Everful

Wholesale bedding & bathroom

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Bedding & Bathroom

Find the perfect pieces: wall stickers, window stickers, kitchen stickers and more

All products in bedding & bathroom

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Nordic Geometric Abstract Green Pillowcase Short Plush Printed Decorative Pillow Cover For Sofa Living Room Home Decor
Nordic Geometric Abstract Green Pillowcase Short Plush Printed Decorative Pillow Cover For Sofa Living Room Home Decor
like
Find Similar
Detail of Nordic geometric cushion cover with green abstract female profile design - Minimalist Side Profile Design (CRD80-1)
Detailed texture of square pillowcase with Nordic abstract geometric patterns - Abstract Geometric Patchwork Style (CRD80-2)
Nordic square pillow cover with green botanical leaves and geometric abstract art - Abstract Plant Leaf Style (CRD80-3)
Detail of Nordic geometric throw pillow cover with abstract mid-century modern art pattern - Nordic Minimalist Dots and Arcs Style (CRD80-4)
+18
Nordic Geometric Abstract Green Pillowcase Short Plush Printed Decorative Pillow Cover For Sofa Living Room Home Decor
$1.41
Mix MOQ : 2
Bathroom Sign Wall Sticker Black PVC Bathtub Silhouette Lettering Decal Waterproof Home Decor Removable Door Mural Signage
Bathroom Sign Wall Sticker Black PVC Bathtub Silhouette Lettering Decal Waterproof Home Decor Removable Door Mural Signage
like
Find Similar
Self-adhesive bathroom wall sticker featuring a woman in a bathtub silhouette and bubbles - 14.3x20cm
Bathroom Sign Wall Sticker Black PVC Bathtub Silhouette Lettering Decal Waterproof Home Decor Removable Door Mural Signage
$0.29
No MOQ
Nautical Anchor Sailboat Printed Pillow Cover Polyester Square Cushion Case For Home Sofa Car Nordic Vintage Style Decor
Nautical Anchor Sailboat Printed Pillow Cover Polyester Square Cushion Case For Home Sofa Car Nordic Vintage Style Decor
like
Find Similar
Navy blue linen nautical anchor pillow case with sailing ship and ocean legends print - 45x45cm / Navy Blue (YMD272-1)
Linen anchor sailboat throw pillow cover in navy blue with vintage nautical print - 45x45cm / Dark Blue White Pattern (YMD272-2)
Navy blue linen anchor throw pillow cover with white sailing crew graphic print - 45x45cm / Navy Anchor Print (YMD272-3)
Navy blue linen nautical pillow cover with white anchor design and King of the Sea text - 45x45cm / Navy Rope Anchor (YMD272-4)
Nautical Anchor Sailboat Printed Pillow Cover Polyester Square Cushion Case For Home Sofa Car Nordic Vintage Style Decor
$1.38
Mix MOQ : 2
Cartoon Animal Peach Skin Throw Pillowcase Square Decorative Cushion Cover For Children Room Sofa Home Decor Modern Style
Cartoon Animal Peach Skin Throw Pillowcase Square Decorative Cushion Cover For Children Room Sofa Home Decor Modern Style
like
Find Similar
Detail of white square pillow case with a cute yellow cartoon giraffe and blue clouds - Giraffe Style (DRD234-1)
Detail of square pillowcase featuring a cartoon polar bear design and LOVE text - Love Polar Bear Style (DRD234-2)
Detail showing cartoon elephant pattern with pink bow on white square cushion cover - Ballet Elephant Style (DRD234-3)
Close-up of square blue pillow cover featuring a cute cartoon elephant with a large bow - Bowknot Elephant Style (DRD234-4)
+36
Cartoon Animal Peach Skin Throw Pillowcase Square Decorative Cushion Cover For Children Room Sofa Home Decor Modern Style
$1.30
Mix MOQ : 2
PVC Bathroom Door Sticker Black Lettering English Slogan Wall Decal Removable Waterproof Home Restroom Decor Sign Sticker
PVC Bathroom Door Sticker Black Lettering English Slogan Wall Decal Removable Waterproof Home Restroom Decor Sign Sticker
like
Find Similar
Detailed size specifications for Bathroom wall decal FX-A295 with artistic lettering - 17x39cm
PVC Bathroom Door Sticker Black Lettering English Slogan Wall Decal Removable Waterproof Home Restroom Decor Sign Sticker
$0.17
No MOQ
Modern Geometric Laser Bronzing Plush Pillow Cover Nordic Minimalist Gold Stamped Patchwork Cushion Case For Sofa Home Decor
Modern Geometric Laser Bronzing Plush Pillow Cover Nordic Minimalist Gold Stamped Patchwork Cushion Case For Sofa Home Decor
like
Find Similar
White square cushion cover featuring a pink heart and gold foil princess calligraphy - 45x45 (With 500g Core) / Style 2
Modern geometric pillow cover with pink white and gold foil triangles on soft fabric - 45x45 (With 500g Core) / Style 1
Modern pink black white geometric pillow cover with metallic gold laser stamping - 45x45 (With 500g Core) / Style 4
Modern pink and blue geometric cushion cover with metallic gold stripes for sofas - 45x45 (With 500g Core) / Style 3
+8
Modern Geometric Laser Bronzing Plush Pillow Cover Nordic Minimalist Gold Stamped Patchwork Cushion Case For Sofa Home Decor
-5%
$1.37-3.97
Mix MOQ : 2
Creative Bathroom Decoration Wall Sticker Black Silhouette Woman In Bathtub Floral Pattern PVC Waterproof Self Adhesive Mural
Creative Bathroom Decoration Wall Sticker Black Silhouette Woman In Bathtub Floral Pattern PVC Waterproof Self Adhesive Mural
like
Find Similar
Detail showing dimensions of a bathroom wall sticker with a woman in a bathtub - 22*30cm/fun-f389 / Black
Creative Bathroom Decoration Wall Sticker Black Silhouette Woman In Bathtub Floral Pattern PVC Waterproof Self Adhesive Mural
$0.86
No MOQ
