Everful

Wholesale bibs

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Bibs

Find the perfect pieces: toys & games, kids bags, baby clothing & essentials and more

All products in bibs

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Kids Sporty Cotton Blend Sweatshirt And Pants Outfit Cute Cartoon Monster Printed Heather Grey Toddler Clothing Set
Kids Sporty Cotton Blend Sweatshirt And Pants Outfit Cute Cartoon Monster Printed Heather Grey Toddler Clothing Set
like
Find Similar
Grey marl cotton toddler tracksuit featuring cartoon embroidery and ribbed cuffs - Light Grey / 80
+5
Kids Sporty Cotton Blend Sweatshirt And Pants Outfit Cute Cartoon Monster Printed Heather Grey Toddler Clothing Set
$17.12
No MOQ
Free Shipping
Baby Boy Knitted Set Long Sleeve Polo Shirt And Suspender Shorts And Beret Hat Toddler Outfit For Spring Autumn
Baby Boy Knitted Set Long Sleeve Polo Shirt And Suspender Shorts And Beret Hat Toddler Outfit For Spring Autumn
like
Find Similar
Close-up of sage green knitted overalls with diamond pattern and cream polo shirt - 66CM / Green
Detail of baby boy knit outfit with beige polo sweater and brown overall shorts - 66CM / Carbon Color
Detail of baby knit set featuring textured yellow suspenders and beige sweater - 90cm / Yellow
Flat lay of knit baby set showing detailed beige long sleeve top and brown suspender shorts - 90cm / Brown
+2
Baby Boy Knitted Set Long Sleeve Polo Shirt And Suspender Shorts And Beret Hat Toddler Outfit For Spring Autumn
-7%
$13.24
Mix MOQ : 2
Baby Girl Quilted Hooded Romper Autumn Winter Warm Cotton Padded Jumpsuit Pink Floral Bow One Piece Toddler Bodysuit
Baby Girl Quilted Hooded Romper Autumn Winter Warm Cotton Padded Jumpsuit Pink Floral Bow One Piece Toddler Bodysuit
like
Find Similar
Cozy pink quilted baby romper with floral hood lining and bow accents for winter warmth - 66CM / Pink
NewBaby Girl Quilted Hooded Romper Autumn Winter Warm Cotton Padded Jumpsuit Pink Floral Bow One Piece Toddler Bodysuit
$19.31
No MOQ
Girls Hooded Windbreaker Jacket Pink Patchwork Bow Pockets Kitty Embroidery Polyester Toddler Autumn Casual Outerwear Coat
Girls Hooded Windbreaker Jacket Pink Patchwork Bow Pockets Kitty Embroidery Polyester Toddler Autumn Casual Outerwear Coat
like
Find Similar
Girls windbreaker hooded jacket featuring pink patchwork and bow pockets in sweet style - Pink / 73cm
Girls Hooded Windbreaker Jacket Pink Patchwork Bow Pockets Kitty Embroidery Polyester Toddler Autumn Casual Outerwear Coat
$16.71
No MOQ
Kids Reversible Cotton Vest Korean Style Polka Dot Diamond Quilted Button Down Waistcoat For Boys Girls Casual Sleeveless Top
Kids Reversible Cotton Vest Korean Style Polka Dot Diamond Quilted Button Down Waistcoat For Boys Girls Casual Sleeveless Top
like
Find Similar
Detailed view of reversible quilted toddler vest with polka dot print and button closure - 80cm / Brown
Close-up of kids reversible vest showing grey quilted texture and white polka dot lining - 80cm / Black
+9
Kids Reversible Cotton Vest Korean Style Polka Dot Diamond Quilted Button Down Waistcoat For Boys Girls Casual Sleeveless Top
$8.07
No MOQ
Baby Cotton Quilted Warm Clothing Set Cartoon Dragon Print High Waist Belly Protection Infants Long Sleeve Top And Pants
Baby Cotton Quilted Warm Clothing Set Cartoon Dragon Print High Waist Belly Protection Infants Long Sleeve Top And Pants
like
Find Similar
Quilted red baby thermal underwear set with festive dragon embroidery and Fu character - 66CM / Red
Quilted cotton baby thermal loungewear set with red festive dragon embroidery - 66CM / Off White
+6
Baby Cotton Quilted Warm Clothing Set Cartoon Dragon Print High Waist Belly Protection Infants Long Sleeve Top And Pants
