beach wall tapestry featuring palm tree silhouettes over a grey fabric sofa - Tropical Sunset Palm (1) / 150x100(Peach Skin)
+176
Sunset Beach Tapestry Wall Hanging Polyester Decorative For Living Room Bedroom Tropical Palm Tree Silhouette Aesthetic Decor
-5%
$2.46-9.86
No MOQ
Halloween Decorative Pillowcase Peach Skin Velvet Cushion Cover Cute Black Cat Pumpkin Witch Pattern For Sofa Home Decor
Halloween Decorative Pillowcase Peach Skin Velvet Cushion Cover Cute Black Cat Pumpkin Witch Pattern For Sofa Home Decor
like
Find Similar
Halloween decorative square pillowcase featuring a cute kitten with a moon and starry sky - Starry Night Cat (1)
Detail of artistic white cat cushion cover with vintage motifs and café lettering - Vintage White Cat (2)
Macro detail of vintage collage print cushion cover with white cat and floral patterns - Vintage Collage Cat (3)
Macro shot of peach skin fabric pillowcase featuring white cat and artistic face print - Art Portrait Cat (4)
+36
Halloween Decorative Pillowcase Peach Skin Velvet Cushion Cover Cute Black Cat Pumpkin Witch Pattern For Sofa Home Decor
-4%
$1.04
No MOQ
Vintage European Architectural Landmark Tapestry Retro Paris London Landmark Collage Polyester Wall Hanging For Home Decor
Vintage European Architectural Landmark Tapestry Retro Paris London Landmark Collage Polyester Wall Hanging For Home Decor
like
Find Similar
Macro detail of vintage tapestry with Leaning Tower of Pisa and musical notes on grey sofa - Style 2 (Retro Leaning Tower) / 150x100(Peach Skin)
Detail of vintage European architecture wall tapestry showing London Tower Bridge and text - Style 4 (London Tower Bridge) / 150x100(Peach Skin)
Detail of vintage tapestry featuring European architecture and floral postcard motifs - Style 6 (European Cathedral) / 150x100(Peach Skin)
Detail view of vintage tapestry with Leaning Tower of Pisa and musical notes on sofa wall - Style 1 (Leaning Tower of Pisa) / 150x100(Peach Skin)
+212
Vintage European Architectural Landmark Tapestry Retro Paris London Landmark Collage Polyester Wall Hanging For Home Decor
$2.59-10.37
No MOQ
Christmas Snowman Watercolor Pillowcase Peach Skin Square Decorative Cushion Cover Festive Home Sofa Decor
Christmas Snowman Watercolor Pillowcase Peach Skin Square Decorative Cushion Cover Festive Home Sofa Decor
like
Find Similar
Square peach skin pillow with hand-painted snowman in festive orange scarf and hat - 18x18 Inch / Knitted Hat Snowman Style (1)
Christmas snowman cushion cover with lantern and snowy village on soft peach skin fabric - 18x18 Inch / Lantern Snowman Style (2)
Christmas snowman decorative pillowcase with watercolor bird and birch tree design - 18x18 Inch / Birch Forest Red Bird Snowman Style (3)
Christmas snowman watercolor peach skin pillowcase with forest winter scene - 18x18 Inch / Gift Gazing Snowman Style (4)
+36
Christmas Snowman Watercolor Pillowcase Peach Skin Square Decorative Cushion Cover Festive Home Sofa Decor
-4%
$1.04
No MOQ
Tropical Flamingo Monstera Leaves Wall Tapestry Polyester Fabric Decorative Backdrop For Living Room Bedroom Nordic Style
Tropical Flamingo Monstera Leaves Wall Tapestry Polyester Fabric Decorative Backdrop For Living Room Bedroom Nordic Style
like
Find Similar
Detailed tapestry with pink flamingos and cherry blossoms above a gray sofa - Natural Landscape Flamingo Swan (2) / 150x100(Peach Skin)
Tropical wall tapestry with pink flamingo and monstera leaves over a blue background - Sky Blue Tropical Rainforest Single Flamingo (4) / 150x100(Peach Skin)
Detail of tropical tapestry with flamingo, parrot, and monstera leaves on white wall - Vacation Style Flamingo Parrot (6) / 150x100(Peach Skin)
Detail of flamingo tapestry with tropical leaves hanging above a gray sofa in a living room - Pink Forest Five Flamingos (1) / 150x100(Peach Skin)
+176
Tropical Flamingo Monstera Leaves Wall Tapestry Polyester Fabric Decorative Backdrop For Living Room Bedroom Nordic Style
$2.59-10.37
No MOQ
Free Shipping
African Elephant Savanna Landscape Tapestry Polyester Wall Hanging Nature Sunset Scenery Blanket For Living Room Home Decor
African Elephant Savanna Landscape Tapestry Polyester Wall Hanging Nature Sunset Scenery Blanket For Living Room Home Decor
like
Find Similar
Detailed elephant sunset tapestry showing realistic wildlife print on wall above modern sofa - 150x150 / Realistic Photography Elephant Walking (Style 5)
African elephant tapestry with sunset savannah scenery for living room wall decoration - 150x150 / Elephant Sunset Silhouette (Style 2)
Surreal African elephant wall tapestry featuring Taj Mahal elements and waterfalls on grey wall - 150x150 / Surreal Fantasy Art Elephant (Style 4)
Detail of black and white African elephant tapestry hanging above a modern grey sofa - 150x150 / Black and White Photography Elephant (Style 6)
+156
NewAfrican Elephant Savanna Landscape Tapestry Polyester Wall Hanging Nature Sunset Scenery Blanket For Living Room Home Decor
$2.59-10.37
No MOQ
Watercolor Butterfly Tapestry Wall Hanging Polyester Fabric Artistic Animal Pattern Background For Home Living Room Bedroom Decor
Watercolor Butterfly Tapestry Wall Hanging Polyester Fabric Artistic Animal Pattern Background For Home Living Room Bedroom Decor
like
Find Similar
Watercolor butterfly wall tapestry with pink and orange patterns for home wall decor - Artistic Gradient Butterfly (1) / Small
Artistic watercolor butterfly wall tapestry hanging over a sofa in a modern home - Symmetrical Illustrated Butterfly (2) / Small
Wall hanging tapestry with a geometric blue watercolor butterfly on white polyester fabric - Geometric Style Blue Butterfly (3) / Small
Artistic watercolor butterfly tapestry wall hanging for living room sofa decor - Colorful Vibrant Butterfly (4) / Small
+116
Watercolor Butterfly Tapestry Wall Hanging Polyester Fabric Artistic Animal Pattern Background For Home Living Room Bedroom Decor
$2.59-8.93
No MOQ
Go to

More in home & kitchen

Explore more in art posters

wallhangingdecorativepolyestertasselsheartgirlsheadfacewoman
living roomkidsstylecardsdisplayframelessmagneticdesignsunparty

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access