Everful

Wholesale bedding & bathroom

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Bedding & Bathroom

Find the perfect pieces: wall stickers, window stickers, kitchen stickers and more

All products in bedding & bathroom

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Modern Creative White Dove Bird on Blooming Tree Branch Wall Sticker Waterproof PVC Self Adhesive Decor For Living Room Bedroom
Modern Creative White Dove Bird on Blooming Tree Branch Wall Sticker Waterproof PVC Self Adhesive Decor For Living Room Bedroom
like
Find Similar
Creative wall sticker featuring a white pigeon on blooming branches for home decor - White Dove Branch Pattern (PH_QTB181)
Modern Creative White Dove Bird on Blooming Tree Branch Wall Sticker Waterproof PVC Self Adhesive Decor For Living Room Bedroom
$0.78
No MOQ
Colorful Flower Butterfly Static Cling Window Sticker PVC Waterproof Removable Glass Decal For Home Kitchen Bedroom Decor
Colorful Flower Butterfly Static Cling Window Sticker PVC Waterproof Removable Glass Decal For Home Kitchen Bedroom Decor
like
Find Similar
Floral butterfly glass window decals with colorful wildflowers for home decoration - Colorful Floral Butterfly (JDT-A147)
Colorful Flower Butterfly Static Cling Window Sticker PVC Waterproof Removable Glass Decal For Home Kitchen Bedroom Decor
$1.38
No MOQ
Colorful Floral Static Window Film Watercolor Petunia Flower Glass Sticker Removable Double Sided Visible PVC Window Decal For Home Decor
Colorful Floral Static Window Film Watercolor Petunia Flower Glass Sticker Removable Double Sided Visible PVC Window Decal For Home Decor
like
Find Similar
Colorful watercolor floral static window film stickers for decorative glass surface - Petunia Floral (JDT-A138)
Colorful Floral Static Window Film Watercolor Petunia Flower Glass Sticker Removable Double Sided Visible PVC Window Decal For Home Decor
$0.75
No MOQ
Watercolor Flower Green Plant Static Cling Window Sticker Removable PVC Decorative Decal For Bedroom Living Room Glass Window
Watercolor Flower Green Plant Static Cling Window Sticker Removable PVC Decorative Decal For Bedroom Living Room Glass Window
like
Find Similar
Vibrant watercolor floral static window film stickers for home glass decoration - Multicolor Green Plants Flowers (JDT-A95)
Watercolor Flower Green Plant Static Cling Window Sticker Removable PVC Decorative Decal For Bedroom Living Room Glass Window
$0.81
No MOQ
Summer Tropical Flamingo Window Stickers Static PVC Glass Decals Pineapple Watermelon Leaves Decorative Window Clings For Glass Door Home Store
Summer Tropical Flamingo Window Stickers Static PVC Glass Decals Pineapple Watermelon Leaves Decorative Window Clings For Glass Door Home Store
like
Find Similar
Summer theme static window stickers featuring flamingos and pineapples on a glass window - Tropical Summer Theme (JDT-A90)
Summer Tropical Flamingo Window Stickers Static PVC Glass Decals Pineapple Watermelon Leaves Decorative Window Clings For Glass Door Home Store
$1.61
No MOQ
Orange Camellia And Pink Rose Static Window Sticker Removable PVC Floral Glass Decal For Kitchen Living Room Home Decor
Orange Camellia And Pink Rose Static Window Sticker Removable PVC Floral Glass Decal For Kitchen Living Room Home Decor
like
Find Similar
Orange camellia and pink rose electrostatic window stickers for home wall decoration - Rose and Camellia (JDT-A85)
NewOrange Camellia And Pink Rose Static Window Sticker Removable PVC Floral Glass Decal For Kitchen Living Room Home Decor
$0.86
No MOQ
Artistic Tulip Floral Pattern Window Film Static Cling Removable Glass Sticker Waterproof Decorative Film For Bedroom Kitchen
Artistic Tulip Floral Pattern Window Film Static Cling Removable Glass Sticker Waterproof Decorative Film For Bedroom Kitchen
like
Find Similar
Stained glass tulip flower window privacy film for kitchen and bedroom decoration - Tulip Floral Style (JDT-A89)
Artistic Tulip Floral Pattern Window Film Static Cling Removable Glass Sticker Waterproof Decorative Film For Bedroom Kitchen
$0.72
No MOQ
Christmas Cartoon Static Window Stickers PVC Glass Decals Holiday Decoration Removable Santa Snowman Gnomes
Christmas Cartoon Static Window Stickers PVC Glass Decals Holiday Decoration Removable Santa Snowman Gnomes
like
Find Similar
Christmas window stickers with festive gnomes, snowflakes and Santa on a warm cozy background - Christmas Gnomes Style (JDT-X69)
Static Christmas window clings featuring Santa, snowman and reindeer designs - Santa and Reindeer Style (JDT-X72)
Christmas Cartoon Static Window Stickers PVC Glass Decals Holiday Decoration Removable Santa Snowman Gnomes
-4%
$1.56
No MOQ
Rainbow Window Cling Suncatcher Sticker Static Decal Non Adhesive Prism Film Moon Cat Hourglass Snake Design Home Decor
Rainbow Window Cling Suncatcher Sticker Static Decal Non Adhesive Prism Film Moon Cat Hourglass Snake Design Home Decor
like
Find Similar
Holographic moon cat window film size guide showing dimensions and rainbow light effects - Hourglass Cat Style (JTD_C38)
NewRainbow Window Cling Suncatcher Sticker Static Decal Non Adhesive Prism Film Moon Cat Hourglass Snake Design Home Decor
$1.82
No MOQ
Halloween Decoration Wall Stickers Cartoon Black Cat In Pumpkin And Bats PVC Waterproof Festive Party Home Decor Decals
Halloween Decoration Wall Stickers Cartoon Black Cat In Pumpkin And Bats PVC Waterproof Festive Party Home Decor Decals
like
Find Similar
Detail of Halloween wall sticker showing product receive size and finished cat pumpkin layout - Pumpkin Cat
Halloween Decoration Wall Stickers Cartoon Black Cat In Pumpkin And Bats PVC Waterproof Festive Party Home Decor Decals
-12%
$0.86
No MOQ
Rainbow Suncatcher Bird Window Cling Static PVC Anti-Collision Window Decal For Home Bedroom Glass Decor Modern Minimalist
Rainbow Suncatcher Bird Window Cling Static PVC Anti-Collision Window Decal For Home Bedroom Glass Decor Modern Minimalist
like
Find Similar
Detailed size guide for bird window decals showing layout and finished dimensions - Bird Pattern (JTD_C35)
Rainbow Suncatcher Bird Window Cling Static PVC Anti-Collision Window Decal For Home Bedroom Glass Decor Modern Minimalist
$1.82
No MOQ
Luminous Rabbit Balloon Wall Sticker Glow In The Dark Cartoon Moon Stars PVC Self Adhesive Decal For Kids Room Home Decor
Luminous Rabbit Balloon Wall Sticker Glow In The Dark Cartoon Moon Stars PVC Self Adhesive Decal For Kids Room Home Decor
like
Find Similar
Detailed dimensions of bunny balloon wall stickers showing layout and finish size - Balloon Rabbit (YG_A247)
Luminous Rabbit Balloon Wall Sticker Glow In The Dark Cartoon Moon Stars PVC Self Adhesive Decal For Kids Room Home Decor
-11%
$2.34
No MOQ
Happy Easter Wall Stickers PVC Waterproof Removable Fridge Toilet Door Decals Home Decoration Bunny Egg Holiday Decor
Happy Easter Wall Stickers PVC Waterproof Removable Fridge Toilet Door Decals Home Decoration Bunny Egg Holiday Decor
like
Find Similar
Detail showing Easter wall decal dimensions with rabbit ears and Happy Easter wreath - Fridge Sticker Style 1 (PH_QTA626)
Easter wall decal dimensions showing Happy Easter bunny ears and colorful eggs - Toilet Sticker Style 2 (PH_QTA627)
Detail showing the dimensions and layout of the Happy Easter wall decals set - Door Sticker Style 3 (PH_QTA628)
Easter wall decal dimensions showing Happy Easter eggs design and finished paste size - Wall Sticker Style 4 (PH_QTA629)
Happy Easter Wall Stickers PVC Waterproof Removable Fridge Toilet Door Decals Home Decoration Bunny Egg Holiday Decor
-12%
$0.95-1.30
No MOQ
3D Beach Sunset Window View Wall Sticker PVC Waterproof Broken Wall Effect Ocean Palm Tree Removable Decorative Home Decal
3D Beach Sunset Window View Wall Sticker PVC Waterproof Broken Wall Effect Ocean Palm Tree Removable Decorative Home Decal
like
Find Similar
Detail showing tropical sunset beach 3D wall sticker with received and finished sizes - Window Beach (PH_QTA655)
3D Beach Sunset Window View Wall Sticker PVC Waterproof Broken Wall Effect Ocean Palm Tree Removable Decorative Home Decal
$2.02
No MOQ
Tulip Flower And Butterfly Window Stickers PVC Decorative Wall Decals For Home Living Room Bedroom Kitchen Glass Decoration
Tulip Flower And Butterfly Window Stickers PVC Decorative Wall Decals For Home Living Room Bedroom Kitchen Glass Decoration
like
Find Similar
Floral butterfly wall stickers showing product receive size and finished layout dimensions - Tulip Butterfly Pattern (PH-QT9647)
NewTulip Flower And Butterfly Window Stickers PVC Decorative Wall Decals For Home Living Room Bedroom Kitchen Glass Decoration
-11%
$0.69
No MOQ
Halloween Wreath Wall Sticker PVC Watercolor Pumpkin Floral Happy Halloween Window Decal For Home Bedroom Living Room Decor
Halloween Wreath Wall Sticker PVC Watercolor Pumpkin Floral Happy Halloween Window Decal For Home Bedroom Living Room Decor
like
Find Similar
Halloween wall sticker wreath with pumpkin and red poppy on white background for decor - Ph-qt9168 Halloween Door Sticker
Halloween Wreath Wall Sticker PVC Watercolor Pumpkin Floral Happy Halloween Window Decal For Home Bedroom Living Room Decor
$1.07
No MOQ
Cartoon Ocean Life Luminous Wall Stickers Glow In The Dark PVC Waterproof Sea Animal Decals For Kids Nursery Home Decor
Cartoon Ocean Life Luminous Wall Stickers Glow In The Dark PVC Waterproof Sea Animal Decals For Kids Nursery Home Decor
like
Find Similar
Luminous ocean creature wall stickers set featuring tropical fish and seahorse patterns - Yg337
Cartoon Ocean Life Luminous Wall Stickers Glow In The Dark PVC Waterproof Sea Animal Decals For Kids Nursery Home Decor
-5%
$2.46
No MOQ
Watercolor Seahorse Wall Stickers For Kids Nursery Living Room Artistic Marine Life PVC Decals Removable Waterproof Home Wall Decoration
Watercolor Seahorse Wall Stickers For Kids Nursery Living Room Artistic Marine Life PVC Decals Removable Waterproof Home Wall Decoration
like
Find Similar
Colorful watercolor seahorse wall stickers set with vibrant blue and orange gradient tones - Watercolor Seahorse Style (PH-QT2911)
Watercolor Seahorse Wall Stickers For Kids Nursery Living Room Artistic Marine Life PVC Decals Removable Waterproof Home Wall Decoration
$1.30
No MOQ
Halloween Moon Castle Pumpkin Bat Toilet Wall Sticker PVC Watercolor Ghost Castle Decal For Home Party Decoration
Halloween Moon Castle Pumpkin Bat Toilet Wall Sticker PVC Watercolor Ghost Castle Decal For Home Party Decoration
like
Find Similar
Halloween wall sticker set featuring purple castle, moon and pumpkins with dimensions - Halloween Moon Castle Style (PH-WS3104)
Halloween Moon Castle Pumpkin Bat Toilet Wall Sticker PVC Watercolor Ghost Castle Decal For Home Party Decoration
$0.92
No MOQ
Tropical Flamingo Wall Stickers Waterproof PVC Monstera Leaf Floral Decals For Living Room Bedroom Toilet Lid Home Decor
Tropical Flamingo Wall Stickers Waterproof PVC Monstera Leaf Floral Decals For Living Room Bedroom Toilet Lid Home Decor
like
Find Similar
Pink flamingo wall sticker with tropical palm leaves and yellow flowers in 29x29cm size - Flamingo Style
NewTropical Flamingo Wall Stickers Waterproof PVC Monstera Leaf Floral Decals For Living Room Bedroom Toilet Lid Home Decor
$1.10
No MOQ
Colored Stained Glass Window Privacy Film Static Cling Non Adhesive Frosted Geometric Decorative Translucent Film For Home Office
Colored Stained Glass Window Privacy Film Static Cling Non Adhesive Frosted Geometric Decorative Translucent Film For Home Office
like
Find Similar
Static 3D woven geometric window privacy film with textured translucent silver finish - Ice Rhombus / 45cm*1m (1 Roll)
Detail of static cling stained glass privacy film with textured stone pattern in a kitchen - Water Wave / 45cm*1m (1 Roll)
Detail showing grey mandala geometric pattern window film for privacy and office decoration - Mandala Flower / 45cm*1m (1 Roll)
Detail of static frosted glass film with geometric diamond pattern for office privacy - Grid / 45cm*1m (1 Roll)
+32
Colored Stained Glass Window Privacy Film Static Cling Non Adhesive Frosted Geometric Decorative Translucent Film For Home Office
$0.92-4.55
No MOQ
 · 
12 views
Cute Cartoon Cat Flower Wreath Wall Sticker PVC Waterproof Decorative Decal For Bedroom Living Room Window Glass Home Decor
Cute Cartoon Cat Flower Wreath Wall Sticker PVC Waterproof Decorative Decal For Bedroom Living Room Window Glass Home Decor
like
Find Similar
Cartoon kitten in floral wreath wall sticker displayed on a bright living room window - Cute Cat (PH-QT641)
Cute Cartoon Cat Flower Wreath Wall Sticker PVC Waterproof Decorative Decal For Bedroom Living Room Window Glass Home Decor
-12%
$0.91
No MOQ
3D Mirror Acrylic Love Letter Wall Sticker Self Adhesive Artistic Cursive Decal For Home Bedroom Living Room Modern Decor
3D Mirror Acrylic Love Letter Wall Sticker Self Adhesive Artistic Cursive Decal For Home Bedroom Living Room Modern Decor
like
Find Similar
Modern backlit LED round wall mirror with silver love lettering for home decor - Silver
Close-up of golden acrylic mirror wall sticker with cursive Love lettering for bedroom decor - Gold
Modern black Love slogan mirror sticker for bathroom wall decoration with glossy finish - Black
3D Mirror Acrylic Love Letter Wall Sticker Self Adhesive Artistic Cursive Decal For Home Bedroom Living Room Modern Decor
$1.30
No MOQ
Acrylic Mirror Cat Switch Sticker Decorative Wall Decal For Living Room Bedroom 3D Sleeping Kitten Zzz Pattern Home Decor
Acrylic Mirror Cat Switch Sticker Decorative Wall Decal For Living Room Bedroom 3D Sleeping Kitten Zzz Pattern Home Decor
like
Find Similar
3 options
Acrylic Mirror Cat Switch Sticker Decorative Wall Decal For Living Room Bedroom 3D Sleeping Kitten Zzz Pattern Home Decor
-5%
$1.04
No MOQ
Halloween Vampire Lips Acrylic Mirror Wall Stickers Tooth Design Reflective Mirror Decals For Bedroom Living Room Home Decor
Halloween Vampire Lips Acrylic Mirror Wall Stickers Tooth Design Reflective Mirror Decals For Bedroom Living Room Home Decor
like
Find Similar
Modern red lip-shaped acrylic mirror wall sticker for minimalist bedroom decoration - Red
Golden mirror acrylic vampire lip wall stickers for Halloween home and bedroom decoration - Gold
Black acrylic mirror vampire lip wall decal with fangs for Halloween home decoration - Black
Creative vampire lip acrylic mirror wall sticker for modern bedroom interior decor - Silver
Halloween Vampire Lips Acrylic Mirror Wall Stickers Tooth Design Reflective Mirror Decals For Bedroom Living Room Home Decor
-5%
$1.31
No MOQ
Acrylic Ocean Theme Mirror Wall Stickers 3D DIY Removable Fish Sea Star Seaweed Waterproof Mural Decals For Home Decor
Acrylic Ocean Theme Mirror Wall Stickers 3D DIY Removable Fish Sea Star Seaweed Waterproof Mural Decals For Home Decor
like
Find Similar
Modern ocean themed acrylic mirror wall stickers featuring fish and sea plants for bedrooms - Silver
Golden acrylic sea creature mirror wall decals including fish and shells for home decor - Gold
Modern black acrylic ocean theme mirror wall decals featuring fish and sea elements - Black
NewAcrylic Ocean Theme Mirror Wall Stickers 3D DIY Removable Fish Sea Star Seaweed Waterproof Mural Decals For Home Decor
$1.15
No MOQ
Hello Beautiful Acrylic Mirror Wall Sticker 3D Reflective Quote Decal For Bedroom Living Room Home Art Wall Decoration
Hello Beautiful Acrylic Mirror Wall Sticker 3D Reflective Quote Decal For Bedroom Living Room Home Art Wall Decoration
like
Find Similar
Modern silver 3D acrylic wall decal with Hello Beautiful script for bedroom decor - Silver
Modern black Hello Beautiful acrylic wall stickers with a round mirror over a sofa - Black
Golden Hello Beautiful 3D mirror wall decal with elegant script for bedroom decor - Gold
Hello Beautiful Acrylic Mirror Wall Sticker 3D Reflective Quote Decal For Bedroom Living Room Home Art Wall Decoration
$1.10
No MOQ
DIY Flying Butterfly Mirror Wall Stickers Acrylic 3D Geometric Square Decal For Living Room Bedroom Home Art Decoration
DIY Flying Butterfly Mirror Wall Stickers Acrylic 3D Geometric Square Decal For Living Room Bedroom Home Art Decoration
like
Find Similar
3D butterfly mirror wall stickers for modern living room home wall decor set - Silver
Golden butterfly and square mirror wall stickers set for modern living room decor - Gold
3D mirror butterfly wall stickers and square mirror decals for modern living room decor - Black
Detail view of red mirror butterfly wall stickers on a modern grey living room wall - Red
+1
DIY Flying Butterfly Mirror Wall Stickers Acrylic 3D Geometric Square Decal For Living Room Bedroom Home Art Decoration
-5%
$2.05
No MOQ
Creative Butterfly Mirror Wall Stickers Acrylic 3D Butterfly Wall Decal Self Adhesive Mirror Wall Art Decor For Home Office
Creative Butterfly Mirror Wall Stickers Acrylic 3D Butterfly Wall Decal Self Adhesive Mirror Wall Art Decor For Home Office
like
Find Similar
Silver butterfly acrylic mirror wall stickers set with a round center mirror for home decor - Silver
Golden acrylic mirror wall stickers featuring creative butterfly and circle patterns - Gold
Blue acrylic butterfly mirror wall stickers for modern living room decoration set - Blue
Creative mirror butterfly wall stickers with round acrylic decals for living room decor - Black
+1
NewCreative Butterfly Mirror Wall Stickers Acrylic 3D Butterfly Wall Decal Self Adhesive Mirror Wall Art Decor For Home Office
-4%
$2.52
No MOQ
3D Mirror Acrylic Cat Wall Sticker Heart Patterns DIY Self Adhesive Decorative Mirror Decal Home Bedroom Living Room
3D Mirror Acrylic Cat Wall Sticker Heart Patterns DIY Self Adhesive Decorative Mirror Decal Home Bedroom Living Room
like
Find Similar
Silver mirror acrylic wall stickers featuring two stylized cats and hearts for home decor - Silver
3D mirror black acrylic cat wall decals with heart stickers for bedroom wall decor - Black
Golden mirror cat and heart wall stickers for home decor with glossy metallic finish - Gold
Red acrylic mirror wall stickers with cartoon cats and heart elements for room decoration - Red
+1
3D Mirror Acrylic Cat Wall Sticker Heart Patterns DIY Self Adhesive Decorative Mirror Decal Home Bedroom Living Room
-4%
$1.37
No MOQ
Ocean World Sea Animal Mirror Wall Stickers 3D Acrylic Removable DIY Waterproof Shark Dolphin Turtle Fish Bubble Decals
Ocean World Sea Animal Mirror Wall Stickers 3D Acrylic Removable DIY Waterproof Shark Dolphin Turtle Fish Bubble Decals
like
Find Similar
Ocean world mirror wall stickers set with shark dolphin sea turtle for bathroom decor - Silver
Golden acrylic mirror wall stickers with ocean animal shapes for children's room decor - Gold
Red acrylic mirror wall stickers with ocean animal motifs for bathroom and kids room - Red
Blue acrylic ocean animal mirror wall stickers set with sharks and dolphins for bathroom - Blue
+1
Ocean World Sea Animal Mirror Wall Stickers 3D Acrylic Removable DIY Waterproof Shark Dolphin Turtle Fish Bubble Decals
-11%
$1.85
No MOQ
Modern Acrylic Mirror Wall Stickers Square Round Corner DIY Reflective Decals For Home Living Room Bedroom Decorative Wall Art
Modern Acrylic Mirror Wall Stickers Square Round Corner DIY Reflective Decals For Home Living Room Bedroom Decorative Wall Art
like
Find Similar
Five-piece square acrylic mirror wall stickers set for modern living room home decoration - Silver
Set of 5 square yellow acrylic mirror wall stickers for creative living room decoration - Gold
5-piece set of blue square acrylic mirror wall stickers for creative living room decor - Blue
Detail of red square acrylic mirror wall stickers showing clear reflection on living room wall - Red
+1
Modern Acrylic Mirror Wall Stickers Square Round Corner DIY Reflective Decals For Home Living Room Bedroom Decorative Wall Art
-12%
$0.91
No MOQ
3D Acrylic Mirror Reindeer Wall Sticker DIY Animal Silhouette Decal For Living Room Bedroom Home Decor Christmas Gift
3D Acrylic Mirror Reindeer Wall Sticker DIY Animal Silhouette Decal For Living Room Bedroom Home Decor Christmas Gift
like
Find Similar
Modern 3D mirror deer wall sticker decoration for home living room above a grey sofa - Silver
3D acrylic mirror wall sticker featuring a golden deer design for living room decor - Gold
3D red mirror acrylic deer wall sticker for creative modern home living room decor - Red
3D mirror wall sticker featuring a blue reindeer design for modern bedroom home decor - Blue
+1
3D Acrylic Mirror Reindeer Wall Sticker DIY Animal Silhouette Decal For Living Room Bedroom Home Decor Christmas Gift
-5%
$1.51
No MOQ
DIY 3D Cat Head Mirror Wall Stickers Acrylic Mirror Decorative Decal Removable Waterproof Mirror Sticker For Living Room Bedroom Kids Nursery Home Decor
DIY 3D Cat Head Mirror Wall Stickers Acrylic Mirror Decorative Decal Removable Waterproof Mirror Sticker For Living Room Bedroom Kids Nursery Home Decor
like
Find Similar
Modern acrylic cat-shaped mirror wall stickers for home living room decor - Silver
Modern cat-shaped yellow acrylic mirror wall sticker for living room home decoration - Gold
Creative red owl shaped acrylic mirror wall sticker for living room home decor - Red
Sapphire blue cat-shaped acrylic mirror wall sticker for children's room decoration - Blue
+1
DIY 3D Cat Head Mirror Wall Stickers Acrylic Mirror Decorative Decal Removable Waterproof Mirror Sticker For Living Room Bedroom Kids Nursery Home Decor
$2.39
No MOQ
3D Acrylic Mirror Wall Stickers Ocean Animals Octopus Tropical Fish Seaweed DIY Self-Adhesive Mural Decals For Home Decor
3D Acrylic Mirror Wall Stickers Ocean Animals Octopus Tropical Fish Seaweed DIY Self-Adhesive Mural Decals For Home Decor
like
Find Similar
3D acrylic ocean mirror wall stickers featuring fish, octopus, and bubbles for home decor - Silver
3D gold acrylic mirror wall stickers with marine animals for home decoration - Gold
Red 3D mirror acrylic ocean animal wall stickers featuring fish and sea creatures - Red
Modern 3D blue acrylic ocean animal wall stickers for living room and bedroom decor - Blue
+1
3D Acrylic Mirror Wall Stickers Ocean Animals Octopus Tropical Fish Seaweed DIY Self-Adhesive Mural Decals For Home Decor
-4%
$1.92
No MOQ
Geometric Round Circle Mirror Wall Stickers Waterproof Acrylic Self Adhesive Decals For Living Room Home Decor DIY Mural
Geometric Round Circle Mirror Wall Stickers Waterproof Acrylic Self Adhesive Decals For Living Room Home Decor DIY Mural
like
Find Similar
Macro detail of glossy gold acrylic mirror wall stickers with reflective round finish - Gold (JM96)
Detail showing a set of 40 pieces circular mirror wall stickers in a matrix arrangement - Silver (JM96)
Detail view of glossy red round mirror wall stickers for modern home living room decor - Red (JM96)
Blue acrylic round mirror wall stickers with reflective surface in a matrix layout - Blue (JM96)
+1
Geometric Round Circle Mirror Wall Stickers Waterproof Acrylic Self Adhesive Decals For Living Room Home Decor DIY Mural
$1.87
No MOQ
Modern Minimalist Fish Mirror Wall Stickers Acrylic 3D DIY Decal Shoals Of Fish For Living Room Nursery Bedroom Home Decor
Modern Minimalist Fish Mirror Wall Stickers Acrylic 3D DIY Decal Shoals Of Fish For Living Room Nursery Bedroom Home Decor
like
Find Similar
Vibrant yellow 3D fish mirror wall stickers set for nursery room and bedroom decor - Gold (JM023D)
Cartoon fish mirror wall stickers in white acrylic for modern home living room decor - Silver (JM023D)
Modern red fish mirror wall stickers in acrylic for creative nursery home decoration - Red (JM023D)
Detailed view of 18 blue 3D mirror fish wall stickers in a Nordic style kids room - Blue (JM023D)
+1
Modern Minimalist Fish Mirror Wall Stickers Acrylic 3D DIY Decal Shoals Of Fish For Living Room Nursery Bedroom Home Decor
-12%
$1.90
No MOQ
Ballet Dancer Silhouette Acrylic Mirror Wall Stickers Modern Home Decor For Living Room Bedroom Self Adhesive Wall Decals
Ballet Dancer Silhouette Acrylic Mirror Wall Stickers Modern Home Decor For Living Room Bedroom Self Adhesive Wall Decals
like
Find Similar
Set of 4 yellow acrylic mirror wall stickers featuring elegant ballet girl silhouettes - Gold (JM450)
Set of 4 silver acrylic mirror wall stickers featuring elegant ballet dancer silhouettes - Silver (JM450)
Blue acrylic mirror ballet dancers wall stickers set of 4 for modern home wall decor - Blue (JM450)
Set of 4 black acrylic mirror ballet dancer silhouettes for elegant wall decoration - Black (JM450)
+1
Ballet Dancer Silhouette Acrylic Mirror Wall Stickers Modern Home Decor For Living Room Bedroom Self Adhesive Wall Decals
$1.79
No MOQ
Sun Flower Mirror Wall Sticker DIY Acrylic Radial Geometric Decal Gold Silver Red Blue Black Self Adhesive Modern Home Decor
Sun Flower Mirror Wall Sticker DIY Acrylic Radial Geometric Decal Gold Silver Red Blue Black Self Adhesive Modern Home Decor
like
Find Similar
Vibrant yellow sunburst mirror wall sticker with 3D acrylic effect for home decor - Gold
Creative sunflower sun acrylic mirror wall stickers for home living room background decor - Silver
Detail of red sunflower acrylic mirror wall sticker with 3D reflective surface effect - Red
Blue acrylic sunflower mirror wall sticker with flame texture for home decor - Blue
+1
Sun Flower Mirror Wall Sticker DIY Acrylic Radial Geometric Decal Gold Silver Red Blue Black Self Adhesive Modern Home Decor
-4%
$1.78
No MOQ
Maple Leaf Acrylic Mirror Wall Sticker 3D DIY Decorative Waterproof Self Adhesive Decal For Living Room Bedroom Home Decor
Maple Leaf Acrylic Mirror Wall Sticker 3D DIY Decorative Waterproof Self Adhesive Decal For Living Room Bedroom Home Decor
like
Find Similar
3D red maple leaf acrylic mirror wall stickers set for living room home wall decoration - Red
Blue maple leaf acrylic mirror wall stickers for 3D home decor on minimalist white wall - Blue
3D black acrylic maple leaf wall stickers with reflective mirror finish for living room - Black
Acrylic maple leaf mirror wall stickers in yellow for modern living room home decoration - Gold
+1
Maple Leaf Acrylic Mirror Wall Sticker 3D DIY Decorative Waterproof Self Adhesive Decal For Living Room Bedroom Home Decor
$2.07
No MOQ
12Pcs Acrylic Mirror Butterfly Wall Stickers 3D DIY Removable Wall Decals Waterproof Home Decor For Living Room Bedroom
12Pcs Acrylic Mirror Butterfly Wall Stickers 3D DIY Removable Wall Decals Waterproof Home Decor For Living Room Bedroom
like
Find Similar
Red 3D mirror butterfly wall stickers in various sizes for bedroom decor - 12 Pcs/Set / Red
Set of 12 blue 3D mirror butterfly wall stickers for living room and bedroom decor - 12 Pcs/Set / Blue
Modern 3D matte black acrylic butterfly wall decals for minimalist home interior decoration - 12 Pcs/Set / Black
Set of 12 yellow acrylic mirror butterfly wall decals in assorted sizes for home decor - 12 Pcs/Set / Gold
+1
12Pcs Acrylic Mirror Butterfly Wall Stickers 3D DIY Removable Wall Decals Waterproof Home Decor For Living Room Bedroom
$1.01
No MOQ
Angel Heart Star 3D Acrylic Mirror Wall Sticker DIY Removable Mirror Decal For Kids Room Bedroom Living Room Home Decor
Angel Heart Star 3D Acrylic Mirror Wall Sticker DIY Removable Mirror Decal For Kids Room Bedroom Living Room Home Decor
like
Find Similar
Red 3D mirror heart and angel wall stickers set for living room and bedroom decor - Red
Blue acrylic mirror wall stickers featuring fairy and heart shapes for room decoration - Blue
Fairy and heart mirror wall stickers set for living room and bedroom wall decoration - Black
Mirror acrylic wall stickers featuring fairy and heart motifs in a modern living room - Silver
+1
Angel Heart Star 3D Acrylic Mirror Wall Sticker DIY Removable Mirror Decal For Kids Room Bedroom Living Room Home Decor
-11%
$1.93
No MOQ
3D Acrylic Mirror Flower Wall Stickers Waterproof Removable Self Adhesive Floral Mirror Wall Decals For Living Room Home Decor
3D Acrylic Mirror Flower Wall Stickers Waterproof Removable Self Adhesive Floral Mirror Wall Decals For Living Room Home Decor
like
Find Similar
Modern 3D acrylic mirror flower wall stickers in silver finish for home wall decor - Silver
3D acrylic mirror flower wall stickers in gold for modern living room wall decor - Gold
3D acrylic floral mirror wall stickers with modern reflective finish for home decor - Black
3D acrylic mirror flower wall stickers in navy blue for living room and bathroom decor - Blue
+1
3D Acrylic Mirror Flower Wall Stickers Waterproof Removable Self Adhesive Floral Mirror Wall Decals For Living Room Home Decor
$2.31
No MOQ
3D Acrylic Mirror Circle Bubble Wall Stickers Modern Minimalist Self-Adhesive Decorative Decals For Home Living Room Decor
3D Acrylic Mirror Circle Bubble Wall Stickers Modern Minimalist Self-Adhesive Decorative Decals For Home Living Room Decor
like
Find Similar
Macro detail of red acrylic 3D bubble wall stickers with glossy mirror finish on white wall - Red
Blue acrylic mirror wall stickers in bubble circle shapes for living room home decor - Blue
3D acrylic mirror circle wall stickers with black bubble design for modern home decor - Black
3D acrylic mirror circle wall decals in silver for modern living room home decor - Silver
+1
3D Acrylic Mirror Circle Bubble Wall Stickers Modern Minimalist Self-Adhesive Decorative Decals For Home Living Room Decor
-11%
$2.28
No MOQ
3D Mirror Acrylic Wall Sticker English Precious Quote Literary Sentence Self Adhesive Decor For Living Room Bedroom Office
3D Mirror Acrylic Wall Sticker English Precious Quote Literary Sentence Self Adhesive Decor For Living Room Bedroom Office
like
Find Similar
Precious English quote acrylic mirror wall sticker with heart accents in black script - S / Black
Golden acrylic mirror wall sticker with quote Precious things are very few in this world - S / Gold
Precious things letter acrylic mirror wall sticker in white finish with 3D text effect - S / Silver
+9
New3D Mirror Acrylic Wall Sticker English Precious Quote Literary Sentence Self Adhesive Decor For Living Room Bedroom Office
$5.76-17.29
No MOQ
3D Feather Acrylic Mirror Wall Sticker Modern Removable Self Adhesive Wall Decal For Living Room Bedroom Home Wall Decor
3D Feather Acrylic Mirror Wall Sticker Modern Removable Self Adhesive Wall Decal For Living Room Bedroom Home Wall Decor
like
Find Similar
6-piece set of golden feather acrylic mirror wall stickers for modern living room decor - Gold
Modern silver feather acrylic mirror wall stickers for living room decor set of five - Silver
Set of 6 black feather acrylic wall stickers with size 86x22.5cm for home decor - Black
Detail view of 6-piece red acrylic feather mirror wall decals for home living room decor - Red
+1
3D Feather Acrylic Mirror Wall Sticker Modern Removable Self Adhesive Wall Decal For Living Room Bedroom Home Wall Decor
$3.17
No MOQ
Watercolor Hydrangea Floral Wall Sticker PVC Self Adhesive Hanging Glass Ball Plant Mural For Bedroom Living Room Home Decor
Watercolor Hydrangea Floral Wall Sticker PVC Self Adhesive Hanging Glass Ball Plant Mural For Bedroom Living Room Home Decor
like
Find Similar
Detail showing self-adhesive watercolor hydrangea wall decal dimensions and layout - Watercolor Hydrangea Glass Ball Style (PH_QTB488)
Watercolor Hydrangea Floral Wall Sticker PVC Self Adhesive Hanging Glass Ball Plant Mural For Bedroom Living Room Home Decor
$1.01
No MOQ
Cartoon Little Yellow Duck Pond Play Window Sticker Static Cling PVC Glass Decal For Bedroom Living Room Home Decoration
Cartoon Little Yellow Duck Pond Play Window Sticker Static Cling PVC Glass Decal For Bedroom Living Room Home Decoration
like
Find Similar
Detail view of cartoon yellow duck glass sticker showing dimensions 14.9 by 11.9 inches - Cartoon Duck Pond Play (JDT-A368)
Cartoon Little Yellow Duck Pond Play Window Sticker Static Cling PVC Glass Decal For Bedroom Living Room Home Decoration
$0.86
No MOQ
Red Rose Butterfly Static Cling Window Sticker Waterproof PVC Glass Decal For Bedroom Balcony Romantic Home Wall Decor
Red Rose Butterfly Static Cling Window Sticker Waterproof PVC Glass Decal For Bedroom Balcony Romantic Home Wall Decor
like
Find Similar
Detailed view of red rose and butterfly static cling stickers with product dimensions - Red Rose Butterfly Motif (JDT-A358)
Red Rose Butterfly Static Cling Window Sticker Waterproof PVC Glass Decal For Bedroom Balcony Romantic Home Wall Decor
$1.21
No MOQ
Ocean Sea Turtle Beach Towel For Adults Microfiber Fast Drying Sandproof Bath Towel For Swimming Travel Pool Yoga Outdoors
Ocean Sea Turtle Beach Towel For Adults Microfiber Fast Drying Sandproof Bath Towel For Swimming Travel Pool Yoga Outdoors
like
Find Similar
Microfiber beach towel with sea turtle starfish print on sandy beach background - Light Yellow Repeated Turtle Pattern (STMJ01-18)
Microfiber beach towel featuring a blue sea turtle print and nautical stripes - Blue and White Striped Turtle (STMJ01-1)
Microfiber beach towel with orange sea turtle and blue nautical stripes held by a model - Nautical Element Striped Turtle (STMJ01-2)
Microfiber beach towel with large sea turtle print and tribal patterns in blue - Double Blue Tribal Turtle (STMJ01-3)
+14
Ocean Sea Turtle Beach Towel For Adults Microfiber Fast Drying Sandproof Bath Towel For Swimming Travel Pool Yoga Outdoors
$2.85
Mix MOQ : 2
 · 
37 sold recently
St Patricks Day Wall Stickers Gnome Shamrock Window Clings PVC Waterproof Green Lucky Decoration For Home Living Room Glass
St Patricks Day Wall Stickers Gnome Shamrock Window Clings PVC Waterproof Green Lucky Decoration For Home Living Room Glass
like
Find Similar
Set of 6 St. Patrick's Day gnome and shamrock window clings with 89 decorative elements - Festival Gnome and Shamrock Set / 20*30cm
St Patricks Day Wall Stickers Gnome Shamrock Window Clings PVC Waterproof Green Lucky Decoration For Home Living Room Glass
$2.25
Mix MOQ : 2
Free Shipping
Halloween Bloodstain Window Stickers Horror Ghost Silhouette Skull Skeleton Static Cling PVC Decals For Party Decoration
Halloween Bloodstain Window Stickers Horror Ghost Silhouette Skull Skeleton Static Cling PVC Decals For Party Decoration
like
Find Similar
Halloween window stickers set with blood handprints, ghostly shadows, and skulls 90x30cm - Blood Skull Set (UV24Y12307S_R) / 90x30cm
Halloween Bloodstain Window Stickers Horror Ghost Silhouette Skull Skeleton Static Cling PVC Decals For Party Decoration
$1.87
Mix MOQ : 2
Halloween Ghost Window Stickers Cute Cat Bat Spider Static Cling PVC Decals For Glass Window Party Decor Removable Decor
Halloween Ghost Window Stickers Cute Cat Bat Spider Static Cling PVC Decals For Glass Window Party Decor Removable Decor
like
Find Similar
Detailed dimensions of 60-piece Halloween window stickers set with ghosts and cats - UV24Y12199S_T / 20*30cm*6pcs
Halloween Ghost Window Stickers Cute Cat Bat Spider Static Cling PVC Decals For Glass Window Party Decor Removable Decor
$2.36
Mix MOQ : 2
Colorful Daisy Flower Window Static Cling Stickers Inspirational Motivational Quotes Mirror Decoration Decal Removable Floral PVC Mirror Stickers For Home
Colorful Daisy Flower Window Static Cling Stickers Inspirational Motivational Quotes Mirror Decoration Decal Removable Floral PVC Mirror Stickers For Home
like
Find Similar
Detail showing 56-piece colorful daisy wall decals with inspiring quotes and size specs - Colorful Inspirational Floral / 20*30cm*4pcs
Colorful Daisy Flower Window Static Cling Stickers Inspirational Motivational Quotes Mirror Decoration Decal Removable Floral PVC Mirror Stickers For Home
$1.73
Mix MOQ : 2
Watercolor Pink Ribbon Bow Bible Verse Wall Stickers PVC God Says I Am Religious Quotes Nursery Room Decor Girl Bedroom Wall Decal
Watercolor Pink Ribbon Bow Bible Verse Wall Stickers PVC God Says I Am Religious Quotes Nursery Room Decor Girl Bedroom Wall Decal
like
Find Similar
Watercolor pink bow and flower wall stickers with religious inspirational quotes - Pink Watercolor Bow Religious Quotes (UV24Y11949T_R) / 90x30cm
Watercolor Pink Ribbon Bow Bible Verse Wall Stickers PVC God Says I Am Religious Quotes Nursery Room Decor Girl Bedroom Wall Decal
$1.87
Mix MOQ : 2
Summer Mediterranean Ocean Style Round Wooden Wall Decor Starfish Shell Beach Hollow Art Home Wall Hanging Decor Ornaments
Summer Mediterranean Ocean Style Round Wooden Wall Decor Starfish Shell Beach Hollow Art Home Wall Hanging Decor Ornaments
like
Find Similar
Set of 4 round nautical wooden wall signs with starfish beach prints and hanging hooks - Ocean Theme Style (Y24Y50955_Q) / 20cmx0.5cm (4 Blocks)
Summer Mediterranean Ocean Style Round Wooden Wall Decor Starfish Shell Beach Hollow Art Home Wall Hanging Decor Ornaments
$6.07
Mix MOQ : 2
Sunflower Butterfly Window Stickers PVC Decorative Floral Wall Decals For Glass Surface Home Decor Kitchen Bedroom Decor
Sunflower Butterfly Window Stickers PVC Decorative Floral Wall Decals For Glass Surface Home Decor Kitchen Bedroom Decor
like
Find Similar
Detailed dimensions of 25pcs sunflower and butterfly window decals set in 30x60cm sheet - Sunflower Butterfly Style (CT24Y11622T_R)
Sunflower Butterfly Window Stickers PVC Decorative Floral Wall Decals For Glass Surface Home Decor Kitchen Bedroom Decor
$1.67
Mix MOQ : 2
Easter Watercolor Bunny Flower Garland Wall Sticker PVC Window Decal Rabbit Pattern Spring Holiday Home Decoration Accessories
Easter Watercolor Bunny Flower Garland Wall Sticker PVC Window Decal Rabbit Pattern Spring Holiday Home Decoration Accessories
like
Find Similar
Detail view showing Easter rabbit wall sticker layout on 30x30cm sheet with floral wreath - 30*30cm / Bunny With Pink Flowers (CT24Y11442T_T)
Detail view of Easter bunny watercolor wall decals with precise dimensions and 9 components - 30*30cm / Bunny Head Garland (CT24Y11443T_T)
Detailed sheet dimensions of watercolor Easter bunny and floral wall stickers set - 30*30cm / Watercolor Bunny (CT24Y11444T_T)
Easter Watercolor Bunny Flower Garland Wall Sticker PVC Window Decal Rabbit Pattern Spring Holiday Home Decoration Accessories
$1.21
Mix MOQ : 2
Summer Gnomes PVC Window Stickers Watermelon Flamingo Beach Decor For Glass Fridge Wall Home Decoration
Summer Gnomes PVC Window Stickers Watermelon Flamingo Beach Decor For Glass Fridge Wall Home Decoration
like
Find Similar
Detail showing 34pcs ocean gnome wall stickers with beach elements and dimensions - Ocean Gnome Style (UV24Y11453T_T) / 20x30cm
Summer gnome wall stickers set with 43pcs featuring watermelon and flamingo motifs - Summer Fruit Gnome Style (UV24Y11450T_T) / 20x30cm
Summer Gnomes PVC Window Stickers Watermelon Flamingo Beach Decor For Glass Fridge Wall Home Decoration
$2.45
Mix MOQ : 2
Valentine's Day Static Window Cling PVC Sticker Red Rose Heart Garland Romantic Festival Decor For Window Glass Toilet
Valentine's Day Static Window Cling PVC Sticker Red Rose Heart Garland Romantic Festival Decor For Window Glass Toilet
like
Find Similar
Detail showing 30x30cm Valentine window cling with red roses and hanging heart designs - Red Rose Heart Style 1 (CT24Y11112S_T) / 30*30cm
Detail view of 30cm heart wreath window sticker with red flowers and wooden clips - Red Rose Heart Style 2 (CT24Y11113S_T) / 30*30cm
Valentine's Day red rose and heart wreath window cling static sticker decal - Red Rose Heart Style 3 (CT24Y11114S_T) / 30*30cm
Valentine's Day Static Window Cling PVC Sticker Red Rose Heart Garland Romantic Festival Decor For Window Glass Toilet
$1.59
Mix MOQ : 2
Go to

More in home & kitchen

Explore more in bedding & bathroom

homecolortravelstoragestylepolyesterdoubleheaddesignheart
hangingholderplasticshapecleaningsimplekidslayerwhitedaily

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access