Everful

Wholesale bedding & bathroom

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Bedding & Bathroom

Find the perfect pieces: wall stickers, window stickers, kitchen stickers and more

Popular collections in bedding & bathroom

All products in bedding & bathroom

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Memory Foam Bathroom Rug Mat Embossed Pebble Pattern Absorbent Anti Slip Floor Mat For Shower Room And Toilet U Shape
Memory Foam Bathroom Rug Mat Embossed Pebble Pattern Absorbent Anti Slip Floor Mat For Shower Room And Toilet U Shape
like
Find Similar
3-piece brown bathroom mat set with pebble texture including U-shape and rectangular rugs - 40*50U + 50*80 (2-Piece Set) / Coffee Stone Pattern
Beige 3-piece bathroom rug set with embossed pebble texture on a modern tiled floor - 40*50U + 50*80 (2-Piece Set) / Camel Stone Pattern
Black three-piece bathroom mat set featuring embossed pebble texture and non-slip backing - 40*50U + 50*80 (2-Piece Set) / Black Stone Pattern
Deep grey 3-piece bathroom rug set with pebble texture on white tile floor - 40*50U + 50*80 (2-Piece Set) / Dark Grey Stone Pattern
+51
Memory Foam Bathroom Rug Mat Embossed Pebble Pattern Absorbent Anti Slip Floor Mat For Shower Room And Toilet U Shape
-5%
$3.01-5.75
No MOQ
 · 
32 sold recently
Soft Memory Foam Bath Mat Coral Velvet Absorbent Non-Slip Washable Rug For Bathroom Entryway Bedroom Kitchen Solid Color Floor Mat
Soft Memory Foam Bath Mat Coral Velvet Absorbent Non-Slip Washable Rug For Bathroom Entryway Bedroom Kitchen Solid Color Floor Mat
like
Find Similar
Absorbent white memory foam bath mat on modern bathroom floor near the bathtub - Beige / 40*60cm
Plush burgundy memory foam bath mat with rounded edges shown in a modern bathroom setup - Burgundy / 40*60cm
Absorbent memory foam bath mat in dark brown coral velvet for bathroom and home - Coffee / 40*60cm
Detail of cream memory foam bath mat with soft texture on grey stone floor decor - Camel / 40*60cm
+35
Soft Memory Foam Bath Mat Coral Velvet Absorbent Non-Slip Washable Rug For Bathroom Entryway Bedroom Kitchen Solid Color Floor Mat
$0.83-1.87
No MOQ
Floral Bath Mat Flocked Polyester Super Absorbent Anti-Slip Bathroom Rug Machine Washable Quick Dry Shower Entryway Mat
Floral Bath Mat Flocked Polyester Super Absorbent Anti-Slip Bathroom Rug Machine Washable Quick Dry Shower Entryway Mat
like
Find Similar
Grey absorbent bathroom mat with colorful flower pattern and Happy text - Lucky Peanuts (Gray) / 50*80cm
Absorbent floral bathroom mat with Happy text in a cozy home setting decor - Peanut-White / 50*80cm
Absorbent rectangular bathroom mat with colorful polka dots on cream plush fabric - Enchanted Dream / 50*80cm
Absorbent beach wave patterned long bathroom rug with anti-slip backing for home - Seaside Footprints / 50*80cm
+43
Floral Bath Mat Flocked Polyester Super Absorbent Anti-Slip Bathroom Rug Machine Washable Quick Dry Shower Entryway Mat
-23%
$4.58-21.87
Mix MOQ : 3
 · 
26 views
Free Shipping
Baby Muslin Swaddle Blanket Multilayer Pure Cotton Soft Breathable Cartoon Bear Floral Newborn Receiving Wrap Stroller Cover
Baby Muslin Swaddle Blanket Multilayer Pure Cotton Soft Breathable Cartoon Bear Floral Newborn Receiving Wrap Stroller Cover
like
Find Similar
Soft earth-tone quilted baby blanket with warm wood floor and morning sunlight - 100*120CM / Tan (Style 2)
Detailed close-up of double-sided cotton baby blanket with green leaf pattern on wood - 100*120CM / Bean Green Leaf Print (Style 4)
Detail of floral baby swaddle blanket with quilted texture and soft khaki reverse side - 100*120CM / Beige Pink Orange Floral (Style 6)
Detail of pink floral baby blanket with layered cotton muslin texture and soft edges - 100*120CM / Beige Pink Floral (Style 1)
+5
Baby Muslin Swaddle Blanket Multilayer Pure Cotton Soft Breathable Cartoon Bear Floral Newborn Receiving Wrap Stroller Cover
$9.19
Mix MOQ : 10
Exfoliating Bath Glove Natural Cotton Linen Sisal Body Scrubber Skin Friendly Deep Cleaning For Shower With Hanging Rope
Exfoliating Bath Glove Natural Cotton Linen Sisal Body Scrubber Skin Friendly Deep Cleaning For Shower With Hanging Rope
like
Find Similar
Natural jute exfoliating bath mitt with thumb hole and hanging loop for deep cleansing - Beige
Exfoliating Bath Glove Natural Cotton Linen Sisal Body Scrubber Skin Friendly Deep Cleaning For Shower With Hanging Rope
-12%
$0.71
Mix MOQ : 2
 · 
112 sold recently
Portable Foot Soaking Bucket PVC Foldable Deep Spa Bath Bag High Capacity Waterproof Massage Tub Home Travel
Portable Foot Soaking Bucket PVC Foldable Deep Spa Bath Bag High Capacity Waterproof Massage Tub Home Travel
like
Find Similar
Beige striped PVC folding foot bath bucket with cute puppy print and sturdy handles - One Dog
Collapsible foot soak bucket in red and white with cartoon puppy print and zipper lid - Three Puppies
Portable folding soaking bucket in yellow stripes with cute cartoon dog print - Coffee Angel Dog
Pink and blue striped portable foot soak tub with a cute cartoon dog print - Pink Dessert Dog
+1
NewPortable Foot Soaking Bucket PVC Foldable Deep Spa Bath Bag High Capacity Waterproof Massage Tub Home Travel
$5.33-9.37
No MOQ
Modern Minimalist Imitation Cashmere Wave Shape Non-Slip Bath Mat Absorbent Bedroom Living Room Rug Decorative Floor Carpet
Modern Minimalist Imitation Cashmere Wave Shape Non-Slip Bath Mat Absorbent Bedroom Living Room Rug Decorative Floor Carpet
like
Find Similar
Modern wavy faux cashmere bath mat with brown and beige color blocking on gray tile - 40*60cm / Brown And Beige Wave Style(LTG001)
Modern minimalist faux cashmere wave-shaped bath mat with plush orange and brown layers - 40*60cm / Orange And Beige Bone Shape Style(LTG002)
Modern minimalist green wavy faux cashmere rug for bedroom and bathroom decor - 40*60cm / Green And White Wave Style(LTG003)
Modern wavy faux cashmere rug in dark coffee and beige colors for cozy home decor - 40*60cm / Deep Coffee And Beige Wave Style(LTG004)
+76
Modern Minimalist Imitation Cashmere Wave Shape Non-Slip Bath Mat Absorbent Bedroom Living Room Rug Decorative Floor Carpet
$1.59-39.77
No MOQ
Free Shipping
Cute Cartoon Animal Hair Drying Towel Cap Absorbent Thickened Coral Velvet Fast Dry Head Wrap For Women Bath Shower
Cute Cartoon Animal Hair Drying Towel Cap Absorbent Thickened Coral Velvet Fast Dry Head Wrap For Women Bath Shower