Bathroom Wall Sticker Bathtub Icon Sign Removable Waterproof PVC Decal Black Lettering For Home Bathroom Tub Wall Decoration
Bathroom Wall Sticker Bathtub Icon Sign Removable Waterproof PVC Decal Black Lettering For Home Bathroom Tub Wall Decoration
like
Find Similar
Self-adhesive black vinyl bathroom wall sticker with bathtub graphic 60x22cm - 60x22cm / Black
Bathroom Wall Sticker Bathtub Icon Sign Removable Waterproof PVC Decal Black Lettering For Home Bathroom Tub Wall Decoration
$1.12
Mix MOQ : 6
Soak Relax Enjoy Wall Sticker With Bubbles Decorative PVC Vinyl Decal For Bathroom Kitchen Home Decor Black Wall Mural
Soak Relax Enjoy Wall Sticker With Bubbles Decorative PVC Vinyl Decal For Bathroom Kitchen Home Decor Black Wall Mural
like
Find Similar
Black Soak Relax Enjoy bubble wall sticker set with paste layout and size guide - Soak Relax Enjoy Style (PB606)
Soak Relax Enjoy Wall Sticker With Bubbles Decorative PVC Vinyl Decal For Bathroom Kitchen Home Decor Black Wall Mural
$0.92
Mix MOQ : 4
Multifunctional Travel Pillow Blanket Dual Use Soft Plush Cartoon Fruit Embroidered Folding Cushion Quilt For Office Car Nap
Multifunctional Travel Pillow Blanket Dual Use Soft Plush Cartoon Fruit Embroidered Folding Cushion Quilt For Office Car Nap
like
Find Similar
Detail of pink quilted blanket unfolding from a grey cushion with peach embroidery - Peach / Folded 40x40cm Unfolded 115x145cm
Pink and yellow 2-in-1 folding pillow blanket with cute fried egg pattern for office use - Fried Egg / Folded 40x40cm Unfolded 115x145cm
Detail view of a blue plush carrot pattern cushion folding into a travel blanket on a beige sofa - New Carrot / Folded 40x40cm Unfolded 115x145cm
Close-up of a purple cactus pillow unfolding into a beige quilted travel blanket - Purple Cactus / Folded 40x40cm Unfolded 115x145cm
+3
Multifunctional Travel Pillow Blanket Dual Use Soft Plush Cartoon Fruit Embroidered Folding Cushion Quilt For Office Car Nap
$6.86
No MOQ
 · 
50 views
Vintage Dutch Velvet Throw Pillow Case Solid Color Decorative Soft Cushion Cover Pressed Edge For Sofa Bed Living Room Home Decor
Vintage Dutch Velvet Throw Pillow Case Solid Color Decorative Soft Cushion Cover Pressed Edge For Sofa Bed Living Room Home Decor
like
Find Similar
Luxurious purple velvet cushion cover with piped edges on a beige sofa - 45x45 (With 500g Core) / Bright Purple
Dutch velvet square pillowcase in elegant mauve pink on a sofa for cozy home decor - 39 Purple Pink / 45x45 (With 500g Core)
Olive green velvet square pillow case with piped edges on a white sofa cushion - 63 Yellow-green / 45x45 (With 500g Core)
Dutch velvet square pillowcase in magenta with elegant decorative piping on beige sofa - 44 Rose / 45x45 (With 500g Core)
+92
Vintage Dutch Velvet Throw Pillow Case Solid Color Decorative Soft Cushion Cover Pressed Edge For Sofa Bed Living Room Home Decor
-5%
$2.46-9.03
Mix MOQ : 2
3D Abstract Cross Flannel Throw Blanket Blue Swirl Art Soft Fleece Nap Blanket For Home Decor Bedding Blanket
3D Abstract Cross Flannel Throw Blanket Blue Swirl Art Soft Fleece Nap Blanket For Home Decor Bedding Blanket
like
Find Similar
Artistic cross print flannel blanket with blue swirls on a modern grey sofa - 100x150cm
3D Abstract Cross Flannel Throw Blanket Blue Swirl Art Soft Fleece Nap Blanket For Home Decor Bedding Blanket
$4.76
No MOQ
 · 
10 views
Watercolor Peony Floral Butterfly Toilet Sticker Waterproof Removable PVC Self Adhesive Wall Decal For Bathroom Home Decor
Watercolor Peony Floral Butterfly Toilet Sticker Waterproof Removable PVC Self Adhesive Wall Decal For Bathroom Home Decor
like
Find Similar
Floral butterfly wall sticker with sunflower and pink blooms for bathroom decor 30x20cm - Floral Butterfly Style (MS7052)
Pink peony and butterfly self-adhesive PVC wall sticker for bathroom decor, 30x30cm size - Floral Butterfly Style (MS7051)
NewWatercolor Peony Floral Butterfly Toilet Sticker Waterproof Removable PVC Self Adhesive Wall Decal For Bathroom Home Decor
$0.78
Mix MOQ : 2
Pink Poppy Flower Purple Butterfly Toilet Sticker Waterproof PVC Bathroom Decal Removable Floral Home Mural Decoration
Pink Poppy Flower Purple Butterfly Toilet Sticker Waterproof PVC Bathroom Decal Removable Floral Home Mural Decoration
like
Find Similar
Detail showing 29x29cm square pink floral and purple butterfly wall sticker dimensions - 29*29CM/fun-m24
Pink Poppy Flower Purple Butterfly Toilet Sticker Waterproof PVC Bathroom Decal Removable Floral Home Mural Decoration
$0.72
No MOQ
Purple Lavender Butterfly Toilet Sticker PVC Waterproof Removable Wisteria Flower Wall Decal For Bathroom Home Decor
Purple Lavender Butterfly Toilet Sticker PVC Waterproof Removable Wisteria Flower Wall Decal For Bathroom Home Decor
like
Find Similar
Detailed dimension guide for purple lavender butterfly wall stickers showing size specs - Purple Floral Butterfly Style (HY-M302) / 29x29cm
NewPurple Lavender Butterfly Toilet Sticker PVC Waterproof Removable Wisteria Flower Wall Decal For Bathroom Home Decor
$0.86
No MOQ
Dolphin Flower Wall Sticker Waterproof PVC Self Adhesive Ocean Animal Tropical Hibiscus Floral Decal For Bathroom Toilet Decor
Dolphin Flower Wall Sticker Waterproof PVC Self Adhesive Ocean Animal Tropical Hibiscus Floral Decal For Bathroom Toilet Decor
like
Find Similar
Detailed 30cm square wall sticker featuring a blue dolphin and colorful hibiscus flowers - 30*30CM In Bag
