Everful

Wholesale bibs

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Bibs

Find the perfect pieces: toys & games, kids bags, baby clothing & essentials and more

All products in bibs

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Newborn Baby Romper 100% Cotton Long Sleeve Boneless Butterfly Style Pajamas Cartoon Print Breathable Infant Jumpsuit
Newborn Baby Romper 100% Cotton Long Sleeve Boneless Butterfly Style Pajamas Cartoon Print Breathable Infant Jumpsuit
like
Find Similar
Detailed flat lay of a pure cotton baby romper with colorful house prints and snowman patch - Snow Day Elf / 52cm
Detail of baby cotton bodysuit with bear print and soft washing label information - Capybara Style / 52cm
Detail of 100% cotton newborn romper featuring rabbit patterns and a plush bunny accent - Childhood Bunny / 52cm
Detail showing 100% cotton baby romper with cute bear embroidery and side snaps - Bear Umbrella / 52cm
+10
Newborn Baby Romper 100% Cotton Long Sleeve Boneless Butterfly Style Pajamas Cartoon Print Breathable Infant Jumpsuit
$5.48
No MOQ
Girls False Two-Piece Long Sleeve T-Shirt 100% Cotton Pink White Contrast Cartoon Pig Bread Print Round Neck Soft Autumn Top
Girls False Two-Piece Long Sleeve T-Shirt 100% Cotton Pink White Contrast Cartoon Pig Bread Print Round Neck Soft Autumn Top
like
Find Similar
Pink and white long-sleeved false two-piece t-shirt for girls with cute cartoon pig print - HT3111 Off-white / 90cm
+5
Girls False Two-Piece Long Sleeve T-Shirt 100% Cotton Pink White Contrast Cartoon Pig Bread Print Round Neck Soft Autumn Top
$4.58
No MOQ
Korean Style Baby Toddler 2 Piece Clothing Set Long Sleeve Checked Shirt And Denim Suspender Pants Outfit For Boys Girls
Korean Style Baby Toddler 2 Piece Clothing Set Long Sleeve Checked Shirt And Denim Suspender Pants Outfit For Boys Girls
like
Find Similar
Kids plaid shirt and cream overalls set with adjustable straps for spring - 80cm / White
Spring plaid shirt and denim overalls set with white sneakers for kids - 80cm / Blue
+6
Korean Style Baby Toddler 2 Piece Clothing Set Long Sleeve Checked Shirt And Denim Suspender Pants Outfit For Boys Girls
$9.80
No MOQ
Baby Girls Long Sleeve Ruffled Waffle Top And Floral Pants Mushroom Embroidery Cotton Toddler Autumn Clothing Outfit
Baby Girls Long Sleeve Ruffled Waffle Top And Floral Pants Mushroom Embroidery Cotton Toddler Autumn Clothing Outfit
like
Find Similar
Sweet baby girl two-piece cream set with mushroom embroidery and floral trousers - 73 / Beige
+4
Baby Girls Long Sleeve Ruffled Waffle Top And Floral Pants Mushroom Embroidery Cotton Toddler Autumn Clothing Outfit
$20.17
No MOQ
Free Shipping
Baby Boy Autumn Winter Quilted Padded Romper With Hat Double Zipper Thickened Cartoon Bear Patchwork Infant Jumpsuit
Baby Boy Autumn Winter Quilted Padded Romper With Hat Double Zipper Thickened Cartoon Bear Patchwork Infant Jumpsuit
like
Find Similar
Quilted warm baby romper in olive green with double zippers and cute bear detail - 66CM / Green
Brown quilted baby romper with cartoon bear face and practical double zippers - 66CM / Brown
+6
Baby Boy Autumn Winter Quilted Padded Romper With Hat Double Zipper Thickened Cartoon Bear Patchwork Infant Jumpsuit
$15.85
No MOQ
Newborn Baby Quilted Warm Romper Cotton Stars Moon Embroidered Jumpsuit Long Sleeve Thermal Autumn Winter Thick Clothes
Newborn Baby Quilted Warm Romper Cotton Stars Moon Embroidered Jumpsuit Long Sleeve Thermal Autumn Winter Thick Clothes
like
Find Similar
Detailed close-up of quilted cotton baby romper with embossed star and moon patterns - Butterfly Romper Style / Cream White / 52cm
Detail of quilted newborn romper with moon stars embossing and side snap ties - Butterfly Romper Style / Milk Yellow / 52cm
Detail of baby quilted romper with embroidered star moon pattern and side-tie design - Butterfly Romper Style / Pale Green / 52cm
Close-up of light blue quilted baby romper featuring moon star patterns and moon embroidery - Butterfly Romper Style / Fog Blue / 52cm
+11
Newborn Baby Quilted Warm Romper Cotton Stars Moon Embroidered Jumpsuit Long Sleeve Thermal Autumn Winter Thick Clothes
$5.33
No MOQ
Girls Sweet Pink Sweatshirt Pants Set Cartoon Bear Print Lace Hem Polo Collar Cotton Casual Long Sleeve Two Piece Clothing Set
Girls Sweet Pink Sweatshirt Pants Set Cartoon Bear Print Lace Hem Polo Collar Cotton Casual Long Sleeve Two Piece Clothing Set
like
Find Similar
Pink girl's lace-trimmed sweatshirt and wide-leg pants set with cartoon bear print - 80cm / Lotus Pink
+4
Girls Sweet Pink Sweatshirt Pants Set Cartoon Bear Print Lace Hem Polo Collar Cotton Casual Long Sleeve Two Piece Clothing Set
$8.36
No MOQ
Baby Boys Casual Cotton Blend Clothing Set Long Sleeve Goose Print Pullover Sweatshirt And Striped Pants 2Pcs Infant Outfits
Baby Boys Casual Cotton Blend Clothing Set Long Sleeve Goose Print Pullover Sweatshirt And Striped Pants 2Pcs Infant Outfits
like
Find Similar
Infant two-piece set with beige goose print sweatshirt and striped pants in INS style - 73cm / Beige
+4
Baby Boys Casual Cotton Blend Clothing Set Long Sleeve Goose Print Pullover Sweatshirt And Striped Pants 2Pcs Infant Outfits
$18.44
No MOQ
Free Shipping
Cute Baby Romper Long Sleeve Cotton Blend Jumpsuit For Newborn Infants Spring Autumn Clothing Bear Applique Homewear
Cute Baby Romper Long Sleeve Cotton Blend Jumpsuit For Newborn Infants Spring Autumn Clothing Bear Applique Homewear
like
Find Similar
Close-up of soft cotton baby romper with 3D plush bear patch and snap button closure - 66CM / Pink
Close-up of cotton baby bodysuit featuring textured bear motif and premium snap buttons - 66CM / Khaki
Detail of baby romper featuring blue patterned sleeves and 3D plush bear embroidery - 66CM / Blue
+8
Cute Baby Romper Long Sleeve Cotton Blend Jumpsuit For Newborn Infants Spring Autumn Clothing Bear Applique Homewear
$6.92
No MOQ
Toddler Baby Cartoon Dog 3D Decor Outfit Polyester Long Sleeve Lapel Jacket And Plaid Pants For Spring Autumn Casual Clothing
Toddler Baby Cartoon Dog 3D Decor Outfit Polyester Long Sleeve Lapel Jacket And Plaid Pants For Spring Autumn Casual Clothing
like
Find Similar
Beige infant two-piece set featuring a cartoon dog patch and ribbed cuffs in soft fabric - 73 / Light Beige Coffee
+4
Toddler Baby Cartoon Dog 3D Decor Outfit Polyester Long Sleeve Lapel Jacket And Plaid Pants For Spring Autumn Casual Clothing
$17.29
No MOQ
Free Shipping
Infant Baby Girl Floral Romper Short Sleeve Cotton Jumpsuit Bow Lace Trim Pastoral Style Summer One Piece Outing Outfit
Infant Baby Girl Floral Romper Short Sleeve Cotton Jumpsuit Bow Lace Trim Pastoral Style Summer One Piece Outing Outfit
like
Find Similar
Floral baby girl short sleeve romper with orange bow detail and ruffle neck design - 66CM / Orange Floral
Infant Baby Girl Floral Romper Short Sleeve Cotton Jumpsuit Bow Lace Trim Pastoral Style Summer One Piece Outing Outfit
$8.65
No MOQ
Free Shipping
Magic Tree Printed Striped Long Sleeve Sweatshirt And Pants Set For Toddler Boys Autumn Casual Outfits Green Clothing
Magic Tree Printed Striped Long Sleeve Sweatshirt And Pants Set For Toddler Boys Autumn Casual Outfits Green Clothing
like
Find Similar
2-piece baby boy clothing set with green striped long sleeve tee and joggers - Green / 73cm
+4
Magic Tree Printed Striped Long Sleeve Sweatshirt And Pants Set For Toddler Boys Autumn Casual Outfits Green Clothing
$17.87
No MOQ
Free Shipping
Baby Girls Winter Padded Clothing Set Thick Warm Hooded Jacket Long Sleeve Top And Ruffle Pants Infant Outfits
Baby Girls Winter Padded Clothing Set Thick Warm Hooded Jacket Long Sleeve Top And Ruffle Pants Infant Outfits
like
Find Similar
Winter baby girl hooded cotton coat in cream white with purple floral trim and snap buttons - 73 / Jacket Only (Without Top And Pants)
Infant girl beige sweatshirt with bunny print and floral hem in size 73 variant - 73 / Top Only (Without Jacket And Pants)
Baby girl light grey blue padded cotton wide leg trousers with floral embroidery - 73 / Pants Only (Without Jacket And Top)
+12
Baby Girls Winter Padded Clothing Set Thick Warm Hooded Jacket Long Sleeve Top And Ruffle Pants Infant Outfits
$9.51-22.19
No MOQ
Free Shipping
Kids Cotton Blend Zipper Vest Cartoon Bear Embroidered Stand Collar Waistcoat For Boys Girls Casual Sleeveless Jacket
Kids Cotton Blend Zipper Vest Cartoon Bear Embroidered Stand Collar Waistcoat For Boys Girls Casual Sleeveless Jacket
like
Find Similar
Kids grey knitted vest with cool bear embroidery and standing collar for spring - 90cm / Gray
Navy blue children's zip-up vest with cute bear embroidery and practical side pockets - 90cm / Navy Blue
Green knitted children vest with zipper and cool bear embroidery for spring - 90cm / Fruit Green
Kids yellow cotton vest with bear embroidery and full zip closure in casual style - 90cm / Yellow
+9
Kids Cotton Blend Zipper Vest Cartoon Bear Embroidered Stand Collar Waistcoat For Boys Girls Casual Sleeveless Jacket
-5%
$5.89
No MOQ
Kids Mock Neck Long Sleeve T-Shirt Cotton Blend Warm Base Layer Tops Casual Solid Color Undershirt For Boys Girls Toddler
Kids Mock Neck Long Sleeve T-Shirt Cotton Blend Warm Base Layer Tops Casual Solid Color Undershirt For Boys Girls Toddler
like
Find Similar
Detail of neatly folded off-white kids mock neck thermal top with premium knit texture - White / 80cm
Detail view of children's black mock neck sweater with fine knit texture and soft fabric - Black / 80cm
Detailed close-up of dark teal kids' knit sweater showing soft texture and high-neck - Aqua Blue / 80cm
Detail of ginger yellow kids turtleneck shirt showing soft textured knit fabric texture - Yellow / 80cm
+50
Kids Mock Neck Long Sleeve T-Shirt Cotton Blend Warm Base Layer Tops Casual Solid Color Undershirt For Boys Girls Toddler
$7.78
No MOQ
Kids Cotton Raglan Long Sleeve T-Shirt Cartoon Dog Panda Animal Print Casual Pullover Top For Boys Girls
Kids Cotton Raglan Long Sleeve T-Shirt Cartoon Dog Panda Animal Print Casual Pullover Top For Boys Girls
like
Find Similar
Korean style kids long sleeve T-shirt with dog print and raglan sleeves for toddlers - 90cm / Dark Blue Sleeves
Toddler raglan sleeve T-shirt with puppy print and blue denim jeans outfit set - 90cm / Striped Sleeves
Kids long sleeve raglan T-shirt with cartoon bear print and light blue denim jeans - 120cm / Bear Pattern (G0581)
Detailed flat lay of children's grey long sleeve tee with dog prints and denim jeans - 120cm
+71
Kids Cotton Raglan Long Sleeve T-Shirt Cartoon Dog Panda Animal Print Casual Pullover Top For Boys Girls
$6.63
No MOQ
Newborn Baby Long Sleeve Cotton Bodysuit Bone-Free Printed Kimono Style Onesie For Infant Boys Girls Spring Autumn Winter
Newborn Baby Long Sleeve Cotton Bodysuit Bone-Free Printed Kimono Style Onesie For Infant Boys Girls Spring Autumn Winter
like
Find Similar
Flat lay of cream cotton baby bodysuit with snowmen prints and wooden rabbit rattle toy - Size 59 / Snow Day Elf
Detail of 100% cotton baby bodysuit with rabbit print and fabric care label - Size 59 / Childhood Bunny
Detail view of cotton baby bodysuit featuring side-opening snaps and 3D bear ornament - Size 59 / Bear Umbrella
Detail view of 100% cotton baby bodysuit with cute bear embroidery and snap buttons - Size 66 / Capybara Style
+14
Newborn Baby Long Sleeve Cotton Bodysuit Bone-Free Printed Kimono Style Onesie For Infant Boys Girls Spring Autumn Winter
$4.76
No MOQ
Newborn Baby Cotton Padded Romper Thickened Warm Winter Clothes Cartoon Dinosaur Lion Bear Print Infant Jumpsuit One Piece
Newborn Baby Cotton Padded Romper Thickened Warm Winter Clothes Cartoon Dinosaur Lion Bear Print Infant Jumpsuit One Piece
like
Find Similar
Thickened cream white baby winter romper with dinosaur print and warm ribbed cuffs - Size 59 / Dinosaur Paradise
Newborn baby padded romper in cream white with cute cartoon animal prints and snap buttons - Size 59 / Animal Alphabet Paradise
Thickened baby winter jumpsuit in creamy white featuring a cute cartoon bear print - 73 Size / Bear
Newborn baby warm padded romper in beige featuring a cute lion crown print and snaps - 73 Size / Little Lion
+16
Newborn Baby Cotton Padded Romper Thickened Warm Winter Clothes Cartoon Dinosaur Lion Bear Print Infant Jumpsuit One Piece
$10.92
No MOQ
Infant Baby Girl Summer Cotton Romper Short Sleeve Ruffle Collar Floral Embroidery Jumpsuit Korean Style Soft Breathable Toddler Clothes
Infant Baby Girl Summer Cotton Romper Short Sleeve Ruffle Collar Floral Embroidery Jumpsuit Korean Style Soft Breathable Toddler Clothes
like
Find Similar
Short sleeve baby girl romper in light green and white mesh with floral embroidery - 66CM / Light Green
Infant Baby Girl Summer Cotton Romper Short Sleeve Ruffle Collar Floral Embroidery Jumpsuit Korean Style Soft Breathable Toddler Clothes
$9.51
No MOQ
Free Shipping
Boys Clothing Set Cotton Beige Cardigan Bear Applique Brown Top And Plaid Pants Spring Infant Toddler Fashion Outfit
Boys Clothing Set Cotton Beige Cardigan Bear Applique Brown Top And Plaid Pants Spring Infant Toddler Fashion Outfit
like
Find Similar
Toddler boy three-piece clothing set with beige cardigan, brown shirt and checkered pants - 73 / Beige
+4
Boys Clothing Set Cotton Beige Cardigan Bear Applique Brown Top And Plaid Pants Spring Infant Toddler Fashion Outfit
$23.34
No MOQ
Cute Baby Long Sleeve Pullover Romper Soft Polar Fleece Smile Pocket Jumpsuit For Newborn Boys Girls Casual Spring Autumn One Piece Outfit
Cute Baby Long Sleeve Pullover Romper Soft Polar Fleece Smile Pocket Jumpsuit For Newborn Boys Girls Casual Spring Autumn One Piece Outfit
like
Find Similar
Pink fleece baby romper with cute cartoon bear pocket for boys and girls - Size 66 / Pink
NewCute Baby Long Sleeve Pullover Romper Soft Polar Fleece Smile Pocket Jumpsuit For Newborn Boys Girls Casual Spring Autumn One Piece Outfit
$10.95
Mix MOQ : 2
Free Shipping
Cute Baby Hooded Striped Top And Dinosaur Suspender Romper For Infant Toddler Cotton Clothes Spring Autumn Outfits
Cute Baby Hooded Striped Top And Dinosaur Suspender Romper For Infant Toddler Cotton Clothes Spring Autumn Outfits
like
Find Similar
Infant striped long sleeve set with beige dinosaur overalls in soft cotton knit - 73cm / Beige Apricot
Baby two-piece set featuring striped hoodie and brown overalls with dinosaur patch - 73cm / Apricot Coffee
+6
Cute Baby Hooded Striped Top And Dinosaur Suspender Romper For Infant Toddler Cotton Clothes Spring Autumn Outfits
$14.99
No MOQ
Baby Boys Casual Cotton Blend Clothing Set Color Block Elephant Print Sweatshirt Plaid Pants Spring Autumn Infant Toddler Outfit
Baby Boys Casual Cotton Blend Clothing Set Color Block Elephant Print Sweatshirt Plaid Pants Spring Autumn Infant Toddler Outfit
like
Find Similar
Toddler casual two-piece outfit featuring color-block sweatshirt and checkered jogger pants - Ivory / 73cm
+4
Baby Boys Casual Cotton Blend Clothing Set Color Block Elephant Print Sweatshirt Plaid Pants Spring Autumn Infant Toddler Outfit
$15.85
No MOQ
Free Shipping
Newborn Baby Cotton Long Sleeve Romper Sweet Bunny Floral Print Peter Pan Collar Jumpsuit For Infant Boys Girls Autumn Clothes
Newborn Baby Cotton Long Sleeve Romper Sweet Bunny Floral Print Peter Pan Collar Jumpsuit For Infant Boys Girls Autumn Clothes
like
Find Similar
Close-up of baby romper featuring pink ruffled collar and cute rabbit floral prints - Size 59 / Pink Rabbit
Detail of baby floral cotton jumpsuit with lace collar and purple bunny pattern - Size 59 / Purple Rabbit
Detail of floral baby romper with caramel doll collar and ruffled shoulders in soft cotton - Size 59 / Coffee Fawn
+12
Newborn Baby Cotton Long Sleeve Romper Sweet Bunny Floral Print Peter Pan Collar Jumpsuit For Infant Boys Girls Autumn Clothes
$6.48
No MOQ
Korean Style Kids Cotton Sleeveless Henley T-Shirt Minimalist Solid Color Summer Breathable Vest Top For Boys Girls Children
Korean Style Kids Cotton Sleeveless Henley T-Shirt Minimalist Solid Color Summer Breathable Vest Top For Boys Girls Children
like
Find Similar
Close-up of olive green knit cotton Henley vest with two wooden buttons for kids - 80cm / Fruit Green
Detail of coffee brown baby vest featuring a ribbed henley neck and soft cotton texture - 80cm / Khaki
Detail view of cotton knit toddler vest with brown color and wood-style buttons - 80cm / Brown
Detail of minimalist beige cotton kids tank top with Henley collar and wooden buttons - 80cm / Beige Apricot
+20
Korean Style Kids Cotton Sleeveless Henley T-Shirt Minimalist Solid Color Summer Breathable Vest Top For Boys Girls Children
$6.31
No MOQ
Free Shipping
Korean Style Kids Cotton Overalls Summer Thin Solid Color Suspender Trousers For Boys Girls Casual Lantern Pants Clothes
Korean Style Kids Cotton Overalls Summer Thin Solid Color Suspender Trousers For Boys Girls Casual Lantern Pants Clothes
like
Find Similar
Detail of cotton kids overalls featuring adjustable button straps and elastic leg cuffs - 80cm / Khaki
Flat lay of brown cotton baby overalls showing elastic cuffs and button strap details - 80cm / Dark Coffee
+10
Korean Style Kids Cotton Overalls Summer Thin Solid Color Suspender Trousers For Boys Girls Casual Lantern Pants Clothes
$12.39
No MOQ
Free Shipping
Baby Quilted Cotton Vest Soft Warm Infant Sleeveless Cardigan Star Moon Quilted Embroidery Waistcoat Newborn Clothing
Baby Quilted Cotton Vest Soft Warm Infant Sleeveless Cardigan Star Moon Quilted Embroidery Waistcoat Newborn Clothing
like
Find Similar
Close-up of 100% cotton quilted baby vest with star patterns and Baby embroidery - 66 / Cream
Detail of baby quilted vest featuring star embossed texture and Baby moon patch - 66 / Milk Yellow
Detail of light green baby vest with star quilting and moon patch embroidery on pure cotton - 66 / Pale Green
Detail view of quilted baby vest featuring star pattern and soft cotton texture - 66 / Light Gray
+16
Baby Quilted Cotton Vest Soft Warm Infant Sleeveless Cardigan Star Moon Quilted Embroidery Waistcoat Newborn Clothing
$3.89
No MOQ
Newborn Baby Cartoon Crocodile Quilted Cotton Romper Long Sleeve Hooded Jumpsuit For Spring Autumn Infant Boys Girls Clothing
Newborn Baby Cartoon Crocodile Quilted Cotton Romper Long Sleeve Hooded Jumpsuit For Spring Autumn Infant Boys Girls Clothing
like
Find Similar
Newborn baby cartoon crocodile hooded jumpsuit with waffle texture and zipper closure - 66 / Green
Newborn cream baby romper with grey stripes and dinosaur embroidery hooded jumpsuit - 66 / Gray
+8
Newborn Baby Cartoon Crocodile Quilted Cotton Romper Long Sleeve Hooded Jumpsuit For Spring Autumn Infant Boys Girls Clothing
-5%
$14.24
Mix MOQ : 2
Free Shipping
Baby Girl Floral Quilted Winter Padded Romper Long Sleeve Vintage Sweet Jumpsuit With Bow Lace Trim Thick Warm Outerwear
Baby Girl Floral Quilted Winter Padded Romper Long Sleeve Vintage Sweet Jumpsuit With Bow Lace Trim Thick Warm Outerwear
like
Find Similar
Detailed flat lay of a floral quilted baby romper with lace trim and black bow details - 90cm / Black & White
Baby Girl Floral Quilted Winter Padded Romper Long Sleeve Vintage Sweet Jumpsuit With Bow Lace Trim Thick Warm Outerwear
-4%
$15.05
Mix MOQ : 2
Infant Winter Thickened Fleece Romper Cute Dinosaur Print Long Sleeve Cotton Bodysuit Warm Baby Jumpsuit Boys Girls
Infant Winter Thickened Fleece Romper Cute Dinosaur Print Long Sleeve Cotton Bodysuit Warm Baby Jumpsuit Boys Girls
like
Find Similar
Thick winter baby dinosaur romper in beige cotton with long sleeves and snap buttons - 66 / Apricot
Close-up of baby dinosaur romper with reinforced metal snap buttons for easy diaper changes - 66 / Gray
+8
Infant Winter Thickened Fleece Romper Cute Dinosaur Print Long Sleeve Cotton Bodysuit Warm Baby Jumpsuit Boys Girls
-5%
$8.21
Mix MOQ : 2
Baby Girl Summer Sleeveless Romper 100% Cotton Muslin Heart Print Lace Collar Princess Jumpsuit Newborn Infant Bodysuit Outfit
Baby Girl Summer Sleeveless Romper 100% Cotton Muslin Heart Print Lace Collar Princess Jumpsuit Newborn Infant Bodysuit Outfit
like
Find Similar
Infant cotton bodysuit and matching shoes with heart prints and lace collar detail - 66CM / Heart Print Style
Baby Girl Summer Sleeveless Romper 100% Cotton Muslin Heart Print Lace Collar Princess Jumpsuit Newborn Infant Bodysuit Outfit
$8.04
Mix MOQ : 2
Free Shipping
Baby Boy Clothing Set Soft Cotton Blend Sweatshirt And Pants Casual Dog Print Two Piece Outfits Toddler Spring Clothes
Baby Boy Clothing Set Soft Cotton Blend Sweatshirt And Pants Casual Dog Print Two Piece Outfits Toddler Spring Clothes
like
Find Similar
Baby boy light grey autumn two-piece set with cute puppy print and casual sweatpants - Gray / 73cm
+4
Baby Boy Clothing Set Soft Cotton Blend Sweatshirt And Pants Casual Dog Print Two Piece Outfits Toddler Spring Clothes
$17.87
No MOQ
Free Shipping
Toddler Boy Korean Style Cotton Plaid Stitching Bear Print Sweatshirt Pants Clothing Outfit Baby Spring Casual Jogger Suit
Toddler Boy Korean Style Cotton Plaid Stitching Bear Print Sweatshirt Pants Clothing Outfit Baby Spring Casual Jogger Suit
like
Find Similar
Infant boys beige two-piece cotton tracksuit with cute bear print and plaid details - 73 / Blue
+4
Toddler Boy Korean Style Cotton Plaid Stitching Bear Print Sweatshirt Pants Clothing Outfit Baby Spring Casual Jogger Suit
$17.00
No MOQ
Girls Cute Tiger Embroidery Sweatshirt And Animal Printed Pants Cotton Warm Fleece Lined Long Sleeve Casual Outfit
Girls Cute Tiger Embroidery Sweatshirt And Animal Printed Pants Cotton Warm Fleece Lined Long Sleeve Casual Outfit
like
Find Similar
Fleece lined orange pink girl's sweatshirt featuring tiger embroidery and leopard print - Fleece Lined Tiger Sweatshirt (H22058) / 6Y(130cm)
Girls winter fleece leggings with colorful animal prints and asymmetric color blocking - Cartoon Animal Print Leggings (22058K) / 6Y(130cm)
Pink girls' sweatshirt set with cute tiger embroidery and leopard elbow patches - Tiger Embroidery Sweatshirt (22058) / 6Y(130cm)
+9
Girls Cute Tiger Embroidery Sweatshirt And Animal Printed Pants Cotton Warm Fleece Lined Long Sleeve Casual Outfit
-52%
$1.96-3.69
No MOQ
Baby Cartoon Animal Embroidery Pre-walker Shoes Cotton Soft Sole Non-slip Infant First Walker Shoes For Boys Girls
Baby Cartoon Animal Embroidery Pre-walker Shoes Cotton Soft Sole Non-slip Infant First Walker Shoes For Boys Girls
like
Find Similar
Cream knit baby walking shoes with cute tiger embroidery and adjustable soft ankle cuff - Inner Length 12cm / Beige Tiger
Pink cotton baby walking shoes with cute rabbit embroidery and soft non-slip soles - Inner Length 12cm / Pink Rabbit
Light blue cotton baby walking shoes with cartoon bear embroidery and soft non-slip soles - Inner Length 12cm / Blue Bear
+3
Baby Cartoon Animal Embroidery Pre-walker Shoes Cotton Soft Sole Non-slip Infant First Walker Shoes For Boys Girls
$3.54
Mix MOQ : 3
Baby Boy Cotton Casual Long Sleeve Outfits Toddler Cartoon Puppy Sweatshirt And Pants Autumn Soft Clothing Ensemble
Baby Boy Cotton Casual Long Sleeve Outfits Toddler Cartoon Puppy Sweatshirt And Pants Autumn Soft Clothing Ensemble
like
Find Similar
Pink toddler casual sweatshirt set with cartoon puppy print and dark brown joggers - As Shown / 73cm
+4
Baby Boy Cotton Casual Long Sleeve Outfits Toddler Cartoon Puppy Sweatshirt And Pants Autumn Soft Clothing Ensemble
$16.71
No MOQ
Free Shipping
Long Sleeve Cotton Infant Romper Side Snap Baby Jumpsuit Bone Free Sewing Combed Cotton Animal Print Newborn Crawling Suit
Long Sleeve Cotton Infant Romper Side Snap Baby Jumpsuit Bone Free Sewing Combed Cotton Animal Print Newborn Crawling Suit
like
Find Similar
Long-sleeve cotton baby romper with beige-white color block and cute cartoon luck dragon - Happy Little Dragon Side Opening / 66CM
Soft cotton long sleeve baby romper with cartoon animal pattern and snap button closure - Happy Little Dragon / 66CM
Soft cotton baby romper with color block design, long sleeves, and snap closure - Single Flower / 66CM
Long-sleeve cotton baby romper featuring a cute bear print and two-tone patchwork design - Happy Little Bear / 66CM
+11
Long Sleeve Cotton Infant Romper Side Snap Baby Jumpsuit Bone Free Sewing Combed Cotton Animal Print Newborn Crawling Suit
$7.35
No MOQ
Baby Girls Long Sleeve T-Shirt Ribbed Mock Neck Lettuce Edge Bottoming Shirt Cotton Blend Spring Autumn Casual Basic Top
Baby Girls Long Sleeve T-Shirt Ribbed Mock Neck Lettuce Edge Bottoming Shirt Cotton Blend Spring Autumn Casual Basic Top
like
Find Similar
Toddler girl ribbed long sleeve cotton tee with turtle neck and lettuce trim edge - 66 / White
Infant girl ribbed black long sleeve tee with ruffle trim in a cozy woven basket - 66 / Black
Brown long-sleeved cotton baby top with ruffle edges and ribbed texture in a basket - 66 / Brown
+12
NewBaby Girls Long Sleeve T-Shirt Ribbed Mock Neck Lettuce Edge Bottoming Shirt Cotton Blend Spring Autumn Casual Basic Top
-5%
$4.93
Mix MOQ : 2
Bohemian Pastoral Artificial Flower Baby Headband Soft Nylon Elastic Floral Hair Band For Newborn Infants Photography Props
Bohemian Pastoral Artificial Flower Baby Headband Soft Nylon Elastic Floral Hair Band For Newborn Infants Photography Props
like
Find Similar
Detail view of handmade mesh flower headbands with navy and white silk petals for baby girls - Navy Blue
Bohemian floral baby headband with peach peonies and soft nylon band for photography - Orange
Detail of pink and white faux flowers on a soft nylon elastic headband for baby girls - Pink
Detailed overhead view of infant floral headband with white fabric flowers and green leaves - Off White
+3
Bohemian Pastoral Artificial Flower Baby Headband Soft Nylon Elastic Floral Hair Band For Newborn Infants Photography Props
$1.87
Mix MOQ : 2
Free Shipping
Baby Winter Thick Fleece Romper Warm Newborn Hooded Jumpsuit With Ears Cute Animal Embroidered Autumn Winter Clothing Outfit
Baby Winter Thick Fleece Romper Warm Newborn Hooded Jumpsuit With Ears Cute Animal Embroidered Autumn Winter Clothing Outfit
like
Find Similar
Thick teddy fleece baby romper with bear ears hat in beige and brown color - Size 66 / Hug Fleece Romper Raccoon
+4
Baby Winter Thick Fleece Romper Warm Newborn Hooded Jumpsuit With Ears Cute Animal Embroidered Autumn Winter Clothing Outfit
$10.09
No MOQ
Kids Girls Corduroy Jacket Cotton T-Shirt Pants Marble Printed Outfits Spring Autumn Toddler Fashion Boutique Clothing
Kids Girls Corduroy Jacket Cotton T-Shirt Pants Marble Printed Outfits Spring Autumn Toddler Fashion Boutique Clothing
like
Find Similar
Pink tie-dye corduroy jacket and pants set for toddler girls in a 3-piece casual outfit - 80cm / Brick Red
Three-piece kids set with tie-dye corduroy jacket, printed T-shirt and joggers - 80cm / Off White
+8
Kids Girls Corduroy Jacket Cotton T-Shirt Pants Marble Printed Outfits Spring Autumn Toddler Fashion Boutique Clothing
$13.83
No MOQ
Kids Boys Faux Two-Piece Polo Shirt Cotton Blend Spliced Striped Long Sleeve Korean Style Casual Toddler Bear Embroidery Top
Kids Boys Faux Two-Piece Polo Shirt Cotton Blend Spliced Striped Long Sleeve Korean Style Casual Toddler Bear Embroidery Top
like
Find Similar
Detail of kids polo shirt with blue bear embroidery and striped patchwork sleeves - 100cm / White
Detail of navy blue kids polo shirt featuring a polar bear embroidery and striped sleeves - 90cm / Navy Blue
+10
Kids Boys Faux Two-Piece Polo Shirt Cotton Blend Spliced Striped Long Sleeve Korean Style Casual Toddler Bear Embroidery Top
-4%
$6.17
No MOQ
Cotton Infant Long Sleeve Romper Cartoon Animal Bear Printed Newborn Jumpsuit Soft Comfortable Casual Baby Bodysuit
Cotton Infant Long Sleeve Romper Cartoon Animal Bear Printed Newborn Jumpsuit Soft Comfortable Casual Baby Bodysuit
like
Find Similar
Close-up of cotton baby bodysuit with cute cartoon bear print and snap closure - Size 59 / Bear Print
Detail of baby cotton romper with cartoon panda prints and front button closure - Size 59 / Panda Print
Close-up of pure cotton baby romper with delicate deer prints and yellow contrast edges - Size 59 / Deer Print
+12
Cotton Infant Long Sleeve Romper Cartoon Animal Bear Printed Newborn Jumpsuit Soft Comfortable Casual Baby Bodysuit
$4.76
No MOQ
Toddler Baby Boys Denim Pants Cotton Blend Soft Washed Jeans With Bear Pattern Letter Embroidery Casual Trousers For Kids
Toddler Baby Boys Denim Pants Cotton Blend Soft Washed Jeans With Bear Pattern Letter Embroidery Casual Trousers For Kids
like
Find Similar
Kids blue washed denim jeans with elastic waist and cute printed bear illustration - 73cm / Blue
Toddler Baby Boys Denim Pants Cotton Blend Soft Washed Jeans With Bear Pattern Letter Embroidery Casual Trousers For Kids
$10.95
No MOQ
Free Shipping
Cute Baby Girl White Duck Down Jumpsuit Floral Print Hooded Snowsuit Winter Thick Warm Infant Toddler Romper Ruffle Trim Soft Polyester
Cute Baby Girl White Duck Down Jumpsuit Floral Print Hooded Snowsuit Winter Thick Warm Infant Toddler Romper Ruffle Trim Soft Polyester
like
Find Similar
Winter infant down snowsuit with floral pattern and blue ribbed cuffs for baby girls - Blue / 66CM
+4
Cute Baby Girl White Duck Down Jumpsuit Floral Print Hooded Snowsuit Winter Thick Warm Infant Toddler Romper Ruffle Trim Soft Polyester
$36.31
No MOQ
Free Shipping
Girls Toddler Two Piece Clothing Set Winter Fleece Bow Printed Long Sleeve Top And Pink Leggings Warm Casual Kids Outfit
Girls Toddler Two Piece Clothing Set Winter Fleece Bow Printed Long Sleeve Top And Pink Leggings Warm Casual Kids Outfit
like
Find Similar
Fleece-lined toddler girls' pajamas with white bow print top and pink leggings - 5Y(120cm) / White Top With Pink Pants (K2105)
Girls Toddler Two Piece Clothing Set Winter Fleece Bow Printed Long Sleeve Top And Pink Leggings Warm Casual Kids Outfit
$6.22
No MOQ
Baby Girls Cotton Knit Cardigan Hollow Out Pointelle Bolero Shrug Sun Protection Thin Summer Outerwear For Toddler Baby
Baby Girls Cotton Knit Cardigan Hollow Out Pointelle Bolero Shrug Sun Protection Thin Summer Outerwear For Toddler Baby
like
Find Similar
Light purple hollow knit cardigan for baby girls with wavy lace edges and long sleeves - 80cm / Purple
White long-sleeve knit cardigan for toddler girls with hollow dot pattern and scalloped edges - 90cm / White
Girls bright red knit bolero shrug with openwork patterns and wavy trim - 90cm / Red
Light yellow knit shrug for baby girls with hollow wavy pattern and pearl button - 90cm / Yellow
+17
Baby Girls Cotton Knit Cardigan Hollow Out Pointelle Bolero Shrug Sun Protection Thin Summer Outerwear For Toddler Baby
-4%
$9.40
No MOQ
Free Shipping
Toddler Girls 3 Piece Clothing Set Peter Pan Collar Jacket Long Sleeve Shirt Lace Trim Pants Floral Bear Prints Baby Outfit
Toddler Girls 3 Piece Clothing Set Peter Pan Collar Jacket Long Sleeve Shirt Lace Trim Pants Floral Bear Prints Baby Outfit
like
Find Similar
Three-piece baby girl floral jacket with lace Peter Pan collar shirt and pink pants set - 73cm / Pink Jacket + Long Sleeve Top + Pants (3-Piece)
Toddler Girls 3 Piece Clothing Set Peter Pan Collar Jacket Long Sleeve Shirt Lace Trim Pants Floral Bear Prints Baby Outfit
$25.65
No MOQ
Newborn Baby Quilted Cotton Romper Thermal Long Sleeve Jumpsuit Cute Cartoon Printed Air Cotton Infant Bodysuit Pajamas
Newborn Baby Quilted Cotton Romper Thermal Long Sleeve Jumpsuit Cute Cartoon Printed Air Cotton Infant Bodysuit Pajamas
like
Find Similar
Macro detail of infant cotton romper with pink floral bunny print and snap buttons - Size 59 / Pink Flower Rabbit
Close-up of quilted cotton baby romper with heart and bear prints and snap button closure - Size 59 / Yellow Little Angel
Detailed view of baby quilted cotton romper with elephant and deer cartoon prints - Size 59 / Blue Star Elephant
Detail of baby quilted cotton romper with bear prints and ribbed collar and cuffs - Size 59 / Orange Floral Bear
+21
Newborn Baby Quilted Cotton Romper Thermal Long Sleeve Jumpsuit Cute Cartoon Printed Air Cotton Infant Bodysuit Pajamas
$5.33
No MOQ
Baby Quilted Cotton Romper Warm Winter Jumpsuit With Cartoon Caterpillar Applique Newborn Long Sleeve Snap Romper
Baby Quilted Cotton Romper Warm Winter Jumpsuit With Cartoon Caterpillar Applique Newborn Long Sleeve Snap Romper
like
Find Similar
Detail of baby quilted romper with light blue diamond stitching and caterpillar embroidery - Size 100 / Blue
Detail of yellow quilted cotton baby onesie featuring a rainbow caterpillar embroidery - Size 100 / Yellow
Detailed close-up of quilted pink baby romper featuring a colorful caterpillar patch - Size 100 / Pink
+12
Baby Quilted Cotton Romper Warm Winter Jumpsuit With Cartoon Caterpillar Applique Newborn Long Sleeve Snap Romper
$6.48
No MOQ
Newborn Baby Thickened Warm Cotton Romper Long Sleeve Kimono Jumpsuit Cute Cartoon Printed Infact Bodysuit Outfit For Winter
Newborn Baby Thickened Warm Cotton Romper Long Sleeve Kimono Jumpsuit Cute Cartoon Printed Infact Bodysuit Outfit For Winter
like
Find Similar
Detail of pink floral baby romper featuring cute bunny prints and cotton quilted texture - Pink Flower Rabbit / 52cm
Detail of soft quilted cotton baby romper with cute animal prints and side ties - Blue Star Elephant / 52cm
+4
Newborn Baby Thickened Warm Cotton Romper Long Sleeve Kimono Jumpsuit Cute Cartoon Printed Infact Bodysuit Outfit For Winter
$4.76
No MOQ
Baby Girl Floral Romper Cotton Lace Square Collar Flutter Sleeve Summer Jumpsuit Newborn Infant Pastoral Style Bodysuit
Baby Girl Floral Romper Cotton Lace Square Collar Flutter Sleeve Summer Jumpsuit Newborn Infant Pastoral Style Bodysuit
like
Find Similar
Baby girl floral romper in cream white with vintage lace collar and ruffled sleeves - 66CM / Off White
Baby Girl Floral Romper Cotton Lace Square Collar Flutter Sleeve Summer Jumpsuit Newborn Infant Pastoral Style Bodysuit
$9.22
No MOQ
Free Shipping
Infant Quilted Cotton Padded Romper Winter Thick Warm Baby Jumpsuit For Newborn Boys Girls Autumn Winter Outdoor Wear
Infant Quilted Cotton Padded Romper Winter Thick Warm Baby Jumpsuit For Newborn Boys Girls Autumn Winter Outdoor Wear
like
Find Similar
Light blue quilted baby romper with diamond pattern and cute duck patch design - Blue / 73cm
Infant Quilted Cotton Padded Romper Winter Thick Warm Baby Jumpsuit For Newborn Boys Girls Autumn Winter Outdoor Wear
$16.43
No MOQ
Toddler Girls Corduroy Three Piece Set Monogram Letter Print Jacket T-Shirt And Pants Autumn Spring Clothing Set
Toddler Girls Corduroy Three Piece Set Monogram Letter Print Jacket T-Shirt And Pants Autumn Spring Clothing Set
like
Find Similar
Pink corduroy three-piece girls outfit with letter print jacket and matching pants - 80cm / Brick Red
Toddler girl 3-piece corduroy clothing set with vintage B-pattern jacket and pants - 80cm / Coffee
+8
Toddler Girls Corduroy Three Piece Set Monogram Letter Print Jacket T-Shirt And Pants Autumn Spring Clothing Set
$13.83
No MOQ
Kids Cotton Vest Sleeveless Jacket Single Breasted Cargo Style Waistcoat Hey Let's Go Print For Boys Girls Summer Fashion
Kids Cotton Vest Sleeveless Jacket Single Breasted Cargo Style Waistcoat Hey Let's Go Print For Boys Girls Summer Fashion
like
Find Similar
Detailed view of beige cotton kids vest with HEY LET'S GO print and dark buttons - Beige Apricot / 80cm
Detail of dark grey kids cotton utility vest with three buttons and HEY graphic print - Dark Gray / 80cm
+10
Kids Cotton Vest Sleeveless Jacket Single Breasted Cargo Style Waistcoat Hey Let's Go Print For Boys Girls Summer Fashion
$7.78
No MOQ
Free Shipping
Kids Cooling Cotton Blend T-Shirt Letter Print Short Sleeve Top Contrast Stitching Casual Children Summer Clothes
Kids Cooling Cotton Blend T-Shirt Letter Print Short Sleeve Top Contrast Stitching Casual Children Summer Clothes
like
Find Similar
Kids quick-dry mustard yellow t-shirt with 'Growing time' print for summer outdoor activities - 80 / Green
Creamy white kids short sleeve T-shirt with red contrast stitching and text print - 80 / White
+12
Kids Cooling Cotton Blend T-Shirt Letter Print Short Sleeve Top Contrast Stitching Casual Children Summer Clothes
$7.93
Mix MOQ : 2
Newborn Baby Cotton Belly Band Summer Thin Mesh Breathable Halter Belly Guard With Snap Buttons For Infants Toddlers
Newborn Baby Cotton Belly Band Summer Thin Mesh Breathable Halter Belly Guard With Snap Buttons For Infants Toddlers
like
Find Similar
Light pink cotton infant belly band with breathable mesh fabric for summer comfort - Size 59 / Orange Pink
Infant summer thin cotton belly wrap vest in mint green with breathable mesh design - Size 59 / Aqua
Breathable baby pink cotton mesh tummy warmer with snap buttons for summer - Size 59 / Smoky Purple
Infant cotton mesh belly band in cream white with vertical stripes for summer cooling - Size 59 / Milk Yellow
+16
NewNewborn Baby Cotton Belly Band Summer Thin Mesh Breathable Halter Belly Guard With Snap Buttons For Infants Toddlers
$2.45
No MOQ
Free Shipping
Newborn Baby Cotton Long Sleeve Romper Breathable Thin Side Opening Jumpsuit Soft Pointelle Pajamas For Infant Summer Air Conditioning Clothes
Newborn Baby Cotton Long Sleeve Romper Breathable Thin Side Opening Jumpsuit Soft Pointelle Pajamas For Infant Summer Air Conditioning Clothes
like
Find Similar
Soft cotton long sleeve baby romper in light green with vertical knit texture and snaps - Size 59 / Aqua
Light pink long-sleeve baby bodysuit in breathable rib-knit cotton with snap closure - Size 59 / Orange Pink
Light pink newborn cotton romper with vertical breathable texture and snap closure - Size 59 / Smoky Purple
Long-sleeve cotton baby romper in cream white with ribbed texture and side buttons - Size 59 / Milk Yellow
+16
Newborn Baby Cotton Long Sleeve Romper Breathable Thin Side Opening Jumpsuit Soft Pointelle Pajamas For Infant Summer Air Conditioning Clothes
$5.33
No MOQ
Boys Striped Polo Shirt Short Sleeve Cotton Blend Embroidered Bear Summer Casual Top Korean Style Breathable Clothes
Boys Striped Polo Shirt Short Sleeve Cotton Blend Embroidered Bear Summer Casual Top Korean Style Breathable Clothes
like
Find Similar
Kids striped cotton polo shirt with navy blue collar and teddy bear embroidery - 90 / White Striped
Children's short sleeve striped Polo shirt with cute bear embroidery on chest - 90 / Black Stripe
+8
Boys Striped Polo Shirt Short Sleeve Cotton Blend Embroidered Bear Summer Casual Top Korean Style Breathable Clothes
-4%
$5.34
No MOQ
Baby Girl Floral Turban Hat Gold Stamping Flower Infant Toddler Beanie Soft Elastic Pullover Hat For Daily Photography Accessory
Baby Girl Floral Turban Hat Gold Stamping Flower Infant Toddler Beanie Soft Elastic Pullover Hat For Daily Photography Accessory
like
Find Similar
Detail of baby turban hat with golden foil flower print and mesh flower applique - Yellow Floral Style (A)
Navy floral baby turban with large pink gold-dotted chiffon flower for toddlers - Letter B
Detail of baby turban hat featuring pink floral pattern and gold polka dot mesh flower - Letter C
Detail of baby turban hat with vintage floral print and large blue mesh gold-dotted flower - Sky Blue Floral Style (D)
+4
Baby Girl Floral Turban Hat Gold Stamping Flower Infant Toddler Beanie Soft Elastic Pullover Hat For Daily Photography Accessory
$0.95
No MOQ
Go to

More in baby & kids

Explore more in bibs

babylayerpolyesterboysstrapbandhandmaterialkerchiefface
solid colorstylepetkidsheartwarmdesignmetalwhiteears

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access