like
Find Similar
Detail of soft brown coral fleece hair towel with cute embroidered bear ears - Brown Bear
Cute Cartoon Animal Hair Drying Towel Cap Absorbent Thickened Coral Velvet Fast Dry Head Wrap For Women Bath Shower
$1.10
No MOQ
White Pillow Insert Soft PP Cotton Filling Non-woven Brushed Fabric Cushion Inner For Sofa Bed Home Decor Square Rectangle
White Pillow Insert Soft PP Cotton Filling Non-woven Brushed Fabric Cushion Inner For Sofa Bed Home Decor Square Rectangle
like
Find Similar
Set of two white square pillow inserts with soft PP cotton filling on a plush carpet - Non-Woven Fabric / 55cmx55cm / White
Set of white striped square pillow inserts in multiple sizes with durable PP cotton filling - Brushed Fabric / 50cm x 50cm / White
+8
White Pillow Insert Soft PP Cotton Filling Non-woven Brushed Fabric Cushion Inner For Sofa Bed Home Decor Square Rectangle
$1.73-3.74
No MOQ
 · 
51 sold recently
Modern Striped Soft Plush Bath Mat Absorbent Anti-Slip Flocking Bathroom Rug Machine Washable Home Floor Mat Shower Rug
Modern Striped Soft Plush Bath Mat Absorbent Anti-Slip Flocking Bathroom Rug Machine Washable Home Floor Mat Shower Rug
like
Find Similar
Plush striped gray and white non-slip bath mat next to a bathtub for home bathroom - Small Style / Simple Life-Gray
Plush non-slip bathroom rug with black, grey and white stripes next to a white bathtub - Small Style / Simple Life-Black
Absorbent pink and white striped plush bath mat with a soft non-slip surface for bathrooms - Small Style / Simple Life-Pink Striped
Striped blue and grey plush absorbent bathroom mat on white marble floor by bathtub - Small Style / Simple Life-Blue Striped
+8
Modern Striped Soft Plush Bath Mat Absorbent Anti-Slip Flocking Bathroom Rug Machine Washable Home Floor Mat Shower Rug
$4.01-9.22
No MOQ
Flocked Bedside Rug Non-Slip Absorbent Floor Mat For Bedroom Bathroom Striped Checkerboard Modern Thickened Polyester
Flocked Bedside Rug Non-Slip Absorbent Floor Mat For Bedroom Bathroom Striped Checkerboard Modern Thickened Polyester
like
Find Similar
Blue and white checkerboard plush bath mat with pink dots on a wooden bedroom floor - 50x80cm / Bilo Blue
Plush rectangular bedside rug featuring a blue and pink checkered pattern with white border - 50x80cm / Garden
Green and cream checkered plush bedside rug with soft long strip runner design - 50x80cm / Bilo Green
Long plush bedside rug with beige and khaki checkerboard pattern for cozy bedroom decor - 50x80cm / Chocolate Beige
+50
Flocked Bedside Rug Non-Slip Absorbent Floor Mat For Bedroom Bathroom Striped Checkerboard Modern Thickened Polyester
$5.48-18.44
No MOQ
 · 
37 views
Non-Slip Bathroom Mat Absorbent Flocking Bath Rug Wave Pattern Microfiber Entrance Door Mat Mediterranean Floor Carpet
Non-Slip Bathroom Mat Absorbent Flocking Bath Rug Wave Pattern Microfiber Entrance Door Mat Mediterranean Floor Carpet
like
Find Similar
Absorbent plush bathroom mat with geometric wave pattern in blue and grey tones - 40*60cm / Green That Embraces All Rivers
Flocked absorbent bath mat with blue and grey wave pattern for bathroom decor - 40*60cm / Blue That Embraces All Rivers
Blue wave pattern flocked bath mat with non-slip backing and soft plush texture - 40*60cm / Wave Impression
+6
Non-Slip Bathroom Mat Absorbent Flocking Bath Rug Wave Pattern Microfiber Entrance Door Mat Mediterranean Floor Carpet
-4%
$3.81-8.55
No MOQ
Waterproof Polyester Shower Curtain And Anti Slip Flannel Bathroom Mats Toilet Cover Mandala Bohemian Holiday Home Decor
Waterproof Polyester Shower Curtain And Anti Slip Flannel Bathroom Mats Toilet Cover Mandala Bohemian Holiday Home Decor
like
Find Similar
Mandala patterned 4-piece bathroom set with shower curtain and matching floor mats - Shower Curtain 90x180 / Multicolor Mandala (kq001)
Waterproof polyester bathroom set with red mandala pattern shower curtain and floor mats - Shower Curtain 90x180 / Red & Beige Mandala (kq002)
4-piece bathroom set with purple and gold mandala shower curtain and matching rugs - Shower Curtain 90x180 / Purple & Gold Mandala (kq003)
Blue and purple mandala boho shower curtain with matching non-slip bath mat four-piece set - Shower Curtain 90x180 / Blue & Purple Gradient Mandala (kq004)
+76
Waterproof Polyester Shower Curtain And Anti Slip Flannel Bathroom Mats Toilet Cover Mandala Bohemian Holiday Home Decor
$4.90-12.97
Mix MOQ : 2
 · 
41 views
Free Shipping
Non-Slip Bathroom Rug Absorbent Cartoon Flocked Bath Mat Soft Microfiber Plush Floor Carpet For Bath Bedside Home Decor
Non-Slip Bathroom Rug Absorbent Cartoon Flocked Bath Mat Soft Microfiber Plush Floor Carpet For Bath Bedside Home Decor
like
Find Similar
Semi-circular yellow sunflower plush bath mat with non-slip texture in modern bathroom - Sun Flower / 51*91cm
Semicircle hill landscape bath mat in green and beige gradient plush fabric - Mountain Forest / 45*70cm
Absorbent green flower-shaped tufted bath mat with colorful floral patterns and HAPPY text - Happy Flower Forest / 45*70cm
Pink and coral red flower shaped non-slip bathroom mat with soft absorbent plush texture - Flower Shadow / 45*70cm
+21
Non-Slip Bathroom Rug Absorbent Cartoon Flocked Bath Mat Soft Microfiber Plush Floor Carpet For Bath Bedside Home Decor
-27%
$7.46-17.55
Mix MOQ : 3
 · 
22 views
Beach Towel Microfiber Quick Dry Absorbent Lightweight For Swimming Travel Pool Geometric Modern Abstract Pattern Women
Beach Towel Microfiber Quick Dry Absorbent Lightweight For Swimming Travel Pool Geometric Modern Abstract Pattern Women
like
Find Similar
Thick microfiber beach towel with geometric navy, brown, and yellow patterns - Deep Blue Coffee Color Block Geometric (1)
Thick beach towel with geometric triangle patterns in blue and yellow tones - Blue Yellow Grey Patchwork Triangle (2)
Thick beach towel with luxury geometric marble patterns and golden lines - Deep Blue Marble Gold Lines (3)
Thick beach towel with mint green and black geometric patterns and golden lines - Mint Green Polka Dot Stripes (4)
+8
Beach Towel Microfiber Quick Dry Absorbent Lightweight For Swimming Travel Pool Geometric Modern Abstract Pattern Women
-4%
$3.70
No MOQ
Highland Cow Printed Flannel Blanket Polyester Warm Throw Blanket For Couch Sofa Bed Home Decor Digital Print Blanket
Highland Cow Printed Flannel Blanket Polyester Warm Throw Blanket For Couch Sofa Bed Home Decor Digital Print Blanket