-4%
$8.08
No MOQ
Toddler Boys Cartoon Dinosaur Full Print Sweatshirt Soft Cotton Blend Long Sleeve Pullover Spring Autumn Kids Casual Top
Toddler Boys Cartoon Dinosaur Full Print Sweatshirt Soft Cotton Blend Long Sleeve Pullover Spring Autumn Kids Casual Top
like
Find Similar
Kids grey long sleeve sweatshirt with dinosaur print and ribbed cuffs for boys - 100cm / Gray
Kids long sleeve crewneck sweatshirt in navy blue with all-over white dinosaur print - 100cm / Navy Blue
+3
Toddler Boys Cartoon Dinosaur Full Print Sweatshirt Soft Cotton Blend Long Sleeve Pullover Spring Autumn Kids Casual Top
$6.20
No MOQ
Baby Girls Knitted Cardigan And Flare Pants Set Bow Argyle Pattern Long Sleeve Knitwear Sweater Outfit For Toddler Girls
Baby Girls Knitted Cardigan And Flare Pants Set Bow Argyle Pattern Long Sleeve Knitwear Sweater Outfit For Toddler Girls
like
Find Similar
Detail of baby knit cardigan featuring diamond textures and elegant black bow embroidery - 73cm / Argyle Knitted Cardigan (Apricot)
Detail of girls' black flared pants featuring white bows and premium stitched seams - 73cm / Bow Decorated Flare Pants (Black)
+10
Baby Girls Knitted Cardigan And Flare Pants Set Bow Argyle Pattern Long Sleeve Knitwear Sweater Outfit For Toddler Girls
-4%
$7.37-12.58
Mix MOQ : 2
Baby Boy Summer Romper Cotton Blend Van Gogh Art Print Short Sleeve Jumpsuit Artistic Newborn Outing Clothes One Piece
Baby Boy Summer Romper Cotton Blend Van Gogh Art Print Short Sleeve Jumpsuit Artistic Newborn Outing Clothes One Piece
like
Find Similar
Short sleeve white cotton baby romper with Van Gogh style artsy prints and snaps - Orange / 66CM
Baby Boy Summer Romper Cotton Blend Van Gogh Art Print Short Sleeve Jumpsuit Artistic Newborn Outing Clothes One Piece
-11%
$7.86
No MOQ
Boys Christmas Joggers Cotton Elastic Waist Drawstring Pants Festive Cartoon Dinosaur Santa Print Autumn Winter Sweatpants
Boys Christmas Joggers Cotton Elastic Waist Drawstring Pants Festive Cartoon Dinosaur Santa Print Autumn Winter Sweatpants
like
Find Similar
Children's gray joggers with festive Christmas patterns featuring Santa and nutcrackers - 2Y(90cm) / Gray Cartoon Print
+5
NewBoys Christmas Joggers Cotton Elastic Waist Drawstring Pants Festive Cartoon Dinosaur Santa Print Autumn Winter Sweatpants
$7.15
No MOQ
Kids Cotton Linen Shorts Summer Breathable Casual Loose Bottoms Elastic Waist Children Solid Color Toddler Unisex Pants
Kids Cotton Linen Shorts Summer Breathable Casual Loose Bottoms Elastic Waist Children Solid Color Toddler Unisex Pants
like
Find Similar
Close-up detail of breathable cotton linen texture and elastic waistband on kids' shorts - 80cm / Beige Apricot
Kids linen cotton shorts in rust red and neutral tones with elastic waist for summer - 80cm / Walnut Brown
Breathable cotton linen blend kids shorts in green red and beige colors detail - 80cm / Olive Green
+15
Kids Cotton Linen Shorts Summer Breathable Casual Loose Bottoms Elastic Waist Children Solid Color Toddler Unisex Pants
$8.93
No MOQ
Free Shipping
Kids Cotton Striped T-Shirt Summer Short Sleeve Round Neck Macaron Color Korean Style Casual Top For Boys Girls Baby
Kids Cotton Striped T-Shirt Summer Short Sleeve Round Neck Macaron Color Korean Style Casual Top For Boys Girls Baby
like
Find Similar
Close-up of yellow and white striped cotton knit T-shirt for children with crew neck detail - 80cm / Light Yellow
Detail showing high-quality grey striped cotton t-shirt fabric and neck stitching - 80cm / Light Gray
Detail of green and white striped cotton t-shirt with reinforced crew neck for kids - 80cm / Light Green