Dolphin Flower Wall Sticker Waterproof PVC Self Adhesive Ocean Animal Tropical Hibiscus Floral Decal For Bathroom Toilet Decor
$0.81
No MOQ
Round Peony Mosaic PVC Wall Sticker Waterproof Self Adhesive Bathroom Decoration Chinese Style Floral Toilet Lid Decal
Round Peony Mosaic PVC Wall Sticker Waterproof Self Adhesive Bathroom Decoration Chinese Style Floral Toilet Lid Decal
like
Find Similar
Peony flower wall sticker with orange mosaic pattern and Greek key border design - Gravel Lotus (TA219)
Round Peony Mosaic PVC Wall Sticker Waterproof Self Adhesive Bathroom Decoration Chinese Style Floral Toilet Lid Decal
$0.92
Mix MOQ : 4
Watercolor Daisy Butterfly Toilet Sticker Waterproof Self Adhesive Floral Lid Tank Decal For Bathroom Home Decor
Watercolor Daisy Butterfly Toilet Sticker Waterproof Self Adhesive Floral Lid Tank Decal For Bathroom Home Decor
like
Find Similar
Detail view of watercolor daisy and butterfly wall decals with 29cm size dimensions - MG-M015
Watercolor Daisy Butterfly Toilet Sticker Waterproof Self Adhesive Floral Lid Tank Decal For Bathroom Home Decor
$0.58
No MOQ
American Vintage Rose Floral Peach Skin Pillowcase Modern Pastoral Decorative Pink Flower Throw Pillow Cover For Home Couch
American Vintage Rose Floral Peach Skin Pillowcase Modern Pastoral Decorative Pink Flower Throw Pillow Cover For Home Couch
like
Find Similar
Peach skin pillowcase featuring artistic pink ranunculus floral print on white background - 18x18 Inch / Pink Ranunculus Art Style (DRD32-1)
Paris themed peach skin pillowcase with pink peony floral patterns for sofa decor - 18x18 Inch / French Vintage Paris Peony Style (DRD32-2)
Pink rose floral pillow case with vintage Love script and postage print on peach skin fabric - 18x18 Inch / Vintage Postmark Rose Love Style (DRD32-3)
Peach skin pillowcase featuring pink peony flowers and vintage Paris typography print - 18x18 Inch / French Vintage Paris Pot Peony Style (DRD32-4)
+10
American Vintage Rose Floral Peach Skin Pillowcase Modern Pastoral Decorative Pink Flower Throw Pillow Cover For Home Couch
-4%
$1.18
Mix MOQ : 2
Green Plant Leaves Butterflies Flower Toilet Sticker PVC Decorative Waterproof Wall Decal For Bathroom Home Decor
Green Plant Leaves Butterflies Flower Toilet Sticker PVC Decorative Waterproof Wall Decal For Bathroom Home Decor
like
Find Similar
Detailed sheet of botanical wall stickers with green leaves, butterflies and gems - Plant and Butterfly Pattern (fun-m105)
Green Plant Leaves Butterflies Flower Toilet Sticker PVC Decorative Waterproof Wall Decal For Bathroom Home Decor
$0.72
No MOQ
Tropical Floral Toilet Stickers Removable PVC Wall Decal For Bathroom Water Tank Decor Watercolor Flower Leaf Pot Plant Decorative Sticker
Tropical Floral Toilet Stickers Removable PVC Wall Decal For Bathroom Water Tank Decor Watercolor Flower Leaf Pot Plant Decorative Sticker
like
Find Similar
Detail of colorful floral wall stickers with pink peonies and purple tulips on white - Multicolor Floral (HY-M012) / 25*29cm
Detailed watercolor hydrangea wall decal in a brown pot for tropical home decor - Hydrangea Potted Plant (HY-M013) / 27*29CM
Macro detail of tropical watercolor leaves wall decal with vibrant green textures - Tropical Broadleaf (HY-M014) / 23*29cm
Detail showing tropical alocasia wall sticker in watercolor pot with wooden base - Realistic Green Plant (HY-M015) / 25*29cm
Tropical Floral Toilet Stickers Removable PVC Wall Decal For Bathroom Water Tank Decor Watercolor Flower Leaf Pot Plant Decorative Sticker
$0.72
No MOQ
Blue Mosaic Sea Turtle Bathroom Wall Stickers PVC Waterproof DIY Glass Door Decals For Shower Room Marine Home Decor
Blue Mosaic Sea Turtle Bathroom Wall Stickers PVC Waterproof DIY Glass Door Decals For Shower Room Marine Home Decor
like
Find Similar
Blue gemstone sea turtle wall decals set including bubbles for bathroom decor stickers - Blue Sea Turtle (PH-QT852)
Blue Mosaic Sea Turtle Bathroom Wall Stickers PVC Waterproof DIY Glass Door Decals For Shower Room Marine Home Decor
$1.87
No MOQ
Vintage Nautical Cotton Linen Throw Pillow Case Sea Star Anchor Rudder Print Square Cushion Cover For Sofa Living Room Home Decor
Vintage Nautical Cotton Linen Throw Pillow Case Sea Star Anchor Rudder Print Square Cushion Cover For Sofa Living Room Home Decor
like
Find Similar
Close-up of anchor print with rope on nautical square cushion cover in linen fabric texture - Blue Polka Dot Anchor (Style 1)
Detail of nautical cushion cover with blue anchor rudder print on linen texture - Blue White Geometric Rudder (Style 2)
Detail of nautical cushion cover showing textured linen fabric and blue lifebuoy pattern - Blue Plaid Lifesaver (Style 3)
Detailed view of nautical lifebuoy print on linen-textured square cushion cover - Red White Wood Grain Lifesaver (Style 4)
+36
Vintage Nautical Cotton Linen Throw Pillow Case Sea Star Anchor Rudder Print Square Cushion Cover For Sofa Living Room Home Decor
-4%
$1.15
No MOQ
Absorbent Non Slip Floor Mat Bohemian Paisley Mandala Print Flannel Area Rug For Bathroom Living Room Kitchen Entryway
Absorbent Non Slip Floor Mat Bohemian Paisley Mandala Print Flannel Area Rug For Bathroom Living Room Kitchen Entryway
like
Find Similar
Vibrant yellow bohemian flannel floor mat with ethnic owl pattern and blue slippers - 40x60cm / Style 1-Yellow Owl
Detailed close-up of bohemian runner rug with paisley mandala print on light wood floor - 40x60cm / Style 2-Rose Red Paisley