like
Find Similar
Highland cow flannel blanket with floral art print draped on a pink armchair - 100x150cm
Highland Cow Printed Flannel Blanket Polyester Warm Throw Blanket For Couch Sofa Bed Home Decor Digital Print Blanket
$4.76
No MOQ
 · 
30 sold recently
Non-Slip Bathroom Mat Absorbent Thickened Flocking Bath Rug Nordic Geometric Rectangular Floor Mat For Bathroom Bedroom
Non-Slip Bathroom Mat Absorbent Thickened Flocking Bath Rug Nordic Geometric Rectangular Floor Mat For Bathroom Bedroom
like
Find Similar
Absorbent non-slip bathroom mat with gray and white plush rectangular frame design - Small / Light Gray
Plush non-slip bathroom mat with grey border and soft cream center for home decor - Small / Dark Gray
Navy blue and white rectangular flocked bathroom mat with soft absorbent texture - Small / Navy Blue
Modern black and white flocked bathroom rug with absorbent fibers near white bathtub - Small / Black
+24
Non-Slip Bathroom Mat Absorbent Thickened Flocking Bath Rug Nordic Geometric Rectangular Floor Mat For Bathroom Bedroom
$5.19-13.83
No MOQ
Abstract Art Faux Cashmere Bathroom Mat Non-slip Water Absorbent Floor Rug Modern Botanical Maple Ginkgo Leaf Entryway Bath Mat
Abstract Art Faux Cashmere Bathroom Mat Non-slip Water Absorbent Floor Rug Modern Botanical Maple Ginkgo Leaf Entryway Bath Mat
like
Find Similar
Abstract maple leaf bath mat with soft faux cashmere texture and non-slip backing - Imitation Cashmere / 40x60cm / Red Maple Leaf (Abstract-1)
Abstract ginkgo leaf cashmere-feel bathroom mat with non-slip backing for home decor - Imitation Cashmere / 40x60cm / Golden Ginkgo (Abstract-2)
Abstract faux cashmere bathroom mat with colorful plant patterns and non-slip backing - Imitation Cashmere / 40x60cm / Artistic Sun (Abstract-3)
Abstract botanical bath mat with thick cashmere-like texture and non-slip backing - Imitation Cashmere / 40x60cm / Botanical Patchwork (Abstract-4)
+28
Abstract Art Faux Cashmere Bathroom Mat Non-slip Water Absorbent Floor Rug Modern Botanical Maple Ginkgo Leaf Entryway Bath Mat
-5%
$0.99-7.88
No MOQ
Absorbent Bath Mat Non-Slip Flocked Thick Plush Rug For Bathroom Shower Floral Marble Pattern Machine Washable
Absorbent Bath Mat Non-Slip Flocked Thick Plush Rug For Bathroom Shower Floral Marble Pattern Machine Washable
like
Find Similar
Plush bathroom mat with elegant gold marble pattern and non-slip white floral velvet - 44*76cm / Khaki Marble
Plush gray and white marble pattern bathroom floor mat with thick absorbent microfiber - 44*76cm / Grey Marble
Plush bathroom mat with elegant black and gray marble texture pattern in modern setting - 44*76cm / Black Gold Vein
Plush bathroom mat with black and gold marble pattern on non-slip absorbent fabric - 44*76cm / Dark Marble
+13
Absorbent Bath Mat Non-Slip Flocked Thick Plush Rug For Bathroom Shower Floral Marble Pattern Machine Washable
$14.38-25.91
Mix MOQ : 3
Non Slip Bathroom Rug Absorbent Flocked Floor Mat Abstract Mountain Sunset Pattern Soft Tufted Bath Mat For Washroom Entryway
Non Slip Bathroom Rug Absorbent Flocked Floor Mat Abstract Mountain Sunset Pattern Soft Tufted Bath Mat For Washroom Entryway
like
Find Similar
Absorbent rectangular bathroom mat with sunset mountain print and plush flocking texture - 40x60cm / Artistic Sun Circle
Absorbent bath mat with red sun and beige geometric pattern on light wood floor - 40x60cm / Japanese Torii Gate
Absorbent bathroom rug with abstract landscape mountains and sun on a wood floor - 50x80cm / Dreamy Blue Mountain
Absorbent bath mat with sunrise pattern and anti-slip backing for bathroom floor - 50x80cm / Cloudy Mountain Scenery
+2
Non Slip Bathroom Rug Absorbent Flocked Floor Mat Abstract Mountain Sunset Pattern Soft Tufted Bath Mat For Washroom Entryway
$5.76-9.22
No MOQ
Woven Storage Basket Paper Rope Rectangular With Wooden Handles And Removable Liner For Bathroom Desktop Organization
Woven Storage Basket Paper Rope Rectangular With Wooden Handles And Removable Liner For Bathroom Desktop Organization
like
Find Similar
Set of two woven paper rope storage baskets with wooden handles and fabric lining - Large / Flaxen
Detail of woven paper rope storage basket with white fabric liner and wooden handles - Small / Coffee
Detail of woven storage basket with off-white fabric liner and light wood handles - Small / Gray
+6
Woven Storage Basket Paper Rope Rectangular With Wooden Handles And Removable Liner For Bathroom Desktop Organization
$3.03-6.28
No MOQ
 · 
50 sold recently
Irregular Faux Cashmere Bath Mat Absorbent Non Slip Floor Rug For Bathroom Entryway Floral Letter Print Home Decor
Irregular Faux Cashmere Bath Mat Absorbent Non Slip Floor Rug For Bathroom Entryway Floral Letter Print Home Decor
like
Find Similar
Irregular faux cashmere bath mat with 'You Look Good' text and floral pattern on wood floor - 40x60 (Faux Cashmere) / Black (You Look Good)
Absorbent plush bathroom mat with flower pattern and YOU LOOK GOOD text on wood floor - 40x60 (Faux Cashmere) / Dark Green (You Look Good)
Pink irregular non-slip bathroom mat with You Look Good text on light wood floor - 40x60 (Faux Cashmere) / Pink (You Look Good)
Blue irregular cashmere-like bath mat with floral patterns and You Look Good text - 40x60 (Faux Cashmere) / Blue (You Look Good)
+36
Irregular Faux Cashmere Bath Mat Absorbent Non Slip Floor Rug For Bathroom Entryway Floral Letter Print Home Decor
-5%
$0.99-7.88
No MOQ
3D Bath Sponge Soft PVA Painless Exfoliation Dead Skin Remover For Kids And Babies Reusable With Lanyard
3D Bath Sponge Soft PVA Painless Exfoliation Dead Skin Remover For Kids And Babies Reusable With Lanyard
like
Find Similar
Blue high-density baby bath sponge with double-sided texture for gentle skin exfoliating - Blue
Soft grey exfoliating bath sponge for children showing gentle skin peeling effect - Gray
Gentle white exfoliating bath sponge for children with double-sided texture for skin - White
Pink exfoliating bath sponge for kids with double-sided scale texture and soft foam material - Pink
3D Bath Sponge Soft PVA Painless Exfoliation Dead Skin Remover For Kids And Babies Reusable With Lanyard
$2.36
No MOQ
Diatomaceous Earth Absorbent Quick Dry Bathroom Mat Set Non-Slip U-Shaped Toilet Rug Floral Geometric Marble Print Floor Mat
Diatomaceous Earth Absorbent Quick Dry Bathroom Mat Set Non-Slip U-Shaped Toilet Rug Floral Geometric Marble Print Floor Mat