Detailed view of pink and white striped cotton T-shirt with soft fabric texture and round neck - 80cm / Silt Pink
+20
Kids Cotton Striped T-Shirt Summer Short Sleeve Round Neck Macaron Color Korean Style Casual Top For Boys Girls Baby
$7.78
No MOQ
Free Shipping
Korean Style Kids Cotton Harem Pants Loose Casual Elastic Waist Pleated Cuff Trousers For Boys Girls Solid Color Pants
Korean Style Kids Cotton Harem Pants Loose Casual Elastic Waist Pleated Cuff Trousers For Boys Girls Solid Color Pants
like
Find Similar
Detail of children's brick red fleece pants with elastic waistband and pleated hem - 80cm / Red Brown
Detail showing elastic waistband and pleated cuffs of kids thick olive harem pants - 80cm / Army Coffee
+10
Korean Style Kids Cotton Harem Pants Loose Casual Elastic Waist Pleated Cuff Trousers For Boys Girls Solid Color Pants
$9.51
No MOQ
Baby Crown Headband Sparkly Glitter Star Rhinestone Elastic Hair Band Birthday Party Photography Prop Infant Toddler Girls
Baby Crown Headband Sparkly Glitter Star Rhinestone Elastic Hair Band Birthday Party Photography Prop Infant Toddler Girls
like
Find Similar
Detail of baby crown headband with gold glitter, star, and rhinestones on white ceramic - Gold
Close-up of a silver glitter crown headband with star details on a white tea cup - Silver
Sparkling blue crown headband for babies with silver elastic strap and rhinestone stars - Blue
Detail of pink sequin crown baby headband with sparkling star and rhinestone accents - Rose Red
+13
Baby Crown Headband Sparkly Glitter Star Rhinestone Elastic Hair Band Birthday Party Photography Prop Infant Toddler Girls
$0.33
Mix MOQ : 20
 · 
72 sold recently
Chinese Style Baby Romper Long Sleeve Cotton Floral Bird Print Jumpsuit For Newborn Infants Autumn Spring Clothing
Chinese Style Baby Romper Long Sleeve Cotton Floral Bird Print Jumpsuit For Newborn Infants Autumn Spring Clothing
like
Find Similar
Flat lay of baby romper with floral bird print and green ruffle details on grey background - 73cm / Birds on Branch
Chinese Style Baby Romper Long Sleeve Cotton Floral Bird Print Jumpsuit For Newborn Infants Autumn Spring Clothing
-5%
$7.39
No MOQ
Baby Girl Elastic Lace Headband With Chiffon Flowers Floral Hair Band For Newborn Infant Toddler Photo Prop Sweet Style
Baby Girl Elastic Lace Headband With Chiffon Flowers Floral Hair Band For Newborn Infant Toddler Photo Prop Sweet Style
like
Find Similar
Elastic white lace baby headband featuring two light pink tulle flowers with yellow stamens - Pink
Elastic baby headband with lace and floral mesh decorations for infants and toddlers - Off White
Elastic baby lace headband with 3D mesh flowers in beige and grey for infant girls - Beige Grey
Elastic baby lace headband featuring 3D chiffon flowers in soft pink and grey colors - Pinkish Grey
+2
Baby Girl Elastic Lace Headband With Chiffon Flowers Floral Hair Band For Newborn Infant Toddler Photo Prop Sweet Style
$1.04
Mix MOQ : 2
 · 
11 views
Kids Summer Cotton Short Sleeve T-Shirt Purple Loose Smiley Face Embroidered Top For Boys Girls Korean Style Casual Apparel
Kids Summer Cotton Short Sleeve T-Shirt Purple Loose Smiley Face Embroidered Top For Boys Girls Korean Style Casual Apparel
like
Find Similar
Kids lavender cotton short sleeve T-shirt with a small embroidered heart smile face - Purple / 80cm
+5
Kids Summer Cotton Short Sleeve T-Shirt Purple Loose Smiley Face Embroidered Top For Boys Girls Korean Style Casual Apparel
$6.63
No MOQ
Free Shipping
Girls Clothing Set Embroidered Knit Vest Ruffle Shirt And Flare Jeans Cotton Outfit For Kids Casual Daily Fashion
Girls Clothing Set Embroidered Knit Vest Ruffle Shirt And Flare Jeans Cotton Outfit For Kids Casual Daily Fashion
like
Find Similar
Girls mint green knit vest featuring floral embroidery and ribbed hem finish - Blue Vest / 80
Three-piece girls' outfit with blue floral knit vest, white shirt and lace-up jeans - White (3-Piece Set) / 80
Girls 3-piece set with white ruffle shirt and blue denim flare pants with lace trim - White (Shirt + Jeans) / 80
Pink knitted vest with white shirt and lace-trimmed jeans 3-piece set for girls - Pink (3-Piece Set) / 80
+38
Girls Clothing Set Embroidered Knit Vest Ruffle Shirt And Flare Jeans Cotton Outfit For Kids Casual Daily Fashion
-4%
$10.28-32.86
No MOQ
 · 
12 views
Free Shipping
Toddler Kids Summer Muslin Sleeveless Vest Breathable Cotton V-Neck Solid Color Tank Top Casual Boys Girls Clothes
Toddler Kids Summer Muslin Sleeveless Vest Breathable Cotton V-Neck Solid Color Tank Top Casual Boys Girls Clothes
like
Find Similar
Close-up of beige sleeveless toddler top showing breathable cotton linen fabric texture - 80cm / Beige
Breathable cotton linen summer tank tops for toddlers in natural earth tone colors - 80cm / Khaki
Flat lay of breathable cotton sleeveless vests in earthy tones for children fashion - 80cm / Purple and Coffee
+15
Toddler Kids Summer Muslin Sleeveless Vest Breathable Cotton V-Neck Solid Color Tank Top Casual Boys Girls Clothes
$6.60
No MOQ
 · 
10 views
Free Shipping
Baby Girl Lace Headband With Bow Artificial Pearl Rhinestone Elastic Hair Band Princess Headpiece For Newborn Infant Photography
Baby Girl Lace Headband With Bow Artificial Pearl Rhinestone Elastic Hair Band Princess Headpiece For Newborn Infant Photography
like
Find Similar
Sweet white lace bow headband for baby girls with vintage floral pattern texture - White Lace Bow
Pink lace baby headband with large bow floral hair accessory for newborn girls - Orange Pink Lace Bow
Elastic baby lace headband featuring a beige satin bow on a soft butterfly lace band - D20 Double Layer Bow Narrow Headband
Elegant beige lace baby headband with large bow detail on soft textured background - Beige Lace Bow
+5
Baby Girl Lace Headband With Bow Artificial Pearl Rhinestone Elastic Hair Band Princess Headpiece For Newborn Infant Photography
-5%
$0.74-0.92
No MOQ
Kids Boys Girls 100 Percent Cotton Combed Sweatshirt Rainbow Happy Embroidered Long Sleeve Crewneck Pullover Bright Yellow Top
Kids Boys Girls 100 Percent Cotton Combed Sweatshirt Rainbow Happy Embroidered Long Sleeve Crewneck Pullover Bright Yellow Top
like
Find Similar
Kids yellow crewneck sweatshirt featuring rainbow patch and HAPPY embroidery - 6Y / Bright Yellow
+5
Kids Boys Girls 100 Percent Cotton Combed Sweatshirt Rainbow Happy Embroidered Long Sleeve Crewneck Pullover Bright Yellow Top
-7%
$6.32
No MOQ
Baby Girl Winter Down Jumpsuit Floral Bow Hooded Warm Snowsuit Outdoor Romper Quilted White Duck Down Toddler Bodysuit
Baby Girl Winter Down Jumpsuit Floral Bow Hooded Warm Snowsuit Outdoor Romper Quilted White Duck Down Toddler Bodysuit
like
Find Similar
Winter infant floral down romper with hooded bow design and warm white padding - Apricot / 66CM
+4
Baby Girl Winter Down Jumpsuit Floral Bow Hooded Warm Snowsuit Outdoor Romper Quilted White Duck Down Toddler Bodysuit
$38.90
No MOQ
Free Shipping
Childrens Winter Thickened Dinosaur Hooded Suit Boys Fleece Jacket Pants Two Piece Set Cute Korean Style Baby Outfit
Childrens Winter Thickened Dinosaur Hooded Suit Boys Fleece Jacket Pants Two Piece Set Cute Korean Style Baby Outfit
like
Find Similar
Winter dinosaur hooded fleece set for boys with 3D dinosaur pocket and fin details - 80cm / Army Green
+4
Childrens Winter Thickened Dinosaur Hooded Suit Boys Fleece Jacket Pants Two Piece Set Cute Korean Style Baby Outfit
$14.41