Bohemian geometric runner rug with vibrant patterns on a modern grey wood floor - 40x60cm / Style 3-Red Yellow Geometric
Rectangular bohemian flannel bath mat with colorful mandala pattern and non-slip backing - 40x60cm / Style 4-Pink Blue Mandala
+21
Absorbent Non Slip Floor Mat Bohemian Paisley Mandala Print Flannel Area Rug For Bathroom Living Room Kitchen Entryway
$3.46-10.95
No MOQ
Vintage Linen Lavender Flower Throw Pillow Cover Decorative Floral Letter Print Square Cushion Case For Home Sofa Couch
Vintage Linen Lavender Flower Throw Pillow Cover Decorative Floral Letter Print Square Cushion Case For Home Sofa Couch
like
Find Similar
Purple spring flower pillow case with hello LOVE print on white sofa decor - 45*45cm (No Insert) / Purple Artistic Letter Pattern (SPP002-1)
Lavender flower cotton linen pillow cover with Love lives here text on white sofa - 45*45cm (No Insert) / Lavender Floral Pattern (SPP002-2)
Lavender flower pillow cover with purple vintage bicycle print on linen sofa cushion - 45*45cm (No Insert) / Bicycle Lavender Pattern (SPP002-3)
Purple lavender floral pillow cover with gold Flower Market text on a cozy white sofa - 45*45cm (No Insert) / Vintage Flowers Market Pattern (SPP002-4)
Vintage Linen Lavender Flower Throw Pillow Cover Decorative Floral Letter Print Square Cushion Case For Home Sofa Couch
$1.30
Mix MOQ : 2
Waterproof PVC Butterfly Flower Basket Toilet Lid Decal Self Adhesive Wall Sticker For Bathroom Home Decor Removable 3D Pastoral Style
Waterproof PVC Butterfly Flower Basket Toilet Lid Decal Self Adhesive Wall Sticker For Bathroom Home Decor Removable 3D Pastoral Style
like
Find Similar
Detail showing dimensions of butterfly and flower basket self-adhesive bathroom wall sticker - Flower Basket Rainbow Butterfly Style (HY-M415)
Waterproof PVC Butterfly Flower Basket Toilet Lid Decal Self Adhesive Wall Sticker For Bathroom Home Decor Removable 3D Pastoral Style
$0.86
No MOQ
Nordic Ins Style Chenille Cushion Cover Moss Green Houndstooth Embroidered Leaf Handmade Pleated Decorative Pillowcase For Sofa
Nordic Ins Style Chenille Cushion Cover Moss Green Houndstooth Embroidered Leaf Handmade Pleated Decorative Pillowcase For Sofa
like
Find Similar
Nordic ins style cushion cover with green embroidered leaf on a modern brown chair - 45x45 / 3D Embroidered Leaf
Nordic houndstooth throw pillow cover in green and white on a modern armchair - 45x45 / Green Houndstooth
Dark green velvet pillow cover with elegant V-shaped pleated design on a modern grey chair - 45x45 / Handmade Pleats
Olive green square throw pillow cover with textured bouclé fabric on a modern chair - 45x45 / Moss Green Chenille
+2
Nordic Ins Style Chenille Cushion Cover Moss Green Houndstooth Embroidered Leaf Handmade Pleated Decorative Pillowcase For Sofa
-5%
$3.43-6.03
Mix MOQ : 2
Floral Bathroom Wall Sticker Waterproof PVC Flower Butterfly Door Decal Art Sign For Restroom Home Decor Modern Minimalist
Floral Bathroom Wall Sticker Waterproof PVC Flower Butterfly Door Decal Art Sign For Restroom Home Decor Modern Minimalist
like
Find Similar
Detail of floral bathroom wall sticker with green leaves and bathroom lettering - Watercolor Floral Bathroom Sign (fun-f18)
Floral Bathroom Wall Sticker Waterproof PVC Flower Butterfly Door Decal Art Sign For Restroom Home Decor Modern Minimalist
$0.72
No MOQ
Removable PVC Floral Basket Toilet Lid Stickers Decorative Flower Wall Decals For Bathroom Restroom Home Decoration
Removable PVC Floral Basket Toilet Lid Stickers Decorative Flower Wall Decals For Bathroom Restroom Home Decoration
like
Find Similar
Detail showing dimensions and layout for creative flower basket embossed wall stickers - 25*29cm*2pcs/fun-m516
Removable PVC Floral Basket Toilet Lid Stickers Decorative Flower Wall Decals For Bathroom Restroom Home Decoration
$1.01
No MOQ
Nordic Geometric Triangle Plush Cushion Cover Quilted Embroidery Decorative Pillow Case Soft Throw Pillowcase Home Decor
Nordic Geometric Triangle Plush Cushion Cover Quilted Embroidery Decorative Pillow Case Soft Throw Pillowcase Home Decor
like
Find Similar
Terracotta plush pillow case with geometric triangle pattern in cozy living room - 45x45 with 400g Core / Light Brown
Cream white plush pillow covers with 3D geometric triangle embroidery and soft texture - 45x45 with 400g Core / White
Pink plush cushion covers with geometric triangle patterns in square and lumbar styles - 45x45 with 400g Core / Pink
Nordic beige geometric plush pillowcase with textured 3D triangle pattern - 45x45 with 400g Core / Apricot
+56
Nordic Geometric Triangle Plush Cushion Cover Quilted Embroidery Decorative Pillow Case Soft Throw Pillowcase Home Decor
$2.45-7.93
Mix MOQ : 2
Cartoon Ocean World Toilet Lid Sticker Waterproof PVC Marine Life Fish Pattern Bathroom Decal For Home Decor
Cartoon Ocean World Toilet Lid Sticker Waterproof PVC Marine Life Fish Pattern Bathroom Decal For Home Decor
like
Find Similar
Cartoon ocean world wall stickers with colorful tropical fish and sea plants for home decor - M-32 Style / 29x36cm
Cartoon ocean world toilet lid stickers with colorful fish octopus and seaweed bathroom decor - M-33 Style / 29x36cm
Cartoon ocean world toilet stickers with colorful fish, seahorse, and sea plants decor - M-34 Style / 29x36cm
Cartoon Ocean World Toilet Lid Sticker Waterproof PVC Marine Life Fish Pattern Bathroom Decal For Home Decor
$1.01
No MOQ
Romantic Watercolor Sunflower House Toilet Lid Sticker Removable PVC Autumn Leaves Wall Decal For Bathroom Home Decoration
Romantic Watercolor Sunflower House Toilet Lid Sticker Removable PVC Autumn Leaves Wall Decal For Bathroom Home Decoration
like
Find Similar
Detail of sunflower house wall sticker showing product size of 29cm by 29cm - Watercolor House And Autumn Plants (HY-M132)
Detailed size chart showing 29x29cm dimensions for autumn sunflower house wall stickers - Autumn Rural Style House (HY-M133)
Detailed dimension layout for romantic sunflower house wall sticker sized 29x29cm - Warm Small House And Fallen Leaves (HY-M134)
Detail view of sunflower house wall sticker with 29cm dimensions and HY-M135 model number - Wooden Texture House And Sunflowers (HY-M135)
Romantic Watercolor Sunflower House Toilet Lid Sticker Removable PVC Autumn Leaves Wall Decal For Bathroom Home Decoration
$0.86
No MOQ
Watercolor Blue Flower Toilet Lid Decal Sticker Waterproof Removable PVC Bathroom Wall Art Decor For Home Bathroom Accessory
Watercolor Blue Flower Toilet Lid Decal Sticker Waterproof Removable PVC Bathroom Wall Art Decor For Home Bathroom Accessory
like
Find Similar
Translucent blue watercolor floral wall decal on white toilet lid, 27x27.5 cm size - Watercolor Blue Floral Style
Watercolor Blue Flower Toilet Lid Decal Sticker Waterproof Removable PVC Bathroom Wall Art Decor For Home Bathroom Accessory
$0.86
No MOQ
Watercolor Flower Butterfly Toilet Sticker Waterproof PVC Bathroom Cistern Decal Removable Floral Wall Sticker For Toilet Lid Decor
Watercolor Flower Butterfly Toilet Sticker Waterproof PVC Bathroom Cistern Decal Removable Floral Wall Sticker For Toilet Lid Decor
like
Find Similar
Floral toilet wall stickers featuring sunflowers, butterflies, and dragonflies - Flower Butterfly Dragonfly Mixed Style (MS588-YW) / 25x30cm
Detail view of floral and butterfly wall stickers with precise size measurements - Purple Rose Butterfly Style (MS503-YW) / 30x20cm
Watercolor Flower Butterfly Toilet Sticker Waterproof PVC Bathroom Cistern Decal Removable Floral Wall Sticker For Toilet Lid Decor
$0.86-0.95
Mix MOQ : 2
Ramadan Moon Star Lantern Pattern Gold Print Dark Blue Throw Pillow Case Ethnic Style Sofa Decorative Cushion Cover
Ramadan Moon Star Lantern Pattern Gold Print Dark Blue Throw Pillow Case Ethnic Style Sofa Decorative Cushion Cover
like
Find Similar
Navy blue square pillowcase featuring gold crescent moon and stars with ornate corner patterns - Star Moon with Border (CDR426-1) / 45*45cm Short Plush Single Sided Without Core
Navy blue Ramadan cushion cover with golden moon, stars and hanging lanterns design - Multiple Lanterns with Star Moon (CDR426-2) / 45*45cm Short Plush Single Sided Without Core
Navy blue Ramadan pillow cover with gold crescent moon and festive hanging lanterns - Hanging Lanterns with Floral Border (CDR426-3) / 45*45cm Short Plush Single Sided Without Core
Golden moon and star Ramadan decorative pillow case with Islamic lantern design in deep blue - Single Large Lantern with Moon (CDR426-4) / 45*45cm Short Plush Single Sided Without Core
NewRamadan Moon Star Lantern Pattern Gold Print Dark Blue Throw Pillow Case Ethnic Style Sofa Decorative Cushion Cover
$1.30
Mix MOQ : 2
Modern Soft Plush Jacquard Cushion Cover Quilted Pattern Square Pillowcase With Sherpa Backing For Sofa Bed Home Decor
Modern Soft Plush Jacquard Cushion Cover Quilted Pattern Square Pillowcase With Sherpa Backing For Sofa Bed Home Decor
like
Find Similar
Plush light purple pillow with 3D rhombus texture on a vintage leather chair - Purple / 45*45mm
+5
Modern Soft Plush Jacquard Cushion Cover Quilted Pattern Square Pillowcase With Sherpa Backing For Sofa Bed Home Decor
$1.87-4.03
Mix MOQ : 2
Modern Minimalist Red Abstract Geometric Pillowcase Polyester Peach Skin Sofa Decorative Throw Pillow Cover For Home Decor
Modern Minimalist Red Abstract Geometric Pillowcase Polyester Peach Skin Sofa Decorative Throw Pillow Cover For Home Decor
like
Find Similar
Modern minimalist red abstract geometric pillow cover with bold art lines for home sofa decor - 18x18 Inch / Abstract Color Block (DRD166-1)
Macro shot of red abstract geometric concentric circles on modern decorative pillow case - 18x18 Inch / Concentric Circles Geometric (DRD166-2)
Close-up of modern red geometric pattern on high-quality fabric cushion cover - 18x18 Inch / Mid-century Modern Circles (DRD166-3)
Detailed view of modern red and black geometric abstract pattern on square cushion cover - 18x18 Inch / Red Black White Abstract (DRD166-4)
+5
Modern Minimalist Red Abstract Geometric Pillowcase Polyester Peach Skin Sofa Decorative Throw Pillow Cover For Home Decor
-4%
$1.18
Mix MOQ : 2
Ballet Dancing Girl Decorative Pillowcase Polyester Square Cushion Cover For Sofa Couch Home Bedroom Living Room Decor
Ballet Dancing Girl Decorative Pillowcase Polyester Square Cushion Cover For Sofa Couch Home Bedroom Living Room Decor
like
Find Similar
Detail of ballerina girl pillowcase with golden Dance with Love lettering and floral decor - Dance With Love (DRD184-1)
Square ballet girl throw pillow cover in white with I love Ballet print and gold details - Crown Ballet Girl (DRD184-2)
Square white pillowcase featuring pink ballet shoes and cat print with I Heart Ballet text - Ballet Shoes and Cat (DRD184-3)
Detail of ballerina girl illustration printed on white square cushion cover fabric - Pink Hair Dancer (DRD184-4)