like
Find Similar
3-piece floral bathroom mat set with U-shaped rug and colorful butterfly patterns - U-Shaped and Rectangular Mat Combination (Small) / Botanical Wild Flowers Green
3-piece diatom mud bathroom mat set with blue and green wave geometric patterns - U-Shaped and Rectangular Mat Combination (Small) / Lemon
Three-piece bathroom mat set with absorbent diatomaceous earth and non-slip backing - U-Shaped and Rectangular Mat Combination (Small) / Irregular Lemon
Retro daisy floral diatom mud 3-piece bathroom mat set with non-slip backing - U-Shaped and Rectangular Mat Combination (Small) / Rustic Daisy
+52
Diatomaceous Earth Absorbent Quick Dry Bathroom Mat Set Non-Slip U-Shaped Toilet Rug Floral Geometric Marble Print Floor Mat
-4%
$3.14-9.26
No MOQ
Free Shipping
Shaggy Bathroom Rug Absorbent Thick Plush Bath Mat Non Slip TPR Bottom Soft Washable Floor Carpet
Shaggy Bathroom Rug Absorbent Thick Plush Bath Mat Non Slip TPR Bottom Soft Washable Floor Carpet
like
Find Similar
White thickened plush bathroom mat with absorbent long-pile texture for shower floor - 50*80cm / White
Thick grey shaggy chenille bath mat with non-slip backing for bathroom entrance - 50*80cm / Light Gray
Plush brown absorbent bathroom rug with non-slip backing for shower and entryway - 50*80cm / Brown
Absorbent beige plush bathroom mat on grey tiles, minimalist soft rectangular floor rug - 50*80cm / Khaki
+14
Shaggy Bathroom Rug Absorbent Thick Plush Bath Mat Non Slip TPR Bottom Soft Washable Floor Carpet
$5.48-11.24
Mix MOQ : 2
 · 
20 views
Bath Mat Rugs With Toilet Lid Cover And U-Shaped Contour Mat Coral Fleece 3D Cobblestone Embossed Non-Slip Absorbent
Bath Mat Rugs With Toilet Lid Cover And U-Shaped Contour Mat Coral Fleece 3D Cobblestone Embossed Non-Slip Absorbent
like
Find Similar
Dark grey pebble pattern bath mat set with 3D memory foam coral velvet texture - Bath Mat And U-Shaped Mat / Gray
3-piece light blue pebble texture bathroom mat set with absorbent coral fleece surface - Bath Mat And U-Shaped Mat / Light Blue
3-piece grey pebble pattern bathroom rug set with bath mat, U-shaped and lid cover - Bath Mat And U-Shaped Mat / Gray
Royal blue 3-piece bathroom set with soft plush velvet and pebble stone pattern - Bath Mat And U-Shaped Mat / Dark Blue
+10
Bath Mat Rugs With Toilet Lid Cover And U-Shaped Contour Mat Coral Fleece 3D Cobblestone Embossed Non-Slip Absorbent
$2.74-4.50
Mix MOQ : 2
 · 
32 views
Cute Cartoon Animal Flower Bath Mat Faux Cashmere Non-Slip Absorbent Entrance Rug For Bathroom Kitchen Doorway Home Decor
Cute Cartoon Animal Flower Bath Mat Faux Cashmere Non-Slip Absorbent Entrance Rug For Bathroom Kitchen Doorway Home Decor
like
Find Similar
Detail of soft plush cat paw bath mat on marble floor with 3D microfiber texture - Small / Imitation Cashmere / Grass Green Cat Paw (MJXKT325-1)
Close-up of fluffy blue bathroom mat with cute cartoon cat paw prints and soft texture - Small / Imitation Cashmere / Bright Blue Cat Paw (MJXKT325-2)
Pink faux cashmere bathroom mat with cute cat paw patterns on white marble floor - Small / Imitation Cashmere / Pink Cat Paw (MJXKT325-3)
Detail of grey bathroom mat with cute white cat paw prints on marble floor - Small / Imitation Cashmere / Gray Cat Paw (MJXKT325-4)
+132
Cute Cartoon Animal Flower Bath Mat Faux Cashmere Non-Slip Absorbent Entrance Rug For Bathroom Kitchen Doorway Home Decor
-4%
$0.79-6.06
No MOQ
Memory Foam Bath Mat Super Absorbent Quick Dry Anti Slip Rug Pebble Texture For Bathroom Shower Room Floor Soft Fleece
Memory Foam Bath Mat Super Absorbent Quick Dry Anti Slip Rug Pebble Texture For Bathroom Shower Room Floor Soft Fleece
like
Find Similar
Absorbent memory foam bath mat in cream white with premium square quilted texture - 40x60cm / Beige
Soft grey memory foam bath mat with pebble texture in a modern bathroom setting - 40x60cm / Grey
Memory foam bath mat in khaki with square texture for absorbent bathroom floor use - 40x60cm / Coffee
Gray memory foam bathroom mat with soft texture and quick-dry absorbent surface - 40x60cm / Coral Grey
+32
Memory Foam Bath Mat Super Absorbent Quick Dry Anti Slip Rug Pebble Texture For Bathroom Shower Room Floor Soft Fleece
-12%
$7.48-15.27
No MOQ
 · 
1 reviews
Modern Absorbent Diatom Mud Bathroom Mat Quick Dry Anti Slip Floor Mat Abstract Floral Design Entrance Rug Home Decor
Modern Absorbent Diatom Mud Bathroom Mat Quick Dry Anti Slip Floor Mat Abstract Floral Design Entrance Rug Home Decor
like
Find Similar
Absorbent diatom mud bath mat with daisy floral print in warm orange and beige tones - 40x60cm / Diatom Mud / Daisy Pattern (MJX1023-1)
Absorbent diatom mud bath mat with abstract geometric art and spiral lines design - 40x60cm / Diatom Mud / Abstract Geometric Spiral (MJX1023-2)
Minimalist diatom mud bath mat with abstract geometric art and home slippers on floor - 40x60cm / Diatom Mud / Minimalist Lines Dots (MJX1023-3)
Detail of diatomaceous mud bath mat with abstract rainbow pattern and rounded corners - 40x60cm / Diatom Mud / Fluid Wave Rainbow (MJX1023-4)
+108
Modern Absorbent Diatom Mud Bathroom Mat Quick Dry Anti Slip Floor Mat Abstract Floral Design Entrance Rug Home Decor
-5%
$0.79-4.48
No MOQ
Free Shipping
Non-Slip Bathroom Mat With Massage Brush PVC Shower Floor Pad Suction Cups Drainage Holes Foot Scrubber Massage Mat
Non-Slip Bathroom Mat With Massage Brush PVC Shower Floor Pad Suction Cups Drainage Holes Foot Scrubber Massage Mat
like
Find Similar
Light blue non-slip bathroom mat with foot massage bristles and suction cups - 80*120cm (Oversized) / Mars Green - With Massage Brush
Beige non-slip bathroom mat with massage texture and foot scrub brush on gray tile - 80*120cm (Oversized) / Khaki - With Massage Brush
Grey bathroom non-slip shower mat with foot massage bristles and textured surface - 80*120cm (Oversized) / Grey - With Massage Brush
Non-slip light blue bathroom mat with massage points and central scrub brush area - 80*120cm (Oversized) / Light Blue - With Massage Brush
+19
Non-Slip Bathroom Mat With Massage Brush PVC Shower Floor Pad Suction Cups Drainage Holes Foot Scrubber Massage Mat
$2.82-16.89
No MOQ
 · 
14 sold recently
Modern Abstract Striped Flocked Bath Mat Soft Absorbent Non-Slip Floor Rug For Bathroom Bedroom Living Room Home Decor
