Everful

Wholesale bedding & bathroom

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Bedding & Bathroom

Find the perfect pieces: wall stickers, window stickers, kitchen stickers and more

Popular collections in bedding & bathroom

All products in bedding & bathroom

filterShow filters
Price Drop
Free Shipping
Best Seller
New Arrivals
3D Acrylic Mirror Flower Wall Stickers Waterproof Removable Self Adhesive Floral Mirror Wall Decals For Living Room Home Decor
3D Acrylic Mirror Flower Wall Stickers Waterproof Removable Self Adhesive Floral Mirror Wall Decals For Living Room Home Decor
like
Find Similar
Modern 3D acrylic mirror flower wall stickers in silver finish for home wall decor - Silver
3D acrylic mirror flower wall stickers in gold for modern living room wall decor - Gold
3D acrylic floral mirror wall stickers with modern reflective finish for home decor - Black
3D acrylic mirror flower wall stickers in navy blue for living room and bathroom decor - Blue
+1
3D Acrylic Mirror Flower Wall Stickers Waterproof Removable Self Adhesive Floral Mirror Wall Decals For Living Room Home Decor
-20%
$1.84
No MOQ
3D Acrylic Mirror Circle Bubble Wall Stickers Modern Minimalist Self-Adhesive Decorative Decals For Home Living Room Decor
3D Acrylic Mirror Circle Bubble Wall Stickers Modern Minimalist Self-Adhesive Decorative Decals For Home Living Room Decor
like
Find Similar
Macro detail of red acrylic 3D bubble wall stickers with glossy mirror finish on white wall - Red
Blue acrylic mirror wall stickers in bubble circle shapes for living room home decor - Blue
3D acrylic mirror circle wall stickers with black bubble design for modern home decor - Black
3D acrylic mirror circle wall decals in silver for modern living room home decor - Silver
+1
3D Acrylic Mirror Circle Bubble Wall Stickers Modern Minimalist Self-Adhesive Decorative Decals For Home Living Room Decor
$2.59
No MOQ
3D Mirror Acrylic Wall Sticker English Precious Quote Literary Sentence Self Adhesive Decor For Living Room Bedroom Office
3D Mirror Acrylic Wall Sticker English Precious Quote Literary Sentence Self Adhesive Decor For Living Room Bedroom Office
like
Find Similar
Precious English quote acrylic mirror wall sticker with heart accents in black script - S / Black
Golden acrylic mirror wall sticker with quote Precious things are very few in this world - S / Gold
Precious things letter acrylic mirror wall sticker in white finish with 3D text effect - S / Silver
+9
New3D Mirror Acrylic Wall Sticker English Precious Quote Literary Sentence Self Adhesive Decor For Living Room Bedroom Office
-12%
$5.07-15.22
No MOQ
3D Feather Acrylic Mirror Wall Sticker Modern Removable Self Adhesive Wall Decal For Living Room Bedroom Home Wall Decor
3D Feather Acrylic Mirror Wall Sticker Modern Removable Self Adhesive Wall Decal For Living Room Bedroom Home Wall Decor
like
Find Similar
6-piece set of golden feather acrylic mirror wall stickers for modern living room decor - Gold
Modern silver feather acrylic mirror wall stickers for living room decor set of five - Silver
Set of 6 black feather acrylic wall stickers with size 86x22.5cm for home decor - Black
Detail view of 6-piece red acrylic feather mirror wall decals for home living room decor - Red
+1
3D Feather Acrylic Mirror Wall Sticker Modern Removable Self Adhesive Wall Decal For Living Room Bedroom Home Wall Decor
-11%
$2.79
No MOQ
Watercolor Hydrangea Floral Wall Sticker PVC Self Adhesive Hanging Glass Ball Plant Mural For Bedroom Living Room Home Decor
Watercolor Hydrangea Floral Wall Sticker PVC Self Adhesive Hanging Glass Ball Plant Mural For Bedroom Living Room Home Decor
like
Find Similar
Detail showing self-adhesive watercolor hydrangea wall decal dimensions and layout - Watercolor Hydrangea Glass Ball Style (PH_QTB488)
Watercolor Hydrangea Floral Wall Sticker PVC Self Adhesive Hanging Glass Ball Plant Mural For Bedroom Living Room Home Decor
$1.01
No MOQ
Cartoon Little Yellow Duck Pond Play Window Sticker Static Cling PVC Glass Decal For Bedroom Living Room Home Decoration
Cartoon Little Yellow Duck Pond Play Window Sticker Static Cling PVC Glass Decal For Bedroom Living Room Home Decoration
like
Find Similar
Detail view of cartoon yellow duck glass sticker showing dimensions 14.9 by 11.9 inches - Cartoon Duck Pond Play (JDT-A368)