+5
Ballet Dancing Girl Decorative Pillowcase Polyester Square Cushion Cover For Sofa Couch Home Bedroom Living Room Decor
-5%
$1.23
Mix MOQ : 2
Creative Black PVC Bathroom Wall Sticker Letter B Bathroom Symbol Waterproof Self Adhesive Minimalist Home Wall Decoration Decal
Creative Black PVC Bathroom Wall Sticker Letter B Bathroom Symbol Waterproof Self Adhesive Minimalist Home Wall Decoration Decal
like
Find Similar
1 option
Creative Black PVC Bathroom Wall Sticker Letter B Bathroom Symbol Waterproof Self Adhesive Minimalist Home Wall Decoration Decal
$0.81
No MOQ
Tropical Green Plant Polyester Cushion Cover Geometric Leaf Print Throw Pillowcase Decorative For Home Sofa Living Room
Tropical Green Plant Polyester Cushion Cover Geometric Leaf Print Throw Pillowcase Decorative For Home Sofa Living Room
like
Find Similar
Square dark green cushion cover with white geometric diamond pattern on white background - 45*45cm (No Insert) / Dark Green White Grid Style (CRD64-1)
Sage green geometric square cushion cover with white diamond pattern in linen texture - 45*45cm (No Insert) / Sage Green Geometric Rhombus Style (CRD64-2)
Tropical green leaves printed square throw pillow cover made of canvas for sofa decor - 45*45cm (No Insert) / Tropical Palm Banana Leaf Style (CRD64-3)
Green geometric plant pattern pillowcase on white background for sofa decor - 45*45cm (No Insert) / Bean Green Botanical Floral Style (CRD64-4)
+5
Tropical Green Plant Polyester Cushion Cover Geometric Leaf Print Throw Pillowcase Decorative For Home Sofa Living Room
$1.38
Mix MOQ : 2
Modern Minimalist Super Soft Short Plush Square Throw Pillow Case Solid White Decorative Cushion Cover For Bedroom Sofa
Modern Minimalist Super Soft Short Plush Square Throw Pillow Case Solid White Decorative Cushion Cover For Bedroom Sofa
like
Find Similar
2 options
Modern Minimalist Super Soft Short Plush Square Throw Pillow Case Solid White Decorative Cushion Cover For Bedroom Sofa
$1.21-4.58
Mix MOQ : 2
Sunflower Pattern Linen Pillowcase Set Modern Simple Yellow Bee Print Square Cushion Cover For Home Sofa Decor Throw Pillow Case
Sunflower Pattern Linen Pillowcase Set Modern Simple Yellow Bee Print Square Cushion Cover For Home Sofa Decor Throw Pillow Case
like
Find Similar
Square sunflower throw pillow cover with bee and Home Sweet Home print on beige fabric - Sunflower and Bee (DYM23-1) / 45x45cm Single Side No Core
Minimalist square linen sunflower pillow cover with Sunshine text for sofa decor - Watercolor Sunflower and Sunshine (DYM23-2) / 45x45cm Single Side No Core
Mustard yellow linen throw pillow cover with HAPPY summer print and heart design - Ginger Yellow HAPPY summer (DYM23-3) / 45x45cm Single Side No Core
Yellow sunflower decorative pillow cover with Hello Sunshine lettering in cotton linen texture - Mustard Yellow HELLO sunshine (DYM23-4) / 45x45cm Single Side No Core
Sunflower Pattern Linen Pillowcase Set Modern Simple Yellow Bee Print Square Cushion Cover For Home Sofa Decor Throw Pillow Case
$1.30
Mix MOQ : 2
Nordic Style Daisy Floral Print Peach Skin Cushion Cover Artistic Abstract Flower Sofa Throw Pillow Case Home Decor
Nordic Style Daisy Floral Print Peach Skin Cushion Cover Artistic Abstract Flower Sofa Throw Pillow Case Home Decor
like
Find Similar
Detail of light blue peach skin fabric texture with daisy flower bouquet illustration - 45*45cm (No Insert) / Light Blue White Daisy in Vase (DRD445-1)
Detailed view of Nordic daisy floral print peach skin pillowcase with abstract geometric pattern - 45*45cm (No Insert) / Simple Abstract Geometric Blocks (DRD445-2)
Mustard yellow Nordic cushion cover featuring a grey abstract leaf print in peach skin - 45*45cm (No Insert) / Mustard Yellow Gray Abstract Leaf (DRD445-3)
Nordic peach skin pillowcase featuring golden Matisse style abstract floral print - 45*45cm (No Insert) / Artistic Streamline Abstract Leaf (DRD445-4)
+13
Nordic Style Daisy Floral Print Peach Skin Cushion Cover Artistic Abstract Flower Sofa Throw Pillow Case Home Decor
$1.27
Mix MOQ : 2
Blue Butterfly Floral Bathroom Toilet Sticker Waterproof PVC Self Adhesive Watercolor Flower Wall Decal Home Restroom Decor
Blue Butterfly Floral Bathroom Toilet Sticker Waterproof PVC Self Adhesive Watercolor Flower Wall Decal Home Restroom Decor
like
Find Similar
Blue butterfly and floral bathroom wall sticker showing 24x24cm sheet and display size - 24*24cm / Blue Butterfly Floral (HY-M518)
Blue Butterfly Floral Bathroom Toilet Sticker Waterproof PVC Self Adhesive Watercolor Flower Wall Decal Home Restroom Decor
$0.58
No MOQ
Pink Cherry Blossom Butterfly Bathroom Toilet Wall Sticker PVC Waterproof Self Adhesive Elegant Home Decor Art Decal
Pink Cherry Blossom Butterfly Bathroom Toilet Wall Sticker PVC Waterproof Self Adhesive Elegant Home Decor Art Decal
like
Find Similar
Detail of pink 3D flower and butterfly wall stickers with 20x29cm size dimensions - Cherry Blossom Butterfly Style (M-311)
Pink Cherry Blossom Butterfly Bathroom Toilet Wall Sticker PVC Waterproof Self Adhesive Elegant Home Decor Art Decal
$0.58
No MOQ
Modern Minimalist Polyester Peach Skin Cushion Cover Pink Lemonade Theme Fruit Geometric Print Square Decorative Pillowcase For Sofa Living Room Home Decor
Modern Minimalist Polyester Peach Skin Cushion Cover Pink Lemonade Theme Fruit Geometric Print Square Decorative Pillowcase For Sofa Living Room Home Decor
like
Find Similar
Modern square pillow case with pink and white geometric overlapping circle patterns - Pink Base White Geometric Ring Style (DRD99-1)
Square pillow cover with decorative yellow polka dot pattern on a white base - White Base Yellow Polka Dot Style (DRD99-2)
Pink square cushion cover with yellow lemon slice patterns for home sofa decor - Pink Base Lemon Slice Style (DRD99-3)
Pink square pillowcase with white polka dots for modern sofa home decoration - Pink Base White Polka Dot Style (DRD99-4)
+9
Modern Minimalist Polyester Peach Skin Cushion Cover Pink Lemonade Theme Fruit Geometric Print Square Decorative Pillowcase For Sofa Living Room Home Decor
$1.21
Mix MOQ : 2
Tropical Flowers Leaves Toilet Sticker Waterproof PVC Monstera Hibiscus Pattern Bathroom Wall Decal Self Adhesive Home Decor
Tropical Flowers Leaves Toilet Sticker Waterproof PVC Monstera Hibiscus Pattern Bathroom Wall Decal Self Adhesive Home Decor
like
Find Similar
Detail of tropical monstera leaves and pink hibiscus flower self-adhesive wall sticker - Tropical Plant Style (M-237)
Tropical Flowers Leaves Toilet Sticker Waterproof PVC Monstera Hibiscus Pattern Bathroom Wall Decal Self Adhesive Home Decor
$0.58
No MOQ
Bird Peach Blossom Branch Toilet Sticker PVC Waterproof Bathroom Wall Decal Floral Removable Home Decor Art
Bird Peach Blossom Branch Toilet Sticker PVC Waterproof Bathroom Wall Decal Floral Removable Home Decor Art
like
Find Similar
Detailed size specifications for peach blossom branch and bird wall sticker 27x29cm - 27*29CM/fun-m62
Bird Peach Blossom Branch Toilet Sticker PVC Waterproof Bathroom Wall Decal Floral Removable Home Decor Art
$0.72
No MOQ
Happy Mother's Day Floral Wreath Throw Pillow Cover Soft Velvet Decorative Pillowcase For Sofa Home Decor Gift For Mom
Happy Mother's Day Floral Wreath Throw Pillow Cover Soft Velvet Decorative Pillowcase For Sofa Home Decor Gift For Mom
like
Find Similar
Macro detail of Mother's Day pillowcase with carnation wreath and calligraphy print - 45x45cm / Carnation Wreath (CDR288-1)
Close-up of Mother's Day pillowcase with yellow floral heart wreath and black typography - 45x45cm / Narcissus Wreath (CDR288-2)
Floral heart wreath Mother's Day pillowcase with Happy Mother's Day text on white fabric - 45x45cm / Dahlia Wreath (CDR288-3)
White cushion cover with floral heart wreath and HAPPY Mother's DAY greeting - 45x45cm / Forget-Me-Not Wreath (CDR288-4)
+14
Happy Mother's Day Floral Wreath Throw Pillow Cover Soft Velvet Decorative Pillowcase For Sofa Home Decor Gift For Mom
$1.21
Mix MOQ : 2
Watercolor Pink Flower Green Leaf Toilet Lid Sticker Waterproof PVC Bathroom Wall Decal Self Adhesive Home Decor
Watercolor Pink Flower Green Leaf Toilet Lid Sticker Waterproof PVC Bathroom Wall Decal Self Adhesive Home Decor
like
Find Similar
Detail of 29x29cm watercolor pink flower and green leaf sticker for bathroom decoration - Watercolor Pink Floral (fun-m46)
Watercolor Pink Flower Green Leaf Toilet Lid Sticker Waterproof PVC Bathroom Wall Decal Self Adhesive Home Decor
$0.72
No MOQ
Bathroom Wall Sticker Wash Away Your Troubles With Some Bubbles Quote PVC Waterproof Vinyl Decal For Home Decor
Bathroom Wall Sticker Wash Away Your Troubles With Some Bubbles Quote PVC Waterproof Vinyl Decal For Home Decor
like
Find Similar
1 option
Bathroom Wall Sticker Wash Away Your Troubles With Some Bubbles Quote PVC Waterproof Vinyl Decal For Home Decor
$1.15
No MOQ
Nordic Autumn Leaves Birds Pattern Linen Cushion Covers Nordic Style Decorative Square Pillowcase For Sofa Living Room Home Decor
Nordic Autumn Leaves Birds Pattern Linen Cushion Covers Nordic Style Decorative Square Pillowcase For Sofa Living Room Home Decor
like
Find Similar
Nordic autumn throw pillow cover featuring fall leaves and branches on linen fabric - Autumn Withered Leaves Pattern (TQYM67-1)
Nordic fall cushion cover with vibrant autumn leaves and berries on white background - Maple Leaves Pattern (TQYM67-2)
Detailed macro view showing the natural linen fabric texture and songbird print pattern - Birds Pattern (TQYM67-3)
Nordic Christmas throw pillow cover with birds, poinsettia, and pinecones on white - Christmas Cardinal Pattern (TQYM67-4)
+3
Nordic Autumn Leaves Birds Pattern Linen Cushion Covers Nordic Style Decorative Square Pillowcase For Sofa Living Room Home Decor
$1.30
Mix MOQ : 2
Nautical Theme Linen Pillowcase Navy Blue Beige Compass Lighthouse Anchor Sailboat Print Cushion Cover Home Decor
Nautical Theme Linen Pillowcase Navy Blue Beige Compass Lighthouse Anchor Sailboat Print Cushion Cover Home Decor
like
Find Similar
Navy blue nautical linen pillow cover with white compass pattern for home sofa decor - 18x18 Inch / Compass Pattern (DYM227-1)
Elegant nautical linen pillowcase with lighthouse print in navy blue for sofa decor - 18x18 Inch / Lighthouse Pattern (DYM227-2)
Navy blue anchor printed linen throw pillow cover with nautical ropes and stripes - 18x18 Inch / Anchor Pattern (DYM227-3)
Linen square pillowcase featuring a white sailing ship print in navy blue nautical style - 18x18 Inch / Sailing Boat Pattern (DYM227-4)
NewNautical Theme Linen Pillowcase Navy Blue Beige Compass Lighthouse Anchor Sailboat Print Cushion Cover Home Decor
$1.21
Mix MOQ : 2
Bathroom Lettering Wall Sticker Vertical Door Decal Waterproof PVC Vinyl Art Decor For Toilet Bathroom Door Minimalist Leaf Decoration Black
Bathroom Lettering Wall Sticker Vertical Door Decal Waterproof PVC Vinyl Art Decor For Toilet Bathroom Door Minimalist Leaf Decoration Black
like
Find Similar
Self-adhesive PVC bathroom wall sticker with floral design and layout dimensions - Layout Specification (10Y23-A33) / Black
Bathroom Lettering Wall Sticker Vertical Door Decal Waterproof PVC Vinyl Art Decor For Toilet Bathroom Door Minimalist Leaf Decoration Black
$0.69
Mix MOQ : 8
Nautical Ocean Style Marine Life Seahorse Starfish Coral Print Linen Throw Pillowcase Decorative Cushion Cover For Sofa Couch Home Decor
Nautical Ocean Style Marine Life Seahorse Starfish Coral Print Linen Throw Pillowcase Decorative Cushion Cover For Sofa Couch Home Decor
like
Find Similar
Detail view of linen pillow cover showing a vintage hand-painted green nautilus shell - Nautilus Pattern Style (YMD13-1)
Linen square pillow cover featuring a detailed dark green sea fan coral print design - Dark Green Sea Fan Style (YMD13-2)
Detail of vintage hand-painted seahorse linen pillow cover with retro sea life print - Sea Horse Pattern Style (YMD13-3)
Linen cushion cover featuring hand-painted turquoise coral print on beige fabric - Teal Branch Coral Style (YMD13-4)
+2
Nautical Ocean Style Marine Life Seahorse Starfish Coral Print Linen Throw Pillowcase Decorative Cushion Cover For Sofa Couch Home Decor
-5%
$1.31
Mix MOQ : 2
Long PVC Bathtub Mat Non-Slip Bathroom Shower Rug With Suction Cups And Drainage Holes Massage Foot Pad Odorless
Long PVC Bathtub Mat Non-Slip Bathroom Shower Rug With Suction Cups And Drainage Holes Massage Foot Pad Odorless
like
Find Similar
Non-slip white PVC bathtub mat with suction cups and massage texture for bathroom safety - 40*100CM / White
Gray rectangular non-slip PVC bathtub mat with drainage holes and suction cups - 40*100CM / Gray
Long PVC Bathtub Mat Non-Slip Bathroom Shower Rug With Suction Cups And Drainage Holes Massage Foot Pad Odorless
$5.42
Mix MOQ : 2
Purple Wisteria Flower Toilet Decoration Stickers Waterproof PVC Self-Adhesive Wall Decals For Bathroom Home Decor Removable Flower Stickers
Purple Wisteria Flower Toilet Decoration Stickers Waterproof PVC Self-Adhesive Wall Decals For Bathroom Home Decor Removable Flower Stickers
like
Find Similar
Waterproof wisteria flower wall sticker set showing both layout and finished size dimensions - KSC113A 30x30cm
Detailed size chart for purple wisteria flower wall stickers showing sheet and layout dimensions - KSC113B 25x30cm
Purple wisteria flower self-adhesive waterproof wall stickers with layout dimensions - KSC113C 25x30cm
Detail of purple wisteria wall decals showing dimensions 28x28cm for bathroom decor - KSC113D 30x30cm
Purple Wisteria Flower Toilet Decoration Stickers Waterproof PVC Self-Adhesive Wall Decals For Bathroom Home Decor Removable Flower Stickers
-4%
$0.69
No MOQ
Tropical Jungle Tiger Printed Pillow Case Polyester American Minimalist Leaf Geometric Decorative Cushion Cover For Sofa Bed
Tropical Jungle Tiger Printed Pillow Case Polyester American Minimalist Leaf Geometric Decorative Cushion Cover For Sofa Bed
like
Find Similar
Modern black and white tiger print throw pillow cover in soft peach skin fabric - Black And White Zebra Print (DRD402-1)
Modern emerald cushion cover with elegant white lilies and hummingbirds print - Dark Green Hummingbird Lily (DRD402-2)
Tropical tiger and palm leaf pattern square cushion cover for home sofa decor - Tropical Tiger with Greenery (DRD402-3)
Tropical jungle tiger print square pillowcase featuring green leaves and wild animal motif - Tiger with Cub (DRD402-4)
+7
Tropical Jungle Tiger Printed Pillow Case Polyester American Minimalist Leaf Geometric Decorative Cushion Cover For Sofa Bed
-5%
$1.20
Mix MOQ : 2
Artistic Linen Cat Tree Silhouette Throw Pillow Case Square Decorative Cushion Cover For Sofa Living Room Home Decor
Artistic Linen Cat Tree Silhouette Throw Pillow Case Square Decorative Cushion Cover For Sofa Living Room Home Decor
like
Find Similar
Artistic cat and tree silhouette linen pillowcase on a grey sofa for home decor - 45x45cm / Yellow Orange Artistic Cat (1)
Artistic watercolor cat silhouette pillow cover displayed on a gray fabric sofa - 45x45cm / Artistic Collage Black Cat (2)
Detailed texture of linen pillow cover featuring cat silhouette and watercolor graffiti art - 45x45cm / Pink Blue Contrast Street Cat (3)
Detailed close-up of a linen cushion with artistic cat and bird silhouette on a grey sofa - 45x45cm / Blue Orange Graffiti Silhouette Cat (4)
+11
Artistic Linen Cat Tree Silhouette Throw Pillow Case Square Decorative Cushion Cover For Sofa Living Room Home Decor
$1.24
No MOQ
Creative Cartoon Cat Pattern Thickened Flocking Bath Mat Non-Slip Water Absorbent Entrance Door Mat Soft Polyester Carpet
Creative Cartoon Cat Pattern Thickened Flocking Bath Mat Non-Slip Water Absorbent Entrance Door Mat Soft Polyester Carpet
like
Find Similar
Plush cat silhouette bathroom mat with soft white flocking and black feline patterns - 50×80CM / Cat Assembly
Creative Cartoon Cat Pattern Thickened Flocking Bath Mat Non-Slip Water Absorbent Entrance Door Mat Soft Polyester Carpet
$9.22
No MOQ
Go to

More in home & kitchen

Explore more in bedding & bathroom

homecolorholdertravelstylepolyesterdoubleheaddesignheart
hangingplasticstorageshapecleaningsimplekidslayerwhitedaily

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access