Modern Abstract Striped Flocked Bath Mat Soft Absorbent Non-Slip Floor Rug For Bathroom Bedroom Living Room Home Decor
like
Find Similar
Thick flocked non-slip bath mat with yellow and grey stripes in a modern bathroom - 40x60cm / Yellow
Thick flocked rectangular bath mat with colorful stripes and non-slip backing for bathroom - 40x60cm / Rose Red
Thick flocked bathroom mat with brown geometric stripes on white marble floor - 40x60cm / Brown
Plush non-slip rectangular rug with abstract geometric stripes in blue, yellow, and black - 40x60cm / Blue
+4
Modern Abstract Striped Flocked Bath Mat Soft Absorbent Non-Slip Floor Rug For Bathroom Bedroom Living Room Home Decor
-5%
$4.93-8.21
No MOQ
Irregular Faux Cashmere Bathroom Mat Wash Your Hands Letter Print Non-slip Water Absorbent Rug For Washroom Home Decor
Irregular Faux Cashmere Bathroom Mat Wash Your Hands Letter Print Non-slip Water Absorbent Rug For Washroom Home Decor
like
Find Similar
Navy blue faux cashmere bathroom mat with colorful 'WASH YOUR HANDS' text and non-slip back - 40x60cm Faux Cashmere / Dark Blue
Irregular plush bath mat with colorful Wash Your Hands text on grey marble floor - 40x60cm Faux Cashmere / White
Pink plush bathroom rug with Wash Your Hands letters and cloud edge on marble floor - 40x60cm Faux Cashmere / Pink
+42
Irregular Faux Cashmere Bathroom Mat Wash Your Hands Letter Print Non-slip Water Absorbent Rug For Washroom Home Decor
-5%
$1.97-49.28
No MOQ
Free Shipping
Chenille Bathroom Bath Mat Absorbent Thick Non-Slip Floor Rug Machine Washable Modern Shower Door Entryway Soft Cozy
Chenille Bathroom Bath Mat Absorbent Thick Non-Slip Floor Rug Machine Washable Modern Shower Door Entryway Soft Cozy
like
Find Similar
Thick beige chenille bath mat with woven texture on bathroom marble floor - 40*60cm / Khaki
Modern white chenille bath mat with thick absorbent 3D woven texture for bathroom - 40*60cm / White
Absorbent grey chenille bath mat with woven texture in a modern bathroom setting - 40*60cm / Dark Gray
Thick navy blue chenille bath mat with absorbent textured surface for bathroom use - 40*60cm / Blue
+59
Chenille Bathroom Bath Mat Absorbent Thick Non-Slip Floor Rug Machine Washable Modern Shower Door Entryway Soft Cozy
$6.34-13.26
Mix MOQ : 2
 · 
12 views
Absorbent Coral Fleece Bathroom Mat Non Slip Striped Rectangular Indoor Floor Rug For Bath Kitchen Entrance Modern Home Decor
Absorbent Coral Fleece Bathroom Mat Non Slip Striped Rectangular Indoor Floor Rug For Bath Kitchen Entrance Modern Home Decor
like
Find Similar
Absorbent striped coral fleece bathroom mat in dark brown for non-slip home floor use - Coffee / 40*60cm (Standard Dot Bottom)
Pink striped coral velvet bathroom rug with non-slip texture and absorbent fabric - Pink / 40*60cm (Standard Dot Bottom)
Burgundy striped coral fleece bathroom mat with absorbent texture on wood floor - Burgundy / 40*60cm (Standard Dot Bottom)
Striped coral fleece bathroom mat in vibrant yellow brown with soft texture - Khaki / 40*60cm (Standard Dot Bottom)
+37
Absorbent Coral Fleece Bathroom Mat Non Slip Striped Rectangular Indoor Floor Rug For Bath Kitchen Entrance Modern Home Decor
$0.93-2.10
No MOQ
Chenille Bath Mat Non-Slip Absorbent Shaggy Rug For Bathroom Bedroom Kitchen Entryway Soft Solid Color Washable
Chenille Bath Mat Non-Slip Absorbent Shaggy Rug For Bathroom Bedroom Kitchen Entryway Soft Solid Color Washable
like
Find Similar
Green chenille bath mat with thick absorbent microfibers on light wooden floor - 50*80cm / Dark Green
Absorbent beige chenille bath mat rectangle non-slip rug for bathroom floor - 40*60cm / Camel
Soft pink chenille microfiber bathroom rug on grey tile floor near white bathtub - 40*60cm / Pink
Absorbent red chenille bath mat for bathroom floor with non-slip texture and soft pile - 40*60cm / China Red
+32
Chenille Bath Mat Non-Slip Absorbent Shaggy Rug For Bathroom Bedroom Kitchen Entryway Soft Solid Color Washable
$2.02-3.60
No MOQ
 · 
39 views
Pintuck Duvet Cover And Pillowcases French Style 3D Pleated Flower Textured Microfiber Bedding Solid Color
Pintuck Duvet Cover And Pillowcases French Style 3D Pleated Flower Textured Microfiber Bedding Solid Color
like
Find Similar
White pinched pleat bedding set including duvet cover and pillowcases in a bedroom - US-Twin: 168*229cm / White
Pinch pleat bedding set in creamy pink featuring 3D floral texture duvet cover and shams - US-Twin: 168*229cm / Creamy Pink
Black textured bedding set featuring 3D floral pinch pleat design with duvet cover and shams - US-Twin: 168*229cm / Black
Luxurious 3D floral pinched pleat bedding set in light grey with matching shams - EU-King: 220*240cm / Light Gray
+24
Pintuck Duvet Cover And Pillowcases French Style 3D Pleated Flower Textured Microfiber Bedding Solid Color
$19.88-28.82
No MOQ
 · 
170 views
Striped Microfiber Bathroom Mat Thickened Fluff Absorbent Quick Dry Non Slip Bath Rug For Shower Entrance Bedroom Solid Color
Striped Microfiber Bathroom Mat Thickened Fluff Absorbent Quick Dry Non Slip Bath Rug For Shower Entrance Bedroom Solid Color
like
Find Similar
Absorbent grey striped bathroom mat with non-slip texture for modern home decor - Light Gray / 40x60cm
Thick dark grey rectangular bathroom rug with striped plush texture and non-slip backing - Dark Gray / 40x60cm
Cream colored plush bathroom mat with striped texture and anti-slip thick material - Cream / 40x60cm
Thick brown coffee absorbent bathroom mat with striped texture and non-slip backing - Brown / 40x60cm
+4
NewStriped Microfiber Bathroom Mat Thickened Fluff Absorbent Quick Dry Non Slip Bath Rug For Shower Entrance Bedroom Solid Color
-5%
$5.20-8.76
No MOQ
Cartoon Animal Shaped Bath Mat Non Slip Absorbent Faux Cashmere Floor Rug For Bathroom Entryway Husky Pig Pug Ghost Evil Eye Design
Cartoon Animal Shaped Bath Mat Non Slip Absorbent Faux Cashmere Floor Rug For Bathroom Entryway Husky Pig Pug Ghost Evil Eye Design
like
Find Similar
Detailed texture of husky cartoon bath mat with soft faux cashmere and anti-slip backing - Husky Style / 40*60cm (Faux Cashmere)
Detailed close-up of Hamsa Hand and Evil Eye pattern on soft plush bathroom mat - Hamsa Hand Style / 40*60cm (Faux Cashmere)
Cute pink pig shaped faux cashmere bath mat with anti-slip texture on light floor tiles - Pig Style / 40*60cm (Faux Cashmere)
Cartoon pug-shaped plush bath mat with absorbent non-slip texture for home bathroom - Pug Style / 40*60cm (Faux Cashmere)
+44
Cartoon Animal Shaped Bath Mat Non Slip Absorbent Faux Cashmere Floor Rug For Bathroom Entryway Husky Pig Pug Ghost Evil Eye Design
-4%
$0.79-6.06
No MOQ
Modern Minimalist Diatom Mud Bathroom Mat Super Absorbent Non-Slip Floor Mat Quick Drying Linen Texture Bath Rug For Entryway Kitchen Toilet
Modern Minimalist Diatom Mud Bathroom Mat Super Absorbent Non-Slip Floor Mat Quick Drying Linen Texture Bath Rug For Entryway Kitchen Toilet
like
Find Similar
Absorbent linen-texture diatom mud bath mat with Bathroom lettering and non-slip backing - 40*60cm / Bathroom-1 (Linen Diatom Mud)
Detail of a beige semi-circle diatom mud bath mat with Bathroom text in a modern setting - 40*60cm / Bathroom-2 (Linen Diatom Mud)
Detailed top view of an oatmeal woven texture bath mat with black BATHROOM lettering - Bathroom-3 / Small (Linen Diatom Mud)
Detail of oval linen texture bath mat with B ATHROOM text on modern bathroom floor - Bathroom-4 / Small (Linen Diatom Mud)
+108
Modern Minimalist Diatom Mud Bathroom Mat Super Absorbent Non-Slip Floor Mat Quick Drying Linen Texture Bath Rug For Entryway Kitchen Toilet
-4%
$0.79-9.22
No MOQ
Hotel Quality Bed Pillows Soft Breathable Polyester Fiber Filling Quilted Rectangular Sleeping Pillow For Bedroom
Hotel Quality Bed Pillows Soft Breathable Polyester Fiber Filling Quilted Rectangular Sleeping Pillow For Bedroom
like
Find Similar
Set of two grey-blue hotel pillows with yellow diamond quilting and soft cotton texture - 48*74cm (Low 550g) / Blue Rhombus Single Edge
Set of 2 white hotel pillows with diamond quilted patterns and dark blue piping - 48*74cm (Low 550g) / White Rhombus Single Edge
Grey hotel pillow with yellow diamond quilting and navy blue brand label in bedroom - Starry Gray Single Side / 48*74cm (Low 550g)
Pair of luxury hotel pillows with white diamond quilting and grey gold trim details - 48*74cm (Low 550g) / White Rhombus 3D Edge
+92
Hotel Quality Bed Pillows Soft Breathable Polyester Fiber Filling Quilted Rectangular Sleeping Pillow For Bedroom
-5%
$1.89-5.21
No MOQ
 · 
310 sold recently
Marble Geometric Bathroom Shower Curtain Mat U-Shaped Rug And Toilet Lid Cover Waterproof Polyester Fabric Modern Decor
Marble Geometric Bathroom Shower Curtain Mat U-Shaped Rug And Toilet Lid Cover Waterproof Polyester Fabric Modern Decor
like
Find Similar
4-piece bathroom set with black gold marble hexagon patterns and anti-slip mats - 3-Piece Bath Mat Set / Black Gold Hexagon Marble(24-1)
Modern grey marble shower curtain set with gold geometric lines and non-slip rugs - 3-Piece Bath Mat Set / Grey Gold Geometric Marble(24-2)
Detailed 4-piece bathroom set with marble print shower curtain and matching non-slip mats - 3-Piece Bath Mat Set / Blue Green Gold Hexagon Marble(22SDYL4C)
Detail of 4-piece bathroom set with black marble pattern and gold leaf design - 3-Piece Bath Mat Set / Black Gold Hexagon Gold Leaf Marble(24-4)
+24
Marble Geometric Bathroom Shower Curtain Mat U-Shaped Rug And Toilet Lid Cover Waterproof Polyester Fabric Modern Decor
$6.48-12.97
No MOQ
Nordic Minimalist Diatom Mud Bathroom Mat Quick Dry Absorbent Anti-Slip Floor Rug For Toilet Shower Entrance Door Mat
Nordic Minimalist Diatom Mud Bathroom Mat Quick Dry Absorbent Anti-Slip Floor Rug For Toilet Shower Entrance Door Mat
like
Find Similar
Modern grey marble bathroom mat with gold veins and quick-dry absorbent material - 40x60cm (Diatomite) / Quicksand
Minimalist absorbent diatomaceous earth bath mat with gray fluid ripple texture - 40x60cm (Diatomite) / Twisted
Modern minimalist gray geometric diatomaceous earth bath mat in a bathroom setting - 40x60cm (Diatomite) / Triangle
Modern leopard print diatom mud bathroom mat with non-slip backing and gold accents - 40x60cm (Diatomite) / Scattered
+84
Nordic Minimalist Diatom Mud Bathroom Mat Quick Dry Absorbent Anti-Slip Floor Rug For Toilet Shower Entrance Door Mat
-5%
$0.79-4.48
No MOQ
Absorbent Flocking Bath Mat Non-Slip Geometric Chevron Floor Rug For Bathroom Bedroom Entrance Modern Minimalist Soft Carpet
Absorbent Flocking Bath Mat Non-Slip Geometric Chevron Floor Rug For Bathroom Bedroom Entrance Modern Minimalist Soft Carpet
like
Find Similar
Modern beige and white chevron plush bath mat on marble floor with soft texture - 50*80cm / Light Gray
Gradient gray wavy flocked absorbent bathroom rug and non-slip door mat for home decor - 50*80cm / Dark Gray
Absorbent dark coffee bath mat with white zigzag pattern next to a bathtub - 40*60cm / Coffee
Plush red bathroom mat with white geometric patterns, absorbent non-slip floor rug - 40*60cm / Burgundy
+13
NewAbsorbent Flocking Bath Mat Non-Slip Geometric Chevron Floor Rug For Bathroom Bedroom Entrance Modern Minimalist Soft Carpet
-4%
$3.81-8.55
No MOQ
Bath Mat Bathroom Rug Super Absorbent Quick Dry Anti-Slip Soft Thickened Flocked Plush Shaggy Carpet Machine Washable
Bath Mat Bathroom Rug Super Absorbent Quick Dry Anti-Slip Soft Thickened Flocked Plush Shaggy Carpet Machine Washable
like
Find Similar
Modern beige shaggy bath mat on grey tile floor in a minimalist bathroom setting - 50*80cm / Standard / Khaki
Thick grey shaggy chenille bath mat with non-slip backing for bathroom entrance - 50*80cm / Standard / Light Gray
White thickened plush bathroom mat with absorbent long-pile texture for shower floor - 50*80cm / Standard / White
Thick plush brown rectangular bath mat with ultra-absorbent texture for bathroom floors - 50*80cm / Standard / Brown
+28
Bath Mat Bathroom Rug Super Absorbent Quick Dry Anti-Slip Soft Thickened Flocked Plush Shaggy Carpet Machine Washable
$5.48-13.23
Mix MOQ : 3
Natural Loofah Facial Pads Round Exfoliating Luffa Sponge For Makeup Removal And Deep Face Cleaning Scrubber
Natural Loofah Facial Pads Round Exfoliating Luffa Sponge For Makeup Removal And Deep Face Cleaning Scrubber
like
Find Similar
Natural loofah exfoliating facial pads for gentle skin cleansing and makeup removal - Single 6x6cm (Bulk)
Natural Loofah Facial Pads Round Exfoliating Luffa Sponge For Makeup Removal And Deep Face Cleaning Scrubber
$0.12
No MOQ
 · 
44 views
Modern Geometric Argyle Flocked Bathroom Rug Non-Slip Absorbent Bath Mat Soft Machine Washable Floor Carpet For Home Decor
Modern Geometric Argyle Flocked Bathroom Rug Non-Slip Absorbent Bath Mat Soft Machine Washable Floor Carpet For Home Decor
like
Find Similar
Green and cream gradient diamond plush bathroom mat with non-slip absorbent texture - Medium / Olive Green
Plush brown and beige gradient diamond pattern non-slip bathroom mat for home - Medium / Coffee
Gradient geometric plush bathroom mat with non-slip backing and absorbent grey shaggy pile - Medium / Gray
Plush bathroom mat with red and pink diamond pattern on white marble floor - Medium / Garnet Red
+16
Modern Geometric Argyle Flocked Bathroom Rug Non-Slip Absorbent Bath Mat Soft Machine Washable Floor Carpet For Home Decor
-4%
$3.54-14.80
Mix MOQ : 2
Absorbent Bathroom Mat Thickened Plush Non Slip Rug Geometric Border Washable Shower Floor Entryway Carpet
Absorbent Bathroom Mat Thickened Plush Non Slip Rug Geometric Border Washable Shower Floor Entryway Carpet
like
Find Similar
Thick grey microfiber absorbent bath mat on white marble floor with feet stepping on it - 40x60cm / Smoke
Grey thick absorbent bathroom mat on white tile floor showing plush texture and soft use - 40x60cm / Starry Grey
Deep blue plush bathroom mat with rectangular patterns on a modern tile floor - 40x60cm / Azure Blue
Black rectangular absorbent bath mat with plush texture on white marble floor by a white tub - 40x60cm / Black
+59
Absorbent Bathroom Mat Thickened Plush Non Slip Rug Geometric Border Washable Shower Floor Entryway Carpet
-5%
$4.93-20.53
No MOQ
 · 
102 sold recently
3D Floral Diatom Mud Bath Mat Absorbent Quick Dry Anti Slip Entrance Floor Rug For Bathroom Door Home Decor
3D Floral Diatom Mud Bath Mat Absorbent Quick Dry Anti Slip Entrance Floor Rug For Bathroom Door Home Decor
like
Find Similar
3D oil painting diatom mud bath mat with blue and white floral design for bathroom entry - 60x90cm / Diatom Mud / New-04 (3D Blue & White Flower)
3D oil painting style absorbent diatom mud bath mat with white floral design for bathroom - 40x60cm / Crystal Velvet / New-02 (3D White Flower)
3D floral diatom mud bath mat with orange and blue flowers for bathroom non-slip use - 40x60cm / Crystal Velvet / New-05 (3D Orange & Blue Flower)
3D floral oil painting absorbent diatom mud bath mat in rectangular shape for bathrooms - 40x60cm / Crystal Velvet / New-06 (3D Pink & White Flower)
+36
3D Floral Diatom Mud Bath Mat Absorbent Quick Dry Anti Slip Entrance Floor Rug For Bathroom Door Home Decor
-5%
$0.75-2.36
No MOQ
 · 
84 sold recently
Creative Soap Shaped 3D Bath Mat Absorbent Quick Dry Anti Slip Rubber Polyester Bathroom Rug Floor Door Mat
Creative Soap Shaped 3D Bath Mat Absorbent Quick Dry Anti Slip Rubber Polyester Bathroom Rug Floor Door Mat
like
Find Similar
Blue soap-shaped 3D diatomaceous earth bath mat with raised SOAP lettering for bathroom - 50x80cm / Soap Blue
Pink 3D soap-shaped diatomaceous earth bath mat with raised SOAP lettering design - 30x40cm / Soap Pink
Soap-shaped purple diatom mud bath mat with 3D visual effect for home bathroom floor - 30x40cm / Soap Purple
Yellow 3D soap-shaped diatom mud bath mat with SOAP relief on bathroom floor - 30x40cm / Soap Yellow
+36
Creative Soap Shaped 3D Bath Mat Absorbent Quick Dry Anti Slip Rubber Polyester Bathroom Rug Floor Door Mat
$0.80-6.36
No MOQ
 · 
13 sold recently
Nordic Minimalist Diatom Mud Bathroom Mat Super Absorbent Non-slip Rug For Bath Kitchen Entryway Home Decor Floor Mat
Nordic Minimalist Diatom Mud Bathroom Mat Super Absorbent Non-slip Rug For Bath Kitchen Entryway Home Decor Floor Mat
like
Find Similar
Minimalist dark gray diatomaceous earth bath mat with Keep Clean slogan and non-slip texture - Diatom Mud (40x60) / KeepClean Dark Gray
Minimalist navy blue diatomaceous mud bath mat with Keep Clean slogan and non-slip texture - Keepclean Blue / 40x60cm (Diatomite)
Minimalist olive green absorbent diatom mud bathroom mat with Keep Clean graphic print - Keepclean Fruit Green / 40x60cm (Diatomite)
Close-up of brown diatom mud bath mat with KEEP CLEAN text and leather texture - Keepclean Brown / 40x60cm (Diatomite)
+116
Nordic Minimalist Diatom Mud Bathroom Mat Super Absorbent Non-slip Rug For Bath Kitchen Entryway Home Decor Floor Mat
-5%
$0.79-4.48
No MOQ
Free Shipping
Marble Print Diatom Mud Bathroom Mat Super Absorbent Non-Slip Quick Dry Floor Mat For Toilet Entrance Modern Home Decor
Marble Print Diatom Mud Bathroom Mat Super Absorbent Non-Slip Quick Dry Floor Mat For Toilet Entrance Modern Home Decor
like
Find Similar
Modern grey marble diatom mud bathroom mat with gold sand lines for quick dry absorption - 40*60cm / Terry Light Gray Gold
Modern grey marble pattern diatomaceous mud bathroom mat with anti-slip texture - 40*60cm / Nanyuan Hibiscus Light Gray
Modern geometric diatom mud bath mat with non-slip gray and gold patterns for bathroom - Terry White Gray / 40x60cm (Diatomite)
Modern grey geometric bathroom mat with gold lines on white marble floor decor - 40*60cm / Terry White Gray Mountain
+124
Marble Print Diatom Mud Bathroom Mat Super Absorbent Non-Slip Quick Dry Floor Mat For Toilet Entrance Modern Home Decor
$0.83-4.70
No MOQ
Free Shipping
Thickened Microfiber Bath Mat Non-Slip Absorbent Bathroom Rug For Shower Door Machine Washable Geometric Floor Mat
Thickened Microfiber Bath Mat Non-Slip Absorbent Bathroom Rug For Shower Door Machine Washable Geometric Floor Mat
like
Find Similar
Thick absorbent beige bath mat with embossed Greek key border on marble floor - 40x60 / Cream
Absorbent bathroom mat in warm coffee brown with thick non-slip velvet texture - 40x60 / Brown
Thick dark grey rectangular absorbent bath mat with plush texture for bathroom - 40x60 / Dark Gray
Thick dark gray absorbent bath mat with geometric non-slip texture for bathroom floors - 40x60 / Light Gray
+4
Thickened Microfiber Bath Mat Non-Slip Absorbent Bathroom Rug For Shower Door Machine Washable Geometric Floor Mat
$5.48-9.22
No MOQ
Absorbent Bath Mat Tufted Microfiber Non Slip Bathroom Rug Cute Letter Pattern Home Decor
Absorbent Bath Mat Tufted Microfiber Non Slip Bathroom Rug Cute Letter Pattern Home Decor
like
Find Similar
Plush rectangular bath mat with WASH YOUR HANDS slogan and colorful handprints - Wash Your Hands (White) / 40x60cm
Absorbent white bath mat with colorful Brush Your Teeth text and blue toothbrush icon - Brush Your Teeth (Beige) / 40x60cm
Pink absorbent bathroom rug with Splish Splash woven letters for home safety - Splish Splash (Pink) / 40x60cm
+3
Absorbent Bath Mat Tufted Microfiber Non Slip Bathroom Rug Cute Letter Pattern Home Decor
$5.76-9.22
No MOQ
Absorbent Microfiber Bathroom Mat Anti Slip Thick Plush Bath Rug Modern Geometric Striped Entryway Door Mat For Shower Washroom
Absorbent Microfiber Bathroom Mat Anti Slip Thick Plush Bath Rug Modern Geometric Striped Entryway Door Mat For Shower Washroom
like
Find Similar
Absorbent cream bath mat with geometric pattern on marble floor for home decor - 40x60cm / Starry Sky Style
Absorbent cream-style bathroom rug with colorful geometric semicircles and stripes - 40x60cm / Rainbow Paradise Style
+4
Absorbent Microfiber Bathroom Mat Anti Slip Thick Plush Bath Rug Modern Geometric Striped Entryway Door Mat For Shower Washroom
$5.19-8.65
No MOQ
Non Slip Bathroom Rug Bath Mat Flocked Polyester Water Absorbent Thick Plush Carpet For Shower Door Machine Washable Cute Rainbow Floral Leaf Design
Non Slip Bathroom Rug Bath Mat Flocked Polyester Water Absorbent Thick Plush Carpet For Shower Door Machine Washable Cute Rainbow Floral Leaf Design
like
Find Similar
Plush bath mat with gray, green, and yellow geometric smile design for bathroom use - 50*80cm / Four-Colored Stones
Close-up of fluffy rainbow bath mat texture in a cozy bathroom setting - 50*80cm / Over The Rainbow
Non-slip rectangular bathroom mat with multi-color leaf pattern on off-white base - 50*80cm / Dancing Leaves
Grey rectangular plush bathroom rug with white bathtub motif and BATHROOM text - 50*80cm / Bathing
+71
Non Slip Bathroom Rug Bath Mat Flocked Polyester Water Absorbent Thick Plush Carpet For Shower Door Machine Washable Cute Rainbow Floral Leaf Design
-23%
$7.46-10.35
Mix MOQ : 2
 · 
19 views
Absorbent Bathroom Bath Mat Thick Microfiber Non-Slip Washable Rug For Shower Room Doorway Flocking Soft Foot Pad
Absorbent Bathroom Bath Mat Thick Microfiber Non-Slip Washable Rug For Shower Room Doorway Flocking Soft Foot Pad
like
Find Similar
Absorbent beige bathroom runner with wave patterns and anti-slip flocking texture - 50*100cm / Geometric Wave
Rectangle beige and white geometric bath mat with plush texture on wood floor - 50*100cm / Leiman Abstract
Absorbent beach wave patterned long bathroom rug with anti-slip backing for home - 50*80cm / Seaside Footprints
Absorbent bath mat with blue and beige wave pattern on modern bathroom floor - 50*80cm / Ocean View
+16
Absorbent Bathroom Bath Mat Thick Microfiber Non-Slip Washable Rug For Shower Room Doorway Flocking Soft Foot Pad
$12.36-16.11
Mix MOQ : 3
Absorbent Bath Mat Non-Slip TPR Flocked Polyester Plush Bathroom Rug Rainbow Geometric Quick Dry Washable Shower Carpet
Absorbent Bath Mat Non-Slip TPR Flocked Polyester Plush Bathroom Rug Rainbow Geometric Quick Dry Washable Shower Carpet
like
Find Similar
Absorbent blue gradient mountain bath mat with soft non-slip texture on bathroom floor - 40*60cm / Sky and Sea
Plush rainbow and clouds bath mat with RAINBOWS lettering and non-slip backing - 40*60cm / Starry Rainbow
Absorbent plush bathroom mat with a green wave gradient design in a shower setting - 40*60cm / Calm Beach
Absorbent green gradient forest bath mat with non-slip backing for bathroom entry - 40*60cm / Green Fields and Mountains
+51
Absorbent Bath Mat Non-Slip TPR Flocked Polyester Plush Bathroom Rug Rainbow Geometric Quick Dry Washable Shower Carpet
-23%
$7.46-21.87
Mix MOQ : 3
 · 
20 views
Christmas Gingerbread House Bath Mat Non-Slip Absorbent Diatom Mud Floor Rug For Bathroom Kitchen Entrance Decorative Carpet
Christmas Gingerbread House Bath Mat Non-Slip Absorbent Diatom Mud Floor Rug For Bathroom Kitchen Entrance Decorative Carpet
like
Find Similar
Absorbent Christmas bathroom mat with gingerbread house and tree on white hexagonal tiles - Gingerbread House Snow Scene Style (JQ240709-1) / 40x60cm Diatom Mud
Absorbent Christmas gingerbread house bath mat with non-slip backing for bathroom decor - Gingerbread House Heart Window Style (JQ240709-2) / 40x60cm Diatom Mud
Christmas diatom mud bath mat with snowy candy house and tree on white tile floor - Christmas Tree Snowman Candy House Style (JQ240709-3) / 40x60cm Diatom Mud
Christmas buffalo plaid bath mat featuring gingerbread houses and sweets on white tiles - Red Black Buffalo Plaid Gingerbread House Style (JQ240709-4) / 40x60cm Diatom Mud
+52
NewChristmas Gingerbread House Bath Mat Non-Slip Absorbent Diatom Mud Floor Rug For Bathroom Kitchen Entrance Decorative Carpet
-4%
$0.79-5.27
No MOQ
Free Shipping
Modern Striped Coral Fleece Bath Mat Absorbent Non-Slip Soft Polyester Floor Mat For Bathroom Entryway Home Decor
Modern Striped Coral Fleece Bath Mat Absorbent Non-Slip Soft Polyester Floor Mat For Bathroom Entryway Home Decor
like
Find Similar
Absorbent light grey striped coral fleece bathroom mat with anti-slip design - 40x60cm / Light Gray
Absorbent grey striped coral fleece bathroom mat with memory foam slow rebound effect - 40x60cm / Dark Gray
Chocolate brown memory foam bath mat with striped texture and anti-slip water absorption - 40x60cm / Coffee
Close-up of khaki striped coral fleece bath mat showing water-absorbent texture and soft fabric - 40x60cm / Camel
+44
Modern Striped Coral Fleece Bath Mat Absorbent Non-Slip Soft Polyester Floor Mat For Bathroom Entryway Home Decor
$0.93-2.10
No MOQ
Absorbent Diatom Mud Bathroom Floor Mat Non-slip Fast Dry Entryway Door Mat Cartoon Floral Abstract Rug For Home Kitchen Bath
Absorbent Diatom Mud Bathroom Floor Mat Non-slip Fast Dry Entryway Door Mat Cartoon Floral Abstract Rug For Home Kitchen Bath
like
Find Similar
Detail of bohemian mandala diatom mud mat on light wood floor by a French door - 40x60cm (Diatomaceous Mud) / Paisley Pattern
Detail of diatom mud floor mat with colorful chevron pattern on wood floor - Colorful Wooden Wall / 40x60cm (Diatomite)
Absorbent diatom mud mat with colorful floral pattern for entryway and bathroom floor - Colorful Art Flowers / 40x60cm (Diatomite)
Artistic oil painting style diatom mud mat with colorful giraffes on light wood floor - Multicolor Giraffe / 40x60cm (Diatomite)
+236
Absorbent Diatom Mud Bathroom Floor Mat Non-slip Fast Dry Entryway Door Mat Cartoon Floral Abstract Rug For Home Kitchen Bath
-5%
$0.79-4.48
No MOQ
Go to

More in home & kitchen

Explore more in bedding & bathroom

homecolorholdertravelstylepolyesterdoubleheaddesignheart
hangingplasticstorageshapecleaningsimplekidslayerwhitedaily

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access