Cartoon Little Yellow Duck Pond Play Window Sticker Static Cling PVC Glass Decal For Bedroom Living Room Home Decoration
$0.86
No MOQ
Red Rose Butterfly Static Cling Window Sticker Waterproof PVC Glass Decal For Bedroom Balcony Romantic Home Wall Decor
Red Rose Butterfly Static Cling Window Sticker Waterproof PVC Glass Decal For Bedroom Balcony Romantic Home Wall Decor
like
Find Similar
Detailed view of red rose and butterfly static cling stickers with product dimensions - Red Rose Butterfly Motif (JDT-A358)
Red Rose Butterfly Static Cling Window Sticker Waterproof PVC Glass Decal For Bedroom Balcony Romantic Home Wall Decor
$1.21
No MOQ
Leopard Print Satin Sleep Cap For Women Soft Polyester Wide Band Bonnet Hair Care Night Hat With Adjustable Tie Bow
Leopard Print Satin Sleep Cap For Women Soft Polyester Wide Band Bonnet Hair Care Night Hat With Adjustable Tie Bow
like
Find Similar
Detail of silk-like leopard print sleep cap with silver-grey satin and stylish side ribbon - One Size / Purple
Detail of mint green leopard print satin sleep bonnet on a white mannequin head - One Size / Green
Silky leopard print satin bonnet with bow decoration shown on a model head - One Size / Off-white
Leopard Print Satin Sleep Cap For Women Soft Polyester Wide Band Bonnet Hair Care Night Hat With Adjustable Tie Bow
$2.31
Mix MOQ : 2
 · 
23 sold recently
St Patricks Day Wall Stickers Gnome Shamrock Window Clings PVC Waterproof Green Lucky Decoration For Home Living Room Glass
St Patricks Day Wall Stickers Gnome Shamrock Window Clings PVC Waterproof Green Lucky Decoration For Home Living Room Glass
like
Find Similar
Set of 6 St. Patrick's Day gnome and shamrock window clings with 89 decorative elements - Festival Gnome and Shamrock Set / 20*30cm
St Patricks Day Wall Stickers Gnome Shamrock Window Clings PVC Waterproof Green Lucky Decoration For Home Living Room Glass
$2.25
Mix MOQ : 2
Free Shipping
Halloween Bloodstain Window Stickers Horror Ghost Silhouette Skull Skeleton Static Cling PVC Decals For Party Decoration
Halloween Bloodstain Window Stickers Horror Ghost Silhouette Skull Skeleton Static Cling PVC Decals For Party Decoration
like
Find Similar
Halloween window stickers set with blood handprints, ghostly shadows, and skulls 90x30cm - Blood Skull Set (UV24Y12307S_R) / 90x30cm
Halloween Bloodstain Window Stickers Horror Ghost Silhouette Skull Skeleton Static Cling PVC Decals For Party Decoration
$1.87
Mix MOQ : 2
Halloween Ghost Window Stickers Cute Cat Bat Spider Static Cling PVC Decals For Glass Window Party Decor Removable Decor
Halloween Ghost Window Stickers Cute Cat Bat Spider Static Cling PVC Decals For Glass Window Party Decor Removable Decor
like
Find Similar
Detailed dimensions of 60-piece Halloween window stickers set with ghosts and cats - UV24Y12199S_T / 20*30cm*6pcs
Halloween Ghost Window Stickers Cute Cat Bat Spider Static Cling PVC Decals For Glass Window Party Decor Removable Decor
$2.36
Mix MOQ : 2
Colorful Daisy Flower Window Static Cling Stickers Inspirational Motivational Quotes Mirror Decoration Decal Removable Floral PVC Mirror Stickers For Home
Colorful Daisy Flower Window Static Cling Stickers Inspirational Motivational Quotes Mirror Decoration Decal Removable Floral PVC Mirror Stickers For Home
like
Find Similar
Detail showing 56-piece colorful daisy wall decals with inspiring quotes and size specs - Colorful Inspirational Floral / 20*30cm*4pcs
Colorful Daisy Flower Window Static Cling Stickers Inspirational Motivational Quotes Mirror Decoration Decal Removable Floral PVC Mirror Stickers For Home
$1.73
Mix MOQ : 2
Watercolor Pink Ribbon Bow Bible Verse Wall Stickers PVC God Says I Am Religious Quotes Nursery Room Decor Girl Bedroom Wall Decal
Watercolor Pink Ribbon Bow Bible Verse Wall Stickers PVC God Says I Am Religious Quotes Nursery Room Decor Girl Bedroom Wall Decal
like
Find Similar
Watercolor pink bow and flower wall stickers with religious inspirational quotes - Pink Watercolor Bow Religious Quotes (UV24Y11949T_R) / 90x30cm
Watercolor Pink Ribbon Bow Bible Verse Wall Stickers PVC God Says I Am Religious Quotes Nursery Room Decor Girl Bedroom Wall Decal
$1.87
Mix MOQ : 2
Summer Mediterranean Ocean Style Round Wooden Wall Decor Starfish Shell Beach Hollow Art Home Wall Hanging Decor Ornaments
Summer Mediterranean Ocean Style Round Wooden Wall Decor Starfish Shell Beach Hollow Art Home Wall Hanging Decor Ornaments
like
Find Similar
Set of 4 round nautical wooden wall signs with starfish beach prints and hanging hooks - Ocean Theme Style (Y24Y50955_Q) / 20cmx0.5cm (4 Blocks)
Summer Mediterranean Ocean Style Round Wooden Wall Decor Starfish Shell Beach Hollow Art Home Wall Hanging Decor Ornaments
$6.07
Mix MOQ : 2
Sunflower Butterfly Window Stickers PVC Decorative Floral Wall Decals For Glass Surface Home Decor Kitchen Bedroom Decor
Sunflower Butterfly Window Stickers PVC Decorative Floral Wall Decals For Glass Surface Home Decor Kitchen Bedroom Decor
like
Find Similar
Detailed dimensions of 25pcs sunflower and butterfly window decals set in 30x60cm sheet - Sunflower Butterfly Style (CT24Y11622T_R)
Sunflower Butterfly Window Stickers PVC Decorative Floral Wall Decals For Glass Surface Home Decor Kitchen Bedroom Decor
$1.67
Mix MOQ : 2
Easter Watercolor Bunny Flower Garland Wall Sticker PVC Window Decal Rabbit Pattern Spring Holiday Home Decoration Accessories
Easter Watercolor Bunny Flower Garland Wall Sticker PVC Window Decal Rabbit Pattern Spring Holiday Home Decoration Accessories
like
Find Similar
Detail view showing Easter rabbit wall sticker layout on 30x30cm sheet with floral wreath - 30*30cm / Bunny With Pink Flowers (CT24Y11442T_T)
Detail view of Easter bunny watercolor wall decals with precise dimensions and 9 components - 30*30cm / Bunny Head Garland (CT24Y11443T_T)
Detailed sheet dimensions of watercolor Easter bunny and floral wall stickers set - 30*30cm / Watercolor Bunny (CT24Y11444T_T)
Easter Watercolor Bunny Flower Garland Wall Sticker PVC Window Decal Rabbit Pattern Spring Holiday Home Decoration Accessories
$1.21
Mix MOQ : 2
Summer Gnomes PVC Window Stickers Watermelon Flamingo Beach Decor For Glass Fridge Wall Home Decoration
Summer Gnomes PVC Window Stickers Watermelon Flamingo Beach Decor For Glass Fridge Wall Home Decoration
like
Find Similar
Detail showing 34pcs ocean gnome wall stickers with beach elements and dimensions - Ocean Gnome Style (UV24Y11453T_T) / 20x30cm
Summer gnome wall stickers set with 43pcs featuring watermelon and flamingo motifs - Summer Fruit Gnome Style (UV24Y11450T_T) / 20x30cm
Summer Gnomes PVC Window Stickers Watermelon Flamingo Beach Decor For Glass Fridge Wall Home Decoration
$2.45
Mix MOQ : 2
Valentine's Day Static Window Cling PVC Sticker Red Rose Heart Garland Romantic Festival Decor For Window Glass Toilet
Valentine's Day Static Window Cling PVC Sticker Red Rose Heart Garland Romantic Festival Decor For Window Glass Toilet
like
Find Similar
Detail showing 30x30cm Valentine window cling with red roses and hanging heart designs - Red Rose Heart Style 1 (CT24Y11112S_T) / 30*30cm
Detail view of 30cm heart wreath window sticker with red flowers and wooden clips - Red Rose Heart Style 2 (CT24Y11113S_T) / 30*30cm
Valentine's Day red rose and heart wreath window cling static sticker decal - Red Rose Heart Style 3 (CT24Y11114S_T) / 30*30cm
Valentine's Day Static Window Cling PVC Sticker Red Rose Heart Garland Romantic Festival Decor For Window Glass Toilet
$1.59
Mix MOQ : 2
Fresh Green Potted Plants Butterfly Wall Stickers PVC Self Adhesive Window Decals For Living Room Bedroom Home Decor
Fresh Green Potted Plants Butterfly Wall Stickers PVC Self Adhesive Window Decals For Living Room Bedroom Home Decor
like
Find Similar
39pcs adhesive PVC wall stickers featuring green potted plants and colorful butterflies - Green Plants and Butterfly Set (CT24Y11020T_T) / 20*30cm*4 Sheets
Fresh Green Potted Plants Butterfly Wall Stickers PVC Self Adhesive Window Decals For Living Room Bedroom Home Decor
$1.73
Mix MOQ : 2
Easter Bunny Rabbit Colorful Egg Watercolor PVC Wall Window Sticker Self Adhesive Fridge Toilet Decal Festival Home Decor
Easter Bunny Rabbit Colorful Egg Watercolor PVC Wall Window Sticker Self Adhesive Fridge Toilet Decal Festival Home Decor
like
Find Similar
Easter wall sticker detail showing watercolor brown bunny and colorful eggs, 30x30cm size - 30*30cm / Watercolor Bunny and Egg Style (UV26Y80304T_T)
Easter Bunny Rabbit Colorful Egg Watercolor PVC Wall Window Sticker Self Adhesive Fridge Toilet Decal Festival Home Decor
$1.15
Mix MOQ : 2
Green Plant Vines And Butterflies Wall Sticker PVC Self Adhesive Window Decal Fresh Floral Home Decor For Living Room Bedroom
Green Plant Vines And Butterflies Wall Sticker PVC Self Adhesive Window Decal Fresh Floral Home Decor For Living Room Bedroom
like
Find Similar
Detailed dimension layout for PVC vine and butterfly wall decals set with measurements - Hanging Vines Butterfly (CT26Y80277T_R) / 90x30cm
Green Plant Vines And Butterflies Wall Sticker PVC Self Adhesive Window Decal Fresh Floral Home Decor For Living Room Bedroom
$1.87
Mix MOQ : 2
Nordic Vintage Floral Self Adhesive Wallpaper PVC Waterproof Removable Wall Sticker For Living Room Bedroom Home Decor
Nordic Vintage Floral Self Adhesive Wallpaper PVC Waterproof Removable Wall Sticker For Living Room Bedroom Home Decor
like
Find Similar
Seamless Nordic vintage floral wallpaper with grey and white rose patterns for living room - Vintage Floral (26Y70003) / 44cm*300cm Per Roll
Self-adhesive PVC wallpaper with watercolor floral and green leaf botanical patterns - Fresh Pastoral (26Y70004) / 44cm*300cm Per Roll
Nordic vintage botanical floral PVC wallpaper with fabric texture and ladybug detail - Artistic Ditsy (26Y70005) / 44cm*300cm Per Roll
Nordic style wallpaper with birds and purple floral patterns in a green watercolor finish - Floral Bird Hand-painted (26Y70006) / 44cm*300cm Per Roll
+4
Nordic Vintage Floral Self Adhesive Wallpaper PVC Waterproof Removable Wall Sticker For Living Room Bedroom Home Decor
$4.27-6.34
Mix MOQ : 2
Easter Egg Window Stickers PVC Self Adhesive Wall Decals Watercolor Pastel Hanging Egg Pattern For Holiday Home Decor
Easter Egg Window Stickers PVC Self Adhesive Wall Decals Watercolor Pastel Hanging Egg Pattern For Holiday Home Decor
like
Find Similar
Detailed size chart for 22pcs Easter egg window stickers on 4 sheets of PVC wall decals - 20*30cm*4 Sheets
Easter Egg Window Stickers PVC Self Adhesive Wall Decals Watercolor Pastel Hanging Egg Pattern For Holiday Home Decor
$1.73
Mix MOQ : 2
Pastoral Polyester Embroidered Coffee Curtains Rural Floral Pattern Short Kitchen Door Curtains With Ruffled Hem For Sink Decor
Pastoral Polyester Embroidered Coffee Curtains Rural Floral Pattern Short Kitchen Door Curtains With Ruffled Hem For Sink Decor
like
Find Similar
Sheer white cafe curtain with tulip embroidery and terracotta ruffled hem for kitchen decor - 100*60 / Tulip Embroidery
Linen farmhouse cafe curtain with red pineapple embroidery and brown ruffle edge trim - 180*60 / Red Pineapple Embroidery
Short cafe curtain with red dot geometric pattern and ruffled hem for kitchen windows - 150*60cm / Multicolor Polka Dot
White semi-sheer cafe curtain with colorful leaf embroidery and terracotta ruffled hem - 150*60cm / Red Yellow Green Leaves
+14
Pastoral Polyester Embroidered Coffee Curtains Rural Floral Pattern Short Kitchen Door Curtains With Ruffled Hem For Sink Decor
-5%
$4.27-6.79
No MOQ
American Vintage Pastoral Impressionist Floral Polyester Door Curtain For Bedroom Living Room Privacy Shield Decorative Hanging Curtain
American Vintage Pastoral Impressionist Floral Polyester Door Curtain For Bedroom Living Room Privacy Shield Decorative Hanging Curtain
like
Find Similar
Retro floral door curtain with oil painting style flowers in bright yellow and blue - 100*130cm / Impressionist Purple
American vintage floral door curtain with colorful oil painting pattern for home decor - 100*130cm / Impressionist Green
American Vintage Pastoral Impressionist Floral Polyester Door Curtain For Bedroom Living Room Privacy Shield Decorative Hanging Curtain
-4%
$4.63-6.80
No MOQ
American Pastoral Tiered Ruffle Cafe Curtain Solid Color Polyester Valance Rod Pocket Half Curtain For Window Cabinet Decor
American Pastoral Tiered Ruffle Cafe Curtain Solid Color Polyester Valance Rod Pocket Half Curtain For Window Cabinet Decor
like
Find Similar
Light gray sheer tier curtain with ruffled layers and rod pocket for cafe or cabinets - 45*100 / Gray
White ruffled partition cafe curtain with layered lace detail in a cozy home setting - 45*100 / White
Sage green tiered ruffle cafe curtain for kitchen window with fresh minimalist design - 45*100 / Bean Green
+6
American Pastoral Tiered Ruffle Cafe Curtain Solid Color Polyester Valance Rod Pocket Half Curtain For Window Cabinet Decor
-5%
$3.70-5.67
No MOQ
White Lace Cafe Curtain Fruit Print Scalloped Edge Pastoral Short Window Curtain For Kitchen Living Room Home Decoration
White Lace Cafe Curtain Fruit Print Scalloped Edge Pastoral Short Window Curtain For Kitchen Living Room Home Decoration
like
Find Similar
White lace cafe curtain with fruit patterns and scalloped edges for kitchen windows - Fruit Print Cafe Style / 140cm*90cm
White Lace Cafe Curtain Fruit Print Scalloped Edge Pastoral Short Window Curtain For Kitchen Living Room Home Decoration
-5%
$5.89
No MOQ
Nordic Bohemian Geometric Printed Door Curtain Polyester Privacy Partition Hanging Curtain For Bedroom Kitchen Home Decor
Nordic Bohemian Geometric Printed Door Curtain Polyester Privacy Partition Hanging Curtain For Bedroom Kitchen Home Decor
like
Find Similar
Bohemian geometric door curtain in cream and navy blue for privacy and home partition - 140*200 / Geometric Print
Nordic Bohemian Geometric Printed Door Curtain Polyester Privacy Partition Hanging Curtain For Bedroom Kitchen Home Decor
-4%
$6.30
No MOQ
Nordic Style Geometric Print Door Curtain Thick Polyester Grommet Top Partition Curtain For Bedroom Kitchen Privacy Shielding
Nordic Style Geometric Print Door Curtain Thick Polyester Grommet Top Partition Curtain For Bedroom Kitchen Privacy Shielding
like
Find Similar
Bohemian geometric door curtain with colorful patterns and metal grommet top - 140*200 / Multi-color Circles
Nordic Style Geometric Print Door Curtain Thick Polyester Grommet Top Partition Curtain For Bedroom Kitchen Privacy Shielding
$6.63
No MOQ
Watercolor Three Little Cats Wall Stickers Waterproof Removable PVC Decorative Decals For Living Room Bedroom Home Decor
Watercolor Three Little Cats Wall Stickers Waterproof Removable PVC Decorative Decals For Living Room Bedroom Home Decor
like
Find Similar
Three cute watercolor cat wall stickers in grey, white and black for home decoration - Three Watercolor Cats Style (SC461)
Watercolor Three Little Cats Wall Stickers Waterproof Removable PVC Decorative Decals For Living Room Bedroom Home Decor
$0.92
Mix MOQ : 4
Pink Cherry Blossom Heart Wall Sticker Waterproof PVC Removable Flower Decal For Bedroom Living Room Toilet Home Decoration
Pink Cherry Blossom Heart Wall Sticker Waterproof PVC Removable Flower Decal For Bedroom Living Room Toilet Home Decoration
like
Find Similar
Self-adhesive pink watercolor floral heart wall sticker with peach blossom design - 30x30cm
Pink Cherry Blossom Heart Wall Sticker Waterproof PVC Removable Flower Decal For Bedroom Living Room Toilet Home Decoration
$0.92
Mix MOQ : 4
Watercolor Purple Whale Wall Stickers PVC Self Adhesive Removable Decals For Kids Nursery Bedroom Living Room Stars Clouds Decor
Watercolor Purple Whale Wall Stickers PVC Self Adhesive Removable Decals For Kids Nursery Bedroom Living Room Stars Clouds Decor
like
Find Similar
Dreamy purple cartoon dolphin wall stickers set with stars and clouds for bedroom decor - Purple Dolphin (ZC1098)
Watercolor Purple Whale Wall Stickers PVC Self Adhesive Removable Decals For Kids Nursery Bedroom Living Room Stars Clouds Decor
$1.44
Mix MOQ : 4
Dreamy Watercolor Unicorn Pink Peony Flower Wall Sticker PVC Removable Waterproof Decal For Nursery Girls Room Bedroom Home Decor
Dreamy Watercolor Unicorn Pink Peony Flower Wall Sticker PVC Removable Waterproof Decal For Nursery Girls Room Bedroom Home Decor
like
Find Similar
Pink unicorn and floral wall sticker with paste effect and layout size details - Unicorn (TA396)
Dreamy Watercolor Unicorn Pink Peony Flower Wall Sticker PVC Removable Waterproof Decal For Nursery Girls Room Bedroom Home Decor
$0.92
Mix MOQ : 4
Watercolor Purple Sea Turtle Wall Sticker Lavender Flower Marine Life PVC Removable Waterproof Decal For Home Decor
Watercolor Purple Sea Turtle Wall Sticker Lavender Flower Marine Life PVC Removable Waterproof Decal For Home Decor
like
Find Similar
Sea turtle and purple flower PVC wall stickers with 49x48cm layout size specifications - Purple Turtle / 30x60cm
NewWatercolor Purple Sea Turtle Wall Sticker Lavender Flower Marine Life PVC Removable Waterproof Decal For Home Decor
$1.21
Mix MOQ : 4
Elegant Christmas Gold Snowflake Wall Sticker Baroque Style Self Adhesive PVC Decal For Bedroom Living Room Holiday Home Decor
Elegant Christmas Gold Snowflake Wall Sticker Baroque Style Self Adhesive PVC Decal For Bedroom Living Room Holiday Home Decor
like
Find Similar
Golden snowflake wall sticker in PVC with 28x28cm paste size and 30x30cm layout - ZC886-Gold Flower-30-30 (No Bag)
Elegant Christmas Gold Snowflake Wall Sticker Baroque Style Self Adhesive PVC Decal For Bedroom Living Room Holiday Home Decor
$0.92
Mix MOQ : 4
Pastoral Sunflower White Fence PVC Wall Stickers For Bedroom Living Room Skirting Line Decorative Self-Adhesive Wall Decals Home Decor
Pastoral Sunflower White Fence PVC Wall Stickers For Bedroom Living Room Skirting Line Decorative Self-Adhesive Wall Decals Home Decor
like
Find Similar
1 option
NewPastoral Sunflower White Fence PVC Wall Stickers For Bedroom Living Room Skirting Line Decorative Self-Adhesive Wall Decals Home Decor
$1.44
Mix MOQ : 4
Christmas Santa Claus Holding Gifts Wall Sticker Waterproof PVC Decal For Living Room Bedroom Toilet Background Festive Decoration
Christmas Santa Claus Holding Gifts Wall Sticker Waterproof PVC Decal For Living Room Bedroom Toilet Background Festive Decoration
like
Find Similar
Santa Claus PVC wall sticker with gift boxes, 30x30cm layout for Christmas decor - 30x30cm
Christmas Santa Claus Holding Gifts Wall Sticker Waterproof PVC Decal For Living Room Bedroom Toilet Background Festive Decoration
$0.92
Mix MOQ : 4
Watercolor Blue Christmas Tree Wall Stickers Snowflake PVC Decals For Bedroom Living Room Holiday Home Wall Decoration
Watercolor Blue Christmas Tree Wall Stickers Snowflake PVC Decals For Bedroom Living Room Holiday Home Wall Decoration
like
Find Similar
Blue Christmas tree wall sticker with snowflakes and gift boxes layout and paste size - PC686/29.5*29.5
Watercolor Blue Christmas Tree Wall Stickers Snowflake PVC Decals For Bedroom Living Room Holiday Home Wall Decoration
$0.92
Mix MOQ : 4
3D Broken Wall Effect Fairy In Pink Flowers Wall Sticker Waterproof Self-Adhesive PVC Decal For Kids Room Bedroom Home Decor
3D Broken Wall Effect Fairy In Pink Flowers Wall Sticker Waterproof Self-Adhesive PVC Decal For Kids Room Bedroom Home Decor
like
Find Similar
3D pink flower fairy wall sticker for home decor, sizing 4.60in x 4.52in variant - Pink Fairy / TA115/15*15
3D Broken Wall Effect Fairy In Pink Flowers Wall Sticker Waterproof Self-Adhesive PVC Decal For Kids Room Bedroom Home Decor
$0.81
Mix MOQ : 4
Watercolor Angel Girl Wall Sticker PVC Waterproof Self-Adhesive Pink Dress Green Wings Flower Crown For Nursery Home Decor
Watercolor Angel Girl Wall Sticker PVC Waterproof Self-Adhesive Pink Dress Green Wings Flower Crown For Nursery Home Decor
like
Find Similar
Detail view of pink angel wall sticker showing layout and finished display dimensions - Angel Girl Pattern (TA114)
Watercolor Angel Girl Wall Sticker PVC Waterproof Self-Adhesive Pink Dress Green Wings Flower Crown For Nursery Home Decor
$0.92
Mix MOQ : 4
Floral Vase Wall Sticker Pink Rose Blue Flower Butterfly Removable PVC Self-Adhesive Wall Decal For Bedroom Living Room Home Decor
Floral Vase Wall Sticker Pink Rose Blue Flower Butterfly Removable PVC Self-Adhesive Wall Decal For Bedroom Living Room Home Decor
like
Find Similar
Detail showing the layout size and paste effect dimensions of the floral wall sticker - PD229/30*40 (No Bag)
Floral Vase Wall Sticker Pink Rose Blue Flower Butterfly Removable PVC Self-Adhesive Wall Decal For Bedroom Living Room Home Decor
$0.98
Mix MOQ : 4
Pastoral Wildflower Wall Sticker PVC Self Adhesive Floral Meadow Skirting Line Decal For Living Room Bedroom Home Decor
Pastoral Wildflower Wall Sticker PVC Self Adhesive Floral Meadow Skirting Line Decal For Living Room Bedroom Home Decor
like
Find Similar
Wildflower wall sticker with 90x30cm layout size and 53.5x42cm final paste effect dimensions - TA063 (30x90cm)
NewPastoral Wildflower Wall Sticker PVC Self Adhesive Floral Meadow Skirting Line Decal For Living Room Bedroom Home Decor
$1.44
Mix MOQ : 4
Cartoon Whale Jellyfish Undersea World Wall Stickers Waterproof PVC Bathtub Decor Removable Ocean Marine Life DIY Adhesive Decals
Cartoon Whale Jellyfish Undersea World Wall Stickers Waterproof PVC Bathtub Decor Removable Ocean Marine Life DIY Adhesive Decals
like
Find Similar
Cartoon whale and jellyfish ocean world wall decal set with hand-drawn sea animal illustrations - 30x90cm
Cartoon Whale Jellyfish Undersea World Wall Stickers Waterproof PVC Bathtub Decor Removable Ocean Marine Life DIY Adhesive Decals
$2.02
Mix MOQ : 4
Pink Rose Flower Wooden Fence Butterfly Watercolor Wall Stickers PVC Self-Adhesive Wall Decal For Living Room Bedroom Home Decor
Pink Rose Flower Wooden Fence Butterfly Watercolor Wall Stickers PVC Self-Adhesive Wall Decal For Living Room Bedroom Home Decor
like
Find Similar
Pink rose and butterfly wall sticker with dimensions for home decor layout - Fence Flower (SC405) / 40x60
NewPink Rose Flower Wooden Fence Butterfly Watercolor Wall Stickers PVC Self-Adhesive Wall Decal For Living Room Bedroom Home Decor
$1.50
Mix MOQ : 4
Laundry Room Wall Sticker Cartoon Dog Bubbles PVC Removable Black Art Lettering Decal For Laundry Room Home Decor
Laundry Room Wall Sticker Cartoon Dog Bubbles PVC Removable Black Art Lettering Decal For Laundry Room Home Decor
like
Find Similar
Cartoon dog laundry room wall sticker with bones and lettering in black PVC design - Dog Bubbles (ZB710)
Laundry Room Wall Sticker Cartoon Dog Bubbles PVC Removable Black Art Lettering Decal For Laundry Room Home Decor
$1.21
Mix MOQ : 4
Modern PVC Female Silhouette Wall Sticker Artistic Body Line Self Adhesive Removable Decal For Living Room Bedroom Decor
Modern PVC Female Silhouette Wall Sticker Artistic Body Line Self Adhesive Removable Decal For Living Room Bedroom Decor
like
Find Similar
Black female silhouette wall decal showing layout and 27x21cm pasted effect - SC533-25x30-Beauty Silhouette
Modern PVC Female Silhouette Wall Sticker Artistic Body Line Self Adhesive Removable Decal For Living Room Bedroom Decor
$0.92
Mix MOQ : 4
Motivational Quote Wall Decal Life Is Not About Waiting For The Storm To Pass Butterfly Star Wall Stickers For Room Decor
Motivational Quote Wall Decal Life Is Not About Waiting For The Storm To Pass Butterfly Star Wall Stickers For Room Decor
like
Find Similar
Black heart-shaped butterfly quote wall sticker with inspirational dance in the rain text - Heart Butterfly Motivational Quote
NewMotivational Quote Wall Decal Life Is Not About Waiting For The Storm To Pass Butterfly Star Wall Stickers For Room Decor
$1.44
Mix MOQ : 4
Mermaid Tail Wall Decal Gradient Pink Purple Blue Gold Glitter Fish Scale PVC Waterproof Sticker For Kids Room Decor
Mermaid Tail Wall Decal Gradient Pink Purple Blue Gold Glitter Fish Scale PVC Waterproof Sticker For Kids Room Decor
like
Find Similar
Waterproof PVC mermaid tail wall stickers for home decor in blue and purple watercolor - 30x45cm
Mermaid Tail Wall Decal Gradient Pink Purple Blue Gold Glitter Fish Scale PVC Waterproof Sticker For Kids Room Decor
$1.04
Mix MOQ : 4
Tropical Parrot Monstera Leaves Wall Sticker Watercolor Flower Self Adhesive PVC Wall Decal For Living Room Home Decor
Tropical Parrot Monstera Leaves Wall Sticker Watercolor Flower Self Adhesive PVC Wall Decal For Living Room Home Decor
like
Find Similar
Colorful macaws and tropical leaves self-adhesive PVC wall decal in 40x30cm layout size - Bird & Green Leaves (SC195) / 30x40cm
Tropical Parrot Monstera Leaves Wall Sticker Watercolor Flower Self Adhesive PVC Wall Decal For Living Room Home Decor
$1.04
Mix MOQ : 4
3D Cosmic Galaxy Nebula Wall Sticker Creative Broken Wall Visual Toilet Decal Removable PVC Decal For Kids Room Home Decor
3D Cosmic Galaxy Nebula Wall Sticker Creative Broken Wall Visual Toilet Decal Removable PVC Decal For Kids Room Home Decor
like
Find Similar
3D nebula galaxy wall stickers with 27cm paste effect and layout for kids room - Starry Galaxy (SC185)
3D Cosmic Galaxy Nebula Wall Sticker Creative Broken Wall Visual Toilet Decal Removable PVC Decal For Kids Room Home Decor
$0.75
Mix MOQ : 4
Watercolor Mother And Child Silhouette Wall Sticker Colorful Bubbles Self-Adhesive PVC Decal For Home Bedroom Decor
Watercolor Mother And Child Silhouette Wall Sticker Colorful Bubbles Self-Adhesive PVC Decal For Home Bedroom Decor
like
Find Similar
Self-adhesive wall sticker featuring a colorful mother and child silhouette for home decor - Mother And Daughter Silhouette Style (ZB538) / Single Sheet
NewWatercolor Mother And Child Silhouette Wall Sticker Colorful Bubbles Self-Adhesive PVC Decal For Home Bedroom Decor
$1.21
Mix MOQ : 4
Cute Cartoon Monkey Blue Flowers Wall Sticker PVC Removable Watercolor Animal Wallpaper For Kids Room Nursery Bedroom Decor
Cute Cartoon Monkey Blue Flowers Wall Sticker PVC Removable Watercolor Animal Wallpaper For Kids Room Nursery Bedroom Decor
like
Find Similar
Cartoon blue monkey wall stickers for bedroom with floral accents and butterfly decals - Blue Monkey and Flowers (ZC663)
Cute Cartoon Monkey Blue Flowers Wall Sticker PVC Removable Watercolor Animal Wallpaper For Kids Room Nursery Bedroom Decor
$1.21
Mix MOQ : 4
Pastoral Sunflower Wall Sticker With White Fence And Butterflies Watercolor Style PVC Removable Self Adhesive Home Mural
Pastoral Sunflower Wall Sticker With White Fence And Butterflies Watercolor Style PVC Removable Self Adhesive Home Mural
like
Find Similar
Self-adhesive sunflower wall stickers with white fence and butterflies for home decor - Sunflower Fence Style (ZB540)
Pastoral Sunflower Wall Sticker With White Fence And Butterflies Watercolor Style PVC Removable Self Adhesive Home Mural
$1.79
Mix MOQ : 4
Watercolor Flower Fairy Butterfly Wall Sticker Removable PVC Aesthetic Fairy Floral Wall Decals For Bedroom Living Room Decor
Watercolor Flower Fairy Butterfly Wall Sticker Removable PVC Aesthetic Fairy Floral Wall Decals For Bedroom Living Room Decor
like
Find Similar
Fairy and butterfly wall sticker set for home decor with 35x35cm paste effect size - Flower Fairy (ZC677/30x30cm)
Watercolor Flower Fairy Butterfly Wall Sticker Removable PVC Aesthetic Fairy Floral Wall Decals For Bedroom Living Room Decor
$1.04
Mix MOQ : 4
Red Rose Butterfly Wall Sticker Romantic Floral PVC Waterproof Decal For Valentine's Day Bedroom Living Room Home Decor
Red Rose Butterfly Wall Sticker Romantic Floral PVC Waterproof Decal For Valentine's Day Bedroom Living Room Home Decor
like
Find Similar
Red roses and butterflies wall stickers set for bedroom home decor layout and size - Red Rose Butterfly Style (ZB622)
Red Rose Butterfly Wall Sticker Romantic Floral PVC Waterproof Decal For Valentine's Day Bedroom Living Room Home Decor
$1.38
Mix MOQ : 4
Artistic Leopard Cub Wall Sticker Blue Watercolor Flowers And Butterflies Waterproof Removable PVC Decal For Home Decor
Artistic Leopard Cub Wall Sticker Blue Watercolor Flowers And Butterflies Waterproof Removable PVC Decal For Home Decor
like
Find Similar
Cartoon tiger wall sticker with blue flowers showing paste effect and layout dimensions - 30x30cm (1 Sheet)
Artistic Leopard Cub Wall Sticker Blue Watercolor Flowers And Butterflies Waterproof Removable PVC Decal For Home Decor
$0.92
Mix MOQ : 4
3D Waterfall Rainforest Broken Wall Sticker Waterproof PVC Self-Adhesive Removable Landscape Wall Decal Home Decor
3D Waterfall Rainforest Broken Wall Sticker Waterproof PVC Self-Adhesive Removable Landscape Wall Decal Home Decor
like
Find Similar
3D broken wall waterfall sticker for home decor with 27x27cm finished size - SC184 30x30
New3D Waterfall Rainforest Broken Wall Sticker Waterproof PVC Self-Adhesive Removable Landscape Wall Decal Home Decor
$0.75
Mix MOQ : 4
Green Butterfly Lotus Pond Wall Stickers Removable PVC Nature Landscape Decals For Living Room Bedroom Home Decoration
Green Butterfly Lotus Pond Wall Stickers Removable PVC Nature Landscape Decals For Living Room Bedroom Home Decoration
like
Find Similar
Green butterflies and water lily self-adhesive wall stickers for living room decor - PB501/30*40cm
Green Butterfly Lotus Pond Wall Stickers Removable PVC Nature Landscape Decals For Living Room Bedroom Home Decoration
$0.81
Mix MOQ : 4
3D Realistic T-Rex Breaking Wall Sticker Removable PVC Decorative Mural For Kids Room Bedroom Living Room Toilet Home Decor
3D Realistic T-Rex Breaking Wall Sticker Removable PVC Decorative Mural For Kids Room Bedroom Living Room Toilet Home Decor
like
Find Similar
3D dinosaur wall sticker with T-Rex breaking through wall for living room decor - SC182 Style 30x30
3D Realistic T-Rex Breaking Wall Sticker Removable PVC Decorative Mural For Kids Room Bedroom Living Room Toilet Home Decor
$0.92
Mix MOQ : 4
Blue Wisteria Flower Butterfly Wall Stickers PVC Removable Self Adhesive Floral Wall Decals For Living Room Bedroom Home Decor
Blue Wisteria Flower Butterfly Wall Stickers PVC Removable Self Adhesive Floral Wall Decals For Living Room Bedroom Home Decor
like
Find Similar
Blue wisteria flowers and green leaves self-adhesive PVC wall decal set for home decor - Blue Wisteria Style (PC592) / Two Sheets
Blue Wisteria Flower Butterfly Wall Stickers PVC Removable Self Adhesive Floral Wall Decals For Living Room Bedroom Home Decor
$2.02
Mix MOQ : 4
Go to

More in home & kitchen

Explore more in bedding & bathroom

homecolorholdertravelstylepolyesterdoubleheaddesignheart
hangingplasticstorageshapecleaningsimplekidslayerwhitedaily

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access