Everful

Wholesale bedding & bathroom

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Bedding & Bathroom

Find the perfect pieces: wall stickers, window stickers, kitchen stickers and more

Popular collections in bedding & bathroom

All products in bedding & bathroom

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Waterproof EVA Toilet Seat Cover Mat With Handle Thickened Padded Cushion Washable Bathroom Accessory Universal Fit Comfort
Waterproof EVA Toilet Seat Cover Mat With Handle Thickened Padded Cushion Washable Bathroom Accessory Universal Fit Comfort
like
Find Similar
Waterproof EVA toilet seat cushion in light green with handle for easy lifting - U-shaped with Handle / Avocado Green
Gray knitted waterproof toilet seat cover with handle for modern bathroom decor - U-shaped with Handle / Silver Gray
Pink waterproof EVA toilet seat cover with built-in handle and thick foam padding - U-shaped with Handle / Peach Pink
Thick beige EVA waterproof toilet seat cover with handle and anti-slip texture - U-shaped with Handle / Sunflower Yellow
Waterproof EVA Toilet Seat Cover Mat With Handle Thickened Padded Cushion Washable Bathroom Accessory Universal Fit Comfort
$0.72
Mix MOQ : 2
 · 
14 views
Microfiber Cartoon Printed Beach Towel Quick Dry Sand Proof Large Bath Towel For Swimming Pool Yoga Travel Summer Seaside
Microfiber Cartoon Printed Beach Towel Quick Dry Sand Proof Large Bath Towel For Swimming Pool Yoga Travel Summer Seaside
like
Find Similar
Microfiber beach towel with cartoon bears illustration and Chinese typography design - Beach Umbrella Bear (STJ003-1)
Cute cartoon bear and floral print microfiber beach towel with pastel macaron colors - Floral Bear (STJ003-2)
Floral and fruit print beach towel featuring Happy Today text on a cream background - Happy Fruit (STJ003-3)
Pink checkered beach towel with cute cartoon rabbit and strawberry prints for vacation - Pink Plaid Bunny (STJ003-4)
+14
Microfiber Cartoon Printed Beach Towel Quick Dry Sand Proof Large Bath Towel For Swimming Pool Yoga Travel Summer Seaside
$4.67
Mix MOQ : 2
Tropical Gradient Microfiber Beach Towel Palm Leaf Printed Fast Drying Oversized Bath Towel For Summer Swim Travel Pool
Tropical Gradient Microfiber Beach Towel Palm Leaf Printed Fast Drying Oversized Bath Towel For Summer Swim Travel Pool
like
Find Similar
Microfiber beach towel with sunset gradient and white tropical palm leaves hanging by the sea - 70x150cm / Multicolor Palm Leaf
Tropical Gradient Microfiber Beach Towel Palm Leaf Printed Fast Drying Oversized Bath Towel For Summer Swim Travel Pool
-5%
$2.60
No MOQ
 · 
11 views
Waterproof Shower Cap Double Layer Satin PEVA Elastic Reusable Bath Hair Cover For Women
Waterproof Shower Cap Double Layer Satin PEVA Elastic Reusable Bath Hair Cover For Women
like
Find Similar
Rainbow satin waterproof shower cap with white stars and elastic pink ruffle trim - Rainbow Star
Close-up of rainbow satin shower cap with elastic pink ruffle edge on female model - Rainbow
Double-layer satin waterproof shower cap for women with brown stripes and yellow ruffle - Coffee Stripes
Waterproof double-layer satin shower cap with flamingo print and pink ruffle edge - Flamingo
+13
Waterproof Shower Cap Double Layer Satin PEVA Elastic Reusable Bath Hair Cover For Women
$1.30
Mix MOQ : 3
 · 
36 sold recently
Pure Cotton Face Towels Thickened Highly Absorbent Antibacterial Soft Long Staple Fabric Bathroom Home Washcloths
Pure Cotton Face Towels Thickened Highly Absorbent Antibacterial Soft Long Staple Fabric Bathroom Home Washcloths
like
Find Similar
Soft pink cotton face towel with absorbent loops and decorative satin border stripes - 33*73CM / Pink
Close-up of thick beige long-staple cotton towel neatly folded on a minimalist tabletop - 33*73CM / Off White
Minimalist grey premium Xinjiang cotton towel folded on a tray in a home setting - 33*73CM / Gray
Thick light blue long-staple cotton towel with textured loops on a white tray - 33*73CM / Light Blue
Pure Cotton Face Towels Thickened Highly Absorbent Antibacterial Soft Long Staple Fabric Bathroom Home Washcloths
$2.85
No MOQ
 · 
134 views
Waterproof Shower Curtain Thickened Polyester Fabric Mandala Bohemian Pattern Retro Style Metal Grommets Bathroom
Waterproof Shower Curtain Thickened Polyester Fabric Mandala Bohemian Pattern Retro Style Metal Grommets Bathroom
like
Find Similar
Thickened polyester shower curtain with bohemian mandala patterns in teal and brown - 80W*180H cm
Thick waterproof polyester shower curtain with vintage mandala geometric patterns - 80W*200H cm
Thick paisley polyester shower curtain featuring advanced waterproof lotus leaf water droplets - 100W*180H cm
Waterproof polyester shower curtain featuring vintage brown and blue mandala floral patterns - 120W*180H cm
+16
Waterproof Shower Curtain Thickened Polyester Fabric Mandala Bohemian Pattern Retro Style Metal Grommets Bathroom
$4.76-11.82
No MOQ
 · 
12 sold recently
Waterproof Polyester Shower Curtain Hookless Big Ring Snap In Liner Double Layer Mesh Top Waffle Weave Floral Pattern
Waterproof Polyester Shower Curtain Hookless Big Ring Snap In Liner Double Layer Mesh Top Waffle Weave Floral Pattern
like
Find Similar
Waterproof bathroom shower curtain with ink wash koi fish design in a modern bathroom - Ink Koi Fish (26SYL-1)
Detail of waterproof shower curtain with artistic butterfly print and rust-proof metal grommets - Stained Glass Butterfly (26SYL-2)
Detail of waterproof shower curtain featuring blue swirls and pink rose floral patterns - Abstract Heart Rose (26SYL-3)
Waterproof Polyester Shower Curtain Hookless Big Ring Snap In Liner Double Layer Mesh Top Waffle Weave Floral Pattern
-4%
$13.14
Mix MOQ : 10
Cartoon Animal Bath Mat Flocking Absorbent Non-Slip Bathroom Floor Rug Soft Machine Washable Decor
Cartoon Animal Bath Mat Flocking Absorbent Non-Slip Bathroom Floor Rug Soft Machine Washable Decor
like
Find Similar
Absorbent blue microfiber bath mat featuring a cute cartoon Shiba Inu dog pattern - 50*80cm / Akita
Absorbent grey bathroom mat featuring a cute cartoon orange cat on soft flocked fabric - 50*80cm / Silly Cat
Cartoon animal flocked bathroom mat in gray with bear and frog non-slip texture - 50*80cm / Happy Friends
Blue flocking bathroom mat with pink rabbit and brown bear, featuring HOME text - 50*80cm / Bear and Rabbit
+74
Cartoon Animal Bath Mat Flocking Absorbent Non-Slip Bathroom Floor Rug Soft Machine Washable Decor
-16%
$7.46-21.87
Mix MOQ : 3
 · 
23 views
Non Slip Bathroom Rug Bath Mat Flocked Polyester Water Absorbent Thick Plush Carpet For Shower Door Machine Washable Cute Rainbow Floral Leaf Design
Non Slip Bathroom Rug Bath Mat Flocked Polyester Water Absorbent Thick Plush Carpet For Shower Door Machine Washable Cute Rainbow Floral Leaf Design
like
Find Similar
Plush bath mat with gray, green, and yellow geometric smile design for bathroom use - 50*80cm / Four-Colored Stones
Close-up of fluffy rainbow bath mat texture in a cozy bathroom setting - 50*80cm / Over The Rainbow
Non-slip rectangular bathroom mat with multi-color leaf pattern on off-white base - 50*80cm / Dancing Leaves
Grey rectangular plush bathroom rug with white bathtub motif and BATHROOM text - 50*80cm / Bathing
+71
Non Slip Bathroom Rug Bath Mat Flocked Polyester Water Absorbent Thick Plush Carpet For Shower Door Machine Washable Cute Rainbow Floral Leaf Design
-23%
$7.46-10.35
Mix MOQ : 2
 · 
19 views
Red Bathroom Hand Towel Bamboo Fiber And Cotton Jacquard Wave Pattern Soft Absorbent Wedding Party Gift For Couples
Red Bathroom Hand Towel Bamboo Fiber And Cotton Jacquard Wave Pattern Soft Absorbent Wedding Party Gift For Couples
like
Find Similar
Red bamboo fiber wedding towel with elegant wave pattern texture on flat packaging - Bamboo Wide Satin Red / 35*75cm
Red festive towel with golden silk stripes for weddings made of absorbent bamboo fiber - Gold Border Large Red / 35*75cm
Three premium red bamboo fiber towels with wavy textures and elegant satin stripes - Red Wave Style / 35*75cm
Red Bathroom Hand Towel Bamboo Fiber And Cotton Jacquard Wave Pattern Soft Absorbent Wedding Party Gift For Couples
-4%
$1.37
Mix MOQ : 2
 · 
46 views
Waterproof Polyester Shower Curtain Detachable Liner Waffle Texture Hookless Ring Animal Cat Leopard Bathroom Decor
Waterproof Polyester Shower Curtain Detachable Liner Waffle Texture Hookless Ring Animal Cat Leopard Bathroom Decor
like
Find Similar
Waterproof double-layer shower curtain with leopard in bathtub and tropical plants pattern - 181x188cm Single Shower Curtain / Leopard SPA (SYL-1)
Detail of waterproof shower curtain with funny cats in a bathtub and tropical plants - 181x188cm Single Shower Curtain / Cat Bath A (SYL-2)
Detail of waterproof bath curtain featuring three cats in a tub with lush green plants - 181x188cm Single Shower Curtain / Cat Bath B (SYL-3)
+3
Waterproof Polyester Shower Curtain Detachable Liner Waffle Texture Hookless Ring Animal Cat Leopard Bathroom Decor
$13.83-19.60
Mix MOQ : 10
Flower Shaped Absorbent Non-Slip Bathroom Mat Oil Painting Tulip Design Quick Drying Aesthetic Floor Rug For Shower Entryway
Flower Shaped Absorbent Non-Slip Bathroom Mat Oil Painting Tulip Design Quick Drying Aesthetic Floor Rug For Shower Entryway
like
Find Similar
Oil painting style yellow and white flower shaped absorbent non-slip bath mat for bathroom - 40*60cm Absorbent Leather / Orange Yellow Large Flower
Irregular oil painting flower bath mat in red with FANCY text and non-slip backing - 40*60cm Absorbent Leather / Cinnabar Red Large Flower
Green and cream oil painting style flower shaped bath mat with plush texture - 40*60cm Absorbent Leather / Emerald Green White Large Flower
Black and cream floral bath mat in oil painting style with Have a Nice Day text - 40*60cm Absorbent Leather / Black Large Flower
+183
Flower Shaped Absorbent Non-Slip Bathroom Mat Oil Painting Tulip Design Quick Drying Aesthetic Floor Rug For Shower Entryway
-12%
$0.96-6.03
No MOQ
 · 
46 views
Microfiber Cartoon Turtle Beach Towel For Summer Resort Absorbent Quick Dry Bath Towel With Floral Wreath Turtle Pattern Soft Wrap
Microfiber Cartoon Turtle Beach Towel For Summer Resort Absorbent Quick Dry Bath Towel With Floral Wreath Turtle Pattern Soft Wrap
like
Find Similar
Microfiber beach towel with cartoon turtle print hanging on a sunny tropical beach - Standard Size / Cartoon Turtle with Straw Hat
Microfiber Cartoon Turtle Beach Towel For Summer Resort Absorbent Quick Dry Bath Towel With Floral Wreath Turtle Pattern Soft Wrap
$2.74
No MOQ
Polyester Waterproof Shower Curtain And Bath Mat 3D Floral Pattern Hookless With Mesh Window Magnetic Bottom Bathroom
Polyester Waterproof Shower Curtain And Bath Mat 3D Floral Pattern Hookless With Mesh Window Magnetic Bottom Bathroom
like
Find Similar
Waterproof shower curtain with 3D floral pattern and mesh top for bathroom decor - 181x188cm Single Curtain / Yellow Floral (26SYL-1)
Close-up of double-layer shower curtain featuring red tulip floral print and white rings - 181x188cm Single Curtain / Red Tulip (26SYL-2)
Detail of waterproof white shower curtain with vibrant red and white tulip floral print - 181x188cm Single Curtain / Red & White Floral (26SYL-3)
+3
NewPolyester Waterproof Shower Curtain And Bath Mat 3D Floral Pattern Hookless With Mesh Window Magnetic Bottom Bathroom
$13.83-19.60
Mix MOQ : 10
Cotton Striped Face Towel Highly Absorbent Soft Thickened Bathroom Washcloth For Adults Quick Dry
Cotton Striped Face Towel Highly Absorbent Soft Thickened Bathroom Washcloth For Adults Quick Dry
like
Find Similar
Thick cotton striped towel in yellow, white and green, soft absorbent face cloth - 34*76cm / Yellow Orchid
Thick blue and teal striped cotton towel folded on a geometric white platform pedestal - 34*76cm / Deep and Light Blue
Thick cotton face towel with blue and yellow stripes, soft and absorbent texture - 34*76cm / Light Blue
Thick cotton striped towel in green, white, and gray, soft and absorbent texture - 34*76cm / Grass Green
+5
Cotton Striped Face Towel Highly Absorbent Soft Thickened Bathroom Washcloth For Adults Quick Dry
-17%
$1.70
No MOQ
 · 
31 views
Hookless Shower Curtain Polyester Waffle Fabric Waterproof Removable Liner Mesh Window Top Magnetic Bottom Abstract Art
Hookless Shower Curtain Polyester Waffle Fabric Waterproof Removable Liner Mesh Window Top Magnetic Bottom Abstract Art
like
Find Similar
Waterproof shower curtain with snow scene, roses, and birds featuring Life is Love text - Winter Snow Heart Dove / 181x188cm Single Shower Curtain
Close-up of abstract floral bird print shower curtain with metal grommets and rings - Abstract Fluid Art / 181x188cm Single Shower Curtain
Stained glass style waffle shower curtain with celestial moon and star print art - Stained Glass Moon Star / 181x188cm Single Shower Curtain
+3
Hookless Shower Curtain Polyester Waffle Fabric Waterproof Removable Liner Mesh Window Top Magnetic Bottom Abstract Art
-5%
$13.14-18.62
Mix MOQ : 10
Tropical Round Microfiber Beach Towel With Tassel Fringe Absorbent Quick Dry Mandala Floral Bath Towel For Picnic Vacation
Tropical Round Microfiber Beach Towel With Tassel Fringe Absorbent Quick Dry Mandala Floral Bath Towel For Picnic Vacation
like
Find Similar
Thick round beach towel with tropical floral pattern and white tassel fringe on wood deck - Fresh Light Blue Floral Style (1)
Thick round beach towel with tropical floral pattern and white tassel trim on wood floor - Tropical Floral Palm Style (2)
Thick round beach towel with tropical pelican and flower print with white tassels - Tropical Pelican Style (3)
Round thick beach towel with tropical floral print, blue palm leaves and white tassels - Pink Orchid Palm Style (4)
+8
Tropical Round Microfiber Beach Towel With Tassel Fringe Absorbent Quick Dry Mandala Floral Bath Towel For Picnic Vacation
-4%
$8.08
No MOQ
Microfiber Beach Towel Watercolor Marine Life Whale Octopus Print Quick Dry Absorbent Large Bath Towel For Swimming Outdoor Yoga
Microfiber Beach Towel Watercolor Marine Life Whale Octopus Print Quick Dry Absorbent Large Bath Towel For Swimming Outdoor Yoga
like
Find Similar
Microfiber beach towel featuring blue octopus and whale print on a wooden sand chair - 70x150cm / Watercolor Ocean
Microfiber Beach Towel Watercolor Marine Life Whale Octopus Print Quick Dry Absorbent Large Bath Towel For Swimming Outdoor Yoga
-5%
$2.60
No MOQ
Flower Bath Mat Absorbent Flocking Microfiber Non-Slip Bathroom Rug Cute Floral Shaped Floor Carpet Washable Decor
Flower Bath Mat Absorbent Flocking Microfiber Non-Slip Bathroom Rug Cute Floral Shaped Floor Carpet Washable Decor
like
Find Similar
Absorbent floral bathroom rug with blue and green flower design and non-slip backing - 40x60cm / Spring Blossoms
Colorful floral flocked bathroom mat with anti-slip backing and soft plush texture - 40x60cm / Secret Garden
Flower Bath Mat Absorbent Flocking Microfiber Non-Slip Bathroom Rug Cute Floral Shaped Floor Carpet Washable Decor
-5%
$6.02-9.31
Mix MOQ : 2
Shower Curtain Waterproof Polyester Fabric Layered Grommet Top Waffle Weave Floral Print Magnetic Bottom Mesh Window
Shower Curtain Waterproof Polyester Fabric Layered Grommet Top Waffle Weave Floral Print Magnetic Bottom Mesh Window
like
Find Similar
Waterproof double layer shower curtain with purple rose floral pattern and metal grommets - 181x188cm / Dark Purple Rose
Detail view of floral digital print shower curtain with reinforced metal grommets - 181x188cm / Pink Rose
Detailed view of yellow mimosa print on dual-layer waterproof floral bath curtain - 181x188cm / Yellow Mimosa Floral
Shower Curtain Waterproof Polyester Fabric Layered Grommet Top Waffle Weave Floral Print Magnetic Bottom Mesh Window
$13.83
Mix MOQ : 10
Waterproof Polyester Shower Curtain William Morris Golden Lily Vintage Floral Art Bathroom Decor Weighted Hem
Waterproof Polyester Shower Curtain William Morris Golden Lily Vintage Floral Art Bathroom Decor Weighted Hem
like
Find Similar
William Morris Golden Lily floral shower curtain in modern marble bathroom setting - 200x200cm / 160g/㎡
+21
Waterproof Polyester Shower Curtain William Morris Golden Lily Vintage Floral Art Bathroom Decor Weighted Hem
-5%
$5.20-12.59
No MOQ
 · 
46 views
Non-Slip Bathroom Mat Absorbent Thickened Flocking Bath Rug Nordic Geometric Rectangular Floor Mat For Bathroom Bedroom
Non-Slip Bathroom Mat Absorbent Thickened Flocking Bath Rug Nordic Geometric Rectangular Floor Mat For Bathroom Bedroom
like
Find Similar
Absorbent non-slip bathroom mat with gray and white plush rectangular frame design - Small / Light Gray
Plush non-slip bathroom mat with grey border and soft cream center for home decor - Small / Dark Gray
Navy blue and white rectangular flocked bathroom mat with soft absorbent texture - Small / Navy Blue
Modern black and white flocked bathroom rug with absorbent fibers near white bathtub - Small / Black
+24
Non-Slip Bathroom Mat Absorbent Thickened Flocking Bath Rug Nordic Geometric Rectangular Floor Mat For Bathroom Bedroom
$5.19-13.83
No MOQ
Absorbent Diatom Mud Bathroom Floor Mat Non-slip Fast Dry Entryway Door Mat Cartoon Floral Abstract Rug For Home Kitchen Bath
Absorbent Diatom Mud Bathroom Floor Mat Non-slip Fast Dry Entryway Door Mat Cartoon Floral Abstract Rug For Home Kitchen Bath
like
Find Similar
Detail of bohemian mandala diatom mud mat on light wood floor by a French door - 40x60cm (Diatomaceous Mud) / Paisley Pattern
Detail of diatom mud floor mat with colorful chevron pattern on wood floor - Colorful Wooden Wall / 40x60cm (Diatomite)
Absorbent diatom mud mat with colorful floral pattern for entryway and bathroom floor - Colorful Art Flowers / 40x60cm (Diatomite)
Artistic oil painting style diatom mud mat with colorful giraffes on light wood floor - Multicolor Giraffe / 40x60cm (Diatomite)
+236
Absorbent Diatom Mud Bathroom Floor Mat Non-slip Fast Dry Entryway Door Mat Cartoon Floral Abstract Rug For Home Kitchen Bath
-5%
$0.79-4.48
No MOQ
Fruit Shaped Bath Mat Plush Absorbent Non-Slip TPR Bottom Bathroom Entrance Cute Watermelon Lemon Orange Soft Rug
Fruit Shaped Bath Mat Plush Absorbent Non-Slip TPR Bottom Bathroom Entrance Cute Watermelon Lemon Orange Soft Rug
like
Find Similar
Semicircular peach-shaped pink plush bath mat with Peachy Clean text and green leaves - 55*63cm / Peach Shape
Semi-circle lemon shaped yellow tufted bath mat with Squeeze the Day slogan design - 46*76cm / Lemon
Semicircle lemon fruit bath mat with Sweet Home text in soft yellow plush fabric - 45*75cm / Sweet Lemon
Red apple shaped bathroom mat with white plush Happy Time text on tiled floor - 50*60cm / Happy Apple
+26
Fruit Shaped Bath Mat Plush Absorbent Non-Slip TPR Bottom Bathroom Entrance Cute Watermelon Lemon Orange Soft Rug
$8.01-18.44
Mix MOQ : 2
 · 
19 views
Round Beach Towel Microfiber Quick Dry Floral Printed Tassel Fringe Oversized Bath Towel For Swimming Pool Yoga Picnic
Round Beach Towel Microfiber Quick Dry Floral Printed Tassel Fringe Oversized Bath Towel For Swimming Pool Yoga Picnic
like
Find Similar
Round beach towel with floral hydrangea print and white tassels on wood deck pool background - Hydrangea Pattern (1)
Round beach towel with rose floral print and white tassels on a pool deck setting - Rose Floral Pattern (2)
Round beach towel with red floral patterns and white tassels on a wooden deck by pool - Red Berry Green Leaf Pattern (3)
Round quick-dry beach towel with red floral pattern and white tassel fringe by the pool - Impressionist Red Floral Pattern (4)
+5
Round Beach Towel Microfiber Quick Dry Floral Printed Tassel Fringe Oversized Bath Towel For Swimming Pool Yoga Picnic
$8.50
No MOQ
Starfish Paradise Microfiber Beach Towel Tropical Hibiscus Floral Printed Quick Dry Large Bath Towel For Swimming Travel Vacation
Starfish Paradise Microfiber Beach Towel Tropical Hibiscus Floral Printed Quick Dry Large Bath Towel For Swimming Travel Vacation
like
Find Similar
Close-up of microfiber beach towel featuring red starfish and tropical paradise print - Standard Size / Red Starfish
Starfish Paradise Microfiber Beach Towel Tropical Hibiscus Floral Printed Quick Dry Large Bath Towel For Swimming Travel Vacation
-5%
$2.60
No MOQ
Shower Curtain Waterproof Polyester Waffle Fabric Hookless Large Ring Detachable Liner Mesh Top Bottom Magnets Floral
Shower Curtain Waterproof Polyester Waffle Fabric Hookless Large Ring Detachable Liner Mesh Top Bottom Magnets Floral
like
Find Similar
Waterproof digital print bath curtain with glowing blue flowers and metal hooks - Blue Fantasy Floral / 181x188cm Single Shower Curtain
Detail of waterproof waffle shower curtain with floral print and silver metal grommets - Red and White Artistic Floral / 181x188cm Single Shower Curtain
Waterproof polyester shower curtain featuring luxury rose floral print and gold archway - Dreamy Rose Landscape / 181x188cm Single Shower Curtain
+3
NewShower Curtain Waterproof Polyester Waffle Fabric Hookless Large Ring Detachable Liner Mesh Top Bottom Magnets Floral
-5%
$13.14-18.62
Mix MOQ : 10
Halloween Autumn Shower Curtain And Floor Mat Detachable Liner Waffle Polyester Waterproof Hookless Mesh Window Pattern
Halloween Autumn Shower Curtain And Floor Mat Detachable Liner Waffle Polyester Waterproof Hookless Mesh Window Pattern
like
Find Similar
Waterproof shower curtain with autumn pink pumpkin and maple leaf patterns for bathroom - 181x188cm Single Shower Curtain / Pink Pumpkin (25SYL-1)
Detail of waterproof shower curtain featuring a gothic skull and sword fantasy artwork - 181x188cm Single Shower Curtain / Dark Skull Sword (25SYL-2)
Detail showing Halloween shower curtain with realistic skull, pumpkin and crow pattern - 181x188cm Single Shower Curtain / Skeleton Bathing (25SYL-3)
+3
Halloween Autumn Shower Curtain And Floor Mat Detachable Liner Waffle Polyester Waterproof Hookless Mesh Window Pattern
$13.83-19.60
Mix MOQ : 10
Cartoon Animal Bath Mat Super Absorbent Flocking Plush Floor Rug Non-Slip Quick Dry Washable For Bathroom Shower Doorway
Cartoon Animal Bath Mat Super Absorbent Flocking Plush Floor Rug Non-Slip Quick Dry Washable For Bathroom Shower Doorway
like
Find Similar
Absorbent bathroom rug with brown bear cartoon pattern on soft flocked surface - 40*60cm / Bubble Bear
Absorbent cartoon bathroom mat featuring a brown bear and sun in plush finish - 40*60cm / Sun Bear Cartoon
Cartoon bear bathroom mat in grey and brown, non-slip absorbent flocking rug - 40*60cm / Star
Absorbent bathroom mat featuring a cute cartoon brown bear design with soft tufted texture - 50*80cm / Bear Holding Flower
+27
Cartoon Animal Bath Mat Super Absorbent Flocking Plush Floor Rug Non-Slip Quick Dry Washable For Bathroom Shower Doorway
-23%
$7.46-10.35
Mix MOQ : 3
Christmas Toilet Lid Cover And U-Shaped Rug Non-woven Fabric Gnome Reindeer Print Festive Bathroom Holiday Decoration
Christmas Toilet Lid Cover And U-Shaped Rug Non-woven Fabric Gnome Reindeer Print Festive Bathroom Holiday Decoration
like
Find Similar
Christmas toilet seat cover and rug set with festive red dog and snowflake patterns - Red
Christmas toilet cover set with gnome and reindeer patterns on a grey fabric base - Gray
Christmas Toilet Lid Cover And U-Shaped Rug Non-woven Fabric Gnome Reindeer Print Festive Bathroom Holiday Decoration
$4.03
Mix MOQ : 2
Colorful Floral Diatom Mud Absorbent Non-slip Floor Mat For Bathroom Kitchen Entryway Flower Pattern Rectangular Door Mat
Colorful Floral Diatom Mud Absorbent Non-slip Floor Mat For Bathroom Kitchen Entryway Flower Pattern Rectangular Door Mat
like
Find Similar
Floral diatom mud laundry mat with colorful botanical pattern on black non-slip surface - 40*60cm / Diatom Mud Rubber Bottom / Colorful-1
Absorbent floral diatom mud mat with colorful sunflowers on black background - 40*60cm / Diatom Mud Rubber Bottom / Colorful-2
Absorbent floral diatom mud mat with colorful flower pattern for washer top and bathroom - 40*60cm / Diatom Mud Rubber Bottom / Colorful-3
Detail of colorful floral diatom mud mat with non-slip texture for laundry and bathroom - 40*60cm / Diatom Mud Rubber Bottom / Colorful-4
+36
Colorful Floral Diatom Mud Absorbent Non-slip Floor Mat For Bathroom Kitchen Entryway Flower Pattern Rectangular Door Mat
-4%
$0.79-6.06
No MOQ
Sea Turtle Print Microfiber Beach Towel Quick Dry Ultra Soft Ocean Pattern Bath Towel For Swimming Travel Blanket
Sea Turtle Print Microfiber Beach Towel Quick Dry Ultra Soft Ocean Pattern Bath Towel For Swimming Travel Blanket
like
Find Similar
Microfiber beach towel featuring turtle digital print on a sun lounger with ocean background - Standard Type / Ocean Sea Turtle
Sea Turtle Print Microfiber Beach Towel Quick Dry Ultra Soft Ocean Pattern Bath Towel For Swimming Travel Blanket
-5%
$2.60
No MOQ
Bathroom Mat Diatomaceous Earth Absorbent Fast Drying Non-Slip Rubber Bottom Cute Panda Pattern Irregular Shape
Bathroom Mat Diatomaceous Earth Absorbent Fast Drying Non-Slip Rubber Bottom Cute Panda Pattern Irregular Shape
like
Find Similar
Absorbent panda shaped bathroom mat with black and white stripes for home bath decor - Diatom Mud - Black and White Stripes / 40x60cm
Absorbent diatomite bath mat with panda design and irregular multi-circle shape - Diatom Mud - Grey Tuanzi / 40x60cm
Grey diatom mud bath mat with panda pattern and GO BATH text in a round design - Diatom Mud - Cat Circle - Light Grey / 40x60cm
Absorbent diatomite bath mat featuring a cute panda design and GO BATH text in black and white - Diatom Mud - Cat Circle - Tuanzi / 40x60cm
+87
Bathroom Mat Diatomaceous Earth Absorbent Fast Drying Non-Slip Rubber Bottom Cute Panda Pattern Irregular Shape
-5%
$4.60-18.40
No MOQ
Free Shipping
Cartoon Bear Hair Drying Cap Coral Fleece Super Absorbent Quick Dry Shower Wrap Turban Cute Animal For Women Kids
Cartoon Bear Hair Drying Cap Coral Fleece Super Absorbent Quick Dry Shower Wrap Turban Cute Animal For Women Kids
like
Find Similar
Absorbent microfiber hair drying towel cap featuring a blue cartoon bear design - Adult / Blue
Pink microfiber cartoon bear hair drying towel with cute ears and elastic band - Adult / Pink
Cartoon Bear Hair Drying Cap Coral Fleece Super Absorbent Quick Dry Shower Wrap Turban Cute Animal For Women Kids
$0.49-0.50
Mix MOQ : 3
 · 
90 sold recently
Waterproof Shower Curtain And Mat Polyester Snap-in Liner Hookless Grommet Mesh Top Weighted Bottom Magnets Art Patterns
Waterproof Shower Curtain And Mat Polyester Snap-in Liner Hookless Grommet Mesh Top Weighted Bottom Magnets Art Patterns
like
Find Similar
Detail view of artistic surrealist woman and celestial pattern on waterproof bath curtain - Mystical Surrealist Art (26SYL-1) / Single Shower Curtain (181x188cm)
Waterproof peacock garden shower curtain with durable metal grommets in stylish bathroom - Persian Peacock Garden (26SYL-2) / Single Shower Curtain (181x188cm)
Detailed view of waterproof floral shower curtain with landscape print and metal grommets - Zen Landscape Moon (26SYL-3) / Single Shower Curtain (181x188cm)
+3
Waterproof Shower Curtain And Mat Polyester Snap-in Liner Hookless Grommet Mesh Top Weighted Bottom Magnets Art Patterns
$13.83-19.60
Mix MOQ : 10
Shower Curtain Polyester Waterproof Washable Decorative Tree Of Life Magic Forest Art Print For Bathroom Home
Shower Curtain Polyester Waterproof Washable Decorative Tree Of Life Magic Forest Art Print For Bathroom Home
like
Find Similar
Waterproof polyester bath curtain featuring a decorative sun moon tree of life design - 90*180cm / Teal
Polyester shower curtain 180x180cm featuring aurora forest and butterfly digital print - 90*180cm / Green
Detail view of fantasy forest shower curtain measuring 180x180cm with floral patterns - 90*180cm / Olive Green
+15
NewShower Curtain Polyester Waterproof Washable Decorative Tree Of Life Magic Forest Art Print For Bathroom Home
$5.99-10.81
No MOQ
Semicircle Bath Mat Flocked Absorbent Non-Slip D-Shaped Floor Rug With TPR Bottom Home Letter Retro Style Bathroom
Semicircle Bath Mat Flocked Absorbent Non-Slip D-Shaped Floor Rug With TPR Bottom Home Letter Retro Style Bathroom
like
Find Similar
Semi-circular grey absorbent bathroom mat with home text on soft chenille fabric - 40x60cm / Vintage Grey
Semicircle bathroom rug with home text, thick grey plush absorbent bath mat for door - 40x60cm / Haze Blue
Semi-circular blue absorbent bathroom mat with home text on white marble floor - 40x60cm / Vintage Blue
Semicircle green tufted bath mat with home lettering and non-slip absorbent texture - 40x60cm / Vintage Green
+8
Semicircle Bath Mat Flocked Absorbent Non-Slip D-Shaped Floor Rug With TPR Bottom Home Letter Retro Style Bathroom
-5%
$4.93-8.21
No MOQ
Pure Cotton Christmas Towels Embroidered Santa Reindeer Holiday Gift Hand Towel Soft Absorbent Bathroom Decor
Pure Cotton Christmas Towels Embroidered Santa Reindeer Holiday Gift Hand Towel Soft Absorbent Bathroom Decor
like
Find Similar
White cotton children towel featuring a cute black cat embroidery on a plain background - Halloween Black Cat / White
White cotton towel featuring embroidered red and black spider web design for Halloween - Halloween Spider Web / White
Red festive cotton towel with Santa Claus embroidery and soft looped terry texture - Santa Claus / Red
White cotton Christmas towel with festive embroidered wreath and red bow detail - Christmas Wreath / White
+7
Pure Cotton Christmas Towels Embroidered Santa Reindeer Holiday Gift Hand Towel Soft Absorbent Bathroom Decor
$1.07-5.16
Mix MOQ : 2
 · 
49 views
Geometric Bathroom Mat Absorbent Non-Slip Plush Rug For Bathroom Entryway Machine Washable Soft Modern Abstract Design
Geometric Bathroom Mat Absorbent Non-Slip Plush Rug For Bathroom Entryway Machine Washable Soft Modern Abstract Design
like
Find Similar
Plush non-slip bath mat with wave pattern and blue accents on bathroom floor - 40x60cm / Green
Modern striped bath mat with geometric yellow accents on a luxury marble bathroom floor - 40x60cm / Yellow
Plush bathroom mat featuring geometric black and white stripes with a bold red accent block - 40x60cm / Red
Detailed plush rectangular bathroom mat featuring a minimalist blue and beige pattern - 40x60cm / Blue
+8
Geometric Bathroom Mat Absorbent Non-Slip Plush Rug For Bathroom Entryway Machine Washable Soft Modern Abstract Design
-5%
$4.60-7.67
No MOQ
Checkerboard Bath Mat Non-Slip Water Absorbent Flocked Plush Bathroom Rug For Bedroom Machine Washable Modern
Checkerboard Bath Mat Non-Slip Water Absorbent Flocked Plush Bathroom Rug For Bedroom Machine Washable Modern
like
Find Similar
Plush pink checkered bedside rug in soft fleece for modern bedroom and cozy home decor - Pink Blue Plaid (Flower Cluster) / 40x60cm
Checkerboard Bath Mat Non-Slip Water Absorbent Flocked Plush Bathroom Rug For Bedroom Machine Washable Modern
$5.48-9.22
No MOQ
Cute Cartoon Dog Hanging Hand Towel Absorbent Soft Coral Fleece Microfiber Towels For Kitchen Bathroom Decorative Hand Towels
Cute Cartoon Dog Hanging Hand Towel Absorbent Soft Coral Fleece Microfiber Towels For Kitchen Bathroom Decorative Hand Towels
like
Find Similar
Hanging corgi dog hand towel in soft microfiber fabric for cute bathroom decoration - Corgi Style
Hanging golden retriever dog hand towel made of absorbent microfiber with embroidery - Labrador Style
Cute corgi dog hanging hand towel made of soft microfiber absorbent fabric in beige - Golden Retriever Style
Cute Cartoon Dog Hanging Hand Towel Absorbent Soft Coral Fleece Microfiber Towels For Kitchen Bathroom Decorative Hand Towels
$4.12
No MOQ
Bathroom Rug Super Absorbent Ag+ Antibacterial Non-Slip TPR Bottom Soft Plush Microfiber For Shower Indoor Modern
Bathroom Rug Super Absorbent Ag+ Antibacterial Non-Slip TPR Bottom Soft Plush Microfiber For Shower Indoor Modern
like
Find Similar
Thick grey shaggy bathroom mat with high water absorption and non-slip backing - 50*80cm / Light Gray
Plush brown rectangular bathroom mat with thick absorbent pile for soft anti-slip comfort - 50*80cm / Brown
Thick white plush bathroom mat with high water absorption and non-slip backing - 50*80cm / White
Plush beige anti-slip bathroom mat with soft texture for home shower door entrance - 50*80cm / Deep Beige
+10
Bathroom Rug Super Absorbent Ag+ Antibacterial Non-Slip TPR Bottom Soft Plush Microfiber For Shower Indoor Modern
$6.02-13.23
Mix MOQ : 2
 · 
11 views
Waterproof Shower Curtain Polyester Waffle Weave 3D Digital Print Landscape Nature Cherry Blossom Decor Bathroom
Waterproof Shower Curtain Polyester Waffle Weave 3D Digital Print Landscape Nature Cherry Blossom Decor Bathroom
like
Find Similar
Waterproof double-layer polyester shower curtain featuring a blooming pink cherry blossom forest - Pink Cherry Blossom - Single Curtain / 181x188cm
Detail of 3D digital floral shower curtain with luxury chair print and white hanging rings - Classical Interior - Single Curtain / 181x188cm
Detail view of waterproof waffle shower curtain with digital landscape print and metal grommets - Mountain Landscape - Single Curtain / 181x188cm
+3
Waterproof Shower Curtain Polyester Waffle Weave 3D Digital Print Landscape Nature Cherry Blossom Decor Bathroom
$13.83-19.60
Mix MOQ : 10
Lamb Embroidery Bath Towel Coral Velvet Absorbent Soft Fleece Hand Towel Home Bathroom Cute Green
Lamb Embroidery Bath Towel Coral Velvet Absorbent Soft Fleece Hand Towel Home Bathroom Cute Green
like
Find Similar
Light green lamb embroidered bath towel set with soft coral fleece and white rope edge - Bath Towel 70*140 / Little Lamb (Grass Green)
Mint green lamb embroidered coral fleece bath towel set with decorative rope edges - Bath Towel 70*140 / Little Lamb (Mountain Green)
Lamb Embroidery Bath Towel Coral Velvet Absorbent Soft Fleece Hand Towel Home Bathroom Cute Green
-5%
$1.10-2.46
No MOQ
Absorbent Flocked Bath Mat Non-Slip Quick Dry Checkerboard Rug For Bathroom Bedroom Soft Plush Doormat
Absorbent Flocked Bath Mat Non-Slip Quick Dry Checkerboard Rug For Bathroom Bedroom Soft Plush Doormat
like
Find Similar
Blue and white checkered plush bathroom mat with pink dots and soft non-slip texture - 40x60cm / Blue
Plush green and cream checkered bathroom mat with pink dots on wooden floor - 40x60cm / Green
+6
Absorbent Flocked Bath Mat Non-Slip Quick Dry Checkerboard Rug For Bathroom Bedroom Soft Plush Doormat
$5.48-18.44
No MOQ
Disposable Bath Towel Face Towel Hair Cap Portable Travel Compressed Thickened Plant Fiber For Hotel Soft Quick Dry
Disposable Bath Towel Face Towel Hair Cap Portable Travel Compressed Thickened Plant Fiber For Hotel Soft Quick Dry
like
Find Similar
Portable disposable compressed bath towel 70x140cm in single individual travel pack - Large Compressed Bath Towel
Thickened disposable white cotton bath towel in single pack for travel, size 70x140cm - Solid Color Bath Towel
Disposable cotton face towels set of 2 in 30x60cm size for travel and hygiene use - Solid Color Towel
Thickened disposable bath towel 70x140cm with cute blue bear pattern for travel - Bear Printed Bath Towel
+4
Disposable Bath Towel Face Towel Hair Cap Portable Travel Compressed Thickened Plant Fiber For Hotel Soft Quick Dry
-5%
$0.18-0.68
No MOQ
 · 
50 sold recently
Shower Curtain Waterproof Polyester Waffle Fabric Snap In Liner Hookless Design Floral Abstract Pattern Bathroom Decor Floor Mat
Shower Curtain Waterproof Polyester Waffle Fabric Snap In Liner Hookless Design Floral Abstract Pattern Bathroom Decor Floor Mat
like
Find Similar
Waterproof double-layer floral shower curtain with black gold flower pattern and metal grommets - SYL-1 Black Gold Floral (Shower Curtain Only) / 181x188cm
Detail showing high-quality metal grommets and watercolor floral print on a white shower curtain - SYL-2 Watercolor Floral (Shower Curtain Only) / 181x188cm
Detail of waterproof bath curtain featuring metal eyelets and abstract floral pattern - SYL-3 Abstract Rose (Shower Curtain Only) / 181x188cm
+3
Shower Curtain Waterproof Polyester Waffle Fabric Snap In Liner Hookless Design Floral Abstract Pattern Bathroom Decor Floor Mat
$13.83-19.60
Mix MOQ : 10
Shower Curtain Polyester Waterproof Fabric Bathroom Decor Floral Butterfly Print Modern Minimalist With Hooks
Shower Curtain Polyester Waterproof Fabric Bathroom Decor Floral Butterfly Print Modern Minimalist With Hooks
like
Find Similar
Floral polyester shower curtain with purple flowers and water ripple reflection - 90*180CM Shower Curtain / Purple Butterfly Floral
Floral shower curtain with silver snowflake pendants and golden stars on cream background - 90*180CM Shower Curtain / Silver Snowflake Stars
Elegant 3D floral bath curtain with blue flowers and pearls in a modern bathroom setting - 90*180CM Shower Curtain / Light Blue Pearl Flower
Polyester shower curtain featuring 3D pink roses with gold edges in a modern bathroom - 90*180CM Shower Curtain / Soft Pink Gold Rose
+26
Shower Curtain Polyester Waterproof Fabric Bathroom Decor Floral Butterfly Print Modern Minimalist With Hooks
-4%
$6.17-9.73
No MOQ
Chenille Bath Mat Thickened Non-Slip Absorbent Rug For Bathroom Shower Bedroom Entrance Door Floor Soft Washable
Chenille Bath Mat Thickened Non-Slip Absorbent Rug For Bathroom Shower Bedroom Entrance Door Floor Soft Washable
like
Find Similar
Khaki chenille bath mat with soft absorbent shaggy texture on white marble floor - 50*80cm / Simple Time-Camel
Brown chenille bathroom floor mat with absorbent noodle texture on wood flooring - 50*80cm / Simple Time-Dark Beige
Pink chenille bathroom mat with soft granular texture and high water absorption - 50*80cm / Simple Time-Sakura Pink
Soft light blue chenille bath mat with absorbent microfiber texture for bathroom floor - 50*80cm / Simple Time-Foggy Blue
+23
Chenille Bath Mat Thickened Non-Slip Absorbent Rug For Bathroom Shower Bedroom Entrance Door Floor Soft Washable
$4.27-14.38
Mix MOQ : 2
 · 
12 views
Lifelike Cat Shaped Hand Towel Absorbent Microfiber Hanging Bathroom Kitchen Decorative Cartoon Animal Towel Soft Drying Cloth
Lifelike Cat Shaped Hand Towel Absorbent Microfiber Hanging Bathroom Kitchen Decorative Cartoon Animal Towel Soft Drying Cloth
like
Find Similar
Realistic black and white cat shaped hand towel with snap buttons for hanging in bathroom - Black Cat
Detail of cute orange tabby cat hand towel showing secure snap button closure on cat paws - Orange Cat
Detail of grey tabby cat hand towel with metal snap buttons and top hanging loop - Gray Cat
Lifelike Cat Shaped Hand Towel Absorbent Microfiber Hanging Bathroom Kitchen Decorative Cartoon Animal Towel Soft Drying Cloth
$4.12
No MOQ
Cartoon Dog Checkered Diatom Mud Bath Mat Absorbent Non-Slip Floor Mat For Bathroom Entryway Kitchen Diatom Ooze Rug Decor
Cartoon Dog Checkered Diatom Mud Bath Mat Absorbent Non-Slip Floor Mat For Bathroom Entryway Kitchen Diatom Ooze Rug Decor
like
Find Similar
Cartoon dachshund brown plaid diatom mud bath mat with non-slip rounded edges - 40*60cm / Diatom Mud / Coffee Puppy 1
Cute brown cartoon puppy absorbent diatom mud bath mat with lucky puppy text design - Xh-brown Puppy 2 / 40x60cm (Diatomite)
Absorbent diatomite bath mat featuring a cute cartoon dog and yellow plaid pattern - Xh-brown Puppy 3 / 40x60cm (Diatomite)
Absorbent diatomite bath mat featuring a cute cartoon lucky bear on brown plaid pattern - Xh-brown Puppy 4 / 40x60cm (Diatomite)
+60
NewCartoon Dog Checkered Diatom Mud Bath Mat Absorbent Non-Slip Floor Mat For Bathroom Entryway Kitchen Diatom Ooze Rug Decor
$0.83-5.53
No MOQ
Microfiber Quick Dry Beach Towel Large Absorbent Bath Towel For Swimming Travel Bohemian Mandala Floral Heart Print Sand Free Beach Blanket For Adults
Microfiber Quick Dry Beach Towel Large Absorbent Bath Towel For Swimming Travel Bohemian Mandala Floral Heart Print Sand Free Beach Blanket For Adults
like
Find Similar
Peacock blue beach towel with cartoon reindeer and floral heart patterns held by a model - Peacock Blue Cartoon Elk Style (1)
Pink bohemian beach towel with reindeer silhouette and geometric floral patterns - Pink Bohemian Elk Style (2)
Brown beach towel with mandala patterns held by a model on a white background - Brown Mandala Floral Style (3)
Bohemian beach towel with orange and white mandala patterns on a dark teal background - Dark Teal Mandala Totem Style (4)
+8
Microfiber Quick Dry Beach Towel Large Absorbent Bath Towel For Swimming Travel Bohemian Mandala Floral Heart Print Sand Free Beach Blanket For Adults
$3.89
No MOQ
Swan Print Shower Curtain Waterproof Mildew Resistant Polyester Waffle Weave Hookless Layered Detachable Liner Magnetic
Swan Print Shower Curtain Waterproof Mildew Resistant Polyester Waffle Weave Hookless Layered Detachable Liner Magnetic
like
Find Similar
Waterproof shower curtain featuring white swan digital print for bathroom decoration - SYL-1 (White Swan Dark Blue) - Curtain Only / 181x188cm
Waterproof shower curtain with white swan and lotus print for bathroom decor - SYL-2 (Swan Lotus Pond) - Curtain Only / 181x188cm
Detail of waterproof double-layer shower curtain with swan heart and rust-proof grommets - SYL-3 (Two Swans Heart Rose) - Curtain Only / 181x188cm
+3
Swan Print Shower Curtain Waterproof Mildew Resistant Polyester Waffle Weave Hookless Layered Detachable Liner Magnetic
$13.83-19.60
Mix MOQ : 10
Funny Cat Shower Curtain Waterproof Polyester Fabric Digital Print Bathroom Decor Novelty Cute Animal Pattern
Funny Cat Shower Curtain Waterproof Polyester Fabric Digital Print Bathroom Decor Novelty Cute Animal Pattern
like
Find Similar
Funny diving cat shower curtain with colorful sea turtles and fish on waterproof polyester - Diving Cat M1716 / 90*180cm
Funny cat and fire-breathing dinosaur polyester waterproof bathroom shower curtain - Space Cat M1720 / 90*180cm
Funny cat riding shark polyester shower curtain with waterproof digital print for bathroom - Cat Riding Shark M1765 / 90*180cm
Funny cat riding T-Rex on sea waves shower curtain made of waterproof polyester - Cat Riding Dino Trident M2295 / 90*180cm
+51
Funny Cat Shower Curtain Waterproof Polyester Fabric Digital Print Bathroom Decor Novelty Cute Animal Pattern
$6.34-8.93
No MOQ
 · 
31 views
Shower Curtain And Bathroom Mat Waterproof Polyester Waffle Weave Hookless With Removable Liner Magnetic Hem Floral Forest Modern
Shower Curtain And Bathroom Mat Waterproof Polyester Waffle Weave Hookless With Removable Liner Magnetic Hem Floral Forest Modern
like
Find Similar
Double-layer waffle shower curtain with floral daisy pattern and rustproof metal eyelets - SYL-1 (Watercolor Daisy) 181x188cm Single Curtain
Detail of waffle weave shower curtain with blue watercolor floral and misty forest print - SYL-2 (Blue Foggy Forest) 181x188cm Single Curtain
Detail of waffle weave shower curtain with forest daisy watercolor print and reinforced grommets - SYL-3 (Vibrant Forest Daisy) 181x188cm Single Curtain
+3
Shower Curtain And Bathroom Mat Waterproof Polyester Waffle Weave Hookless With Removable Liner Magnetic Hem Floral Forest Modern
$13.83-19.60
Mix MOQ : 10
Cute Cartoon Bear Polka Dot Coral Fleece Towel Bath Towel Soft Absorbent Quick Dry Thick Home Dormitory Travel Kawaii
Cute Cartoon Bear Polka Dot Coral Fleece Towel Bath Towel Soft Absorbent Quick Dry Thick Home Dormitory Travel Kawaii
like
Find Similar
Detail of soft coral fleece towel set with cute bear pattern and polka dots on wood rack - Towel [35*75cm] / Polka Dot Bear-White
Detail view of khaki coral fleece towel featuring cute bear dots and soft textures - Towel [35*75cm] / Polka Dot Bear-Khaki
Cute Cartoon Bear Polka Dot Coral Fleece Towel Bath Towel Soft Absorbent Quick Dry Thick Home Dormitory Travel Kawaii
$1.07
No MOQ
Memory Foam Bath Mat Anti-Slip Super Absorbent Fast Dry Bathroom Rug With 3D Texture Soft Thick Machine Washable
Memory Foam Bath Mat Anti-Slip Super Absorbent Fast Dry Bathroom Rug With 3D Texture Soft Thick Machine Washable
like
Find Similar
Off-white memory foam bath mat with plush waffle texture for quick-dry bathroom use - 40x60cm / Pattern Texture-White
Soft grey memory foam bath mat with embossed pebble texture on bathroom tile floor - 40x60cm / Pattern Texture-Dark Gray
Gray memory foam bathroom mat with wave pattern and non-slip absorbent fabric - 40x60cm / Wave Texture-Light Gray
Absorbent memory foam beige bathroom mat with wave texture on modern gray tile floor - 40x60cm / Wave Texture-Dark Beige
+14
Memory Foam Bath Mat Anti-Slip Super Absorbent Fast Dry Bathroom Rug With 3D Texture Soft Thick Machine Washable
$4.61-13.20
Mix MOQ : 3
 · 
21 views
Waterproof Hookless Shower Curtain Polyester Layered Design Detachable Liner Mesh Window Gothic Halloween Pumpkin Reaper
Waterproof Hookless Shower Curtain Polyester Layered Design Detachable Liner Mesh Window Gothic Halloween Pumpkin Reaper
like
Find Similar
Halloween shower curtain with large orange pumpkin and autumn maple leaf scroll pattern - 181x188cm Single Shower Curtain / Orange Pumpkin
Detail of waterproof bathroom shower curtain with reaper and cat gothic illustration - 181x188cm Single Shower Curtain / Grey Reaper Cat
Detail of waterproof shower curtain with gothic skull design and rust-proof metal grommets - 181x188cm Single Shower Curtain / Dark Skull Reaper
+3
Waterproof Hookless Shower Curtain Polyester Layered Design Detachable Liner Mesh Window Gothic Halloween Pumpkin Reaper
-5%
$13.14-18.62
Mix MOQ : 10
Microfiber Beach Towel Quick Dry Sandproof Large Bath Towel Dollar Bill Print Tropical Flamingo Sea Life Summer Travel
Microfiber Beach Towel Quick Dry Sandproof Large Bath Towel Dollar Bill Print Tropical Flamingo Sea Life Summer Travel
like
Find Similar
Microfiber beach towel with vibrant rainbow wavy stripes pattern worn by a model - 80*160cm / Colorful Stripes
Microfiber beach towel with pink flamingo and tropical palm leaves print pattern - 80*160cm / Flamingo Plants
Microfiber beach towel with sunset sea dolphins and tropical fish print variant - 80*160cm
Microfiber beach towel featuring a deep sea dolphin print and blue wave patterns - 80*160cm
+29
Microfiber Beach Towel Quick Dry Sandproof Large Bath Towel Dollar Bill Print Tropical Flamingo Sea Life Summer Travel
$3.31
No MOQ
 · 
74 views
Marble Print Diatom Mud Bathroom Mat Super Absorbent Non-Slip Quick Dry Floor Mat For Toilet Entrance Modern Home Decor
Marble Print Diatom Mud Bathroom Mat Super Absorbent Non-Slip Quick Dry Floor Mat For Toilet Entrance Modern Home Decor
like
Find Similar
Modern grey marble diatom mud bathroom mat with gold sand lines for quick dry absorption - 40*60cm / Terry Light Gray Gold
Modern grey marble pattern diatomaceous mud bathroom mat with anti-slip texture - 40*60cm / Nanyuan Hibiscus Light Gray
Modern geometric diatom mud bath mat with non-slip gray and gold patterns for bathroom - Terry White Gray / 40x60cm (Diatomite)
Modern grey geometric bathroom mat with gold lines on white marble floor decor - 40*60cm / Terry White Gray Mountain
+124
Marble Print Diatom Mud Bathroom Mat Super Absorbent Non-Slip Quick Dry Floor Mat For Toilet Entrance Modern Home Decor
$0.83-4.70
No MOQ
Free Shipping
Go to

More in home & kitchen

Explore more in bedding & bathroom

homecolorholdertravelstylepolyesterdoubleheaddesignheart
hangingplasticstorageshapecleaningsimplekidslayerwhitedaily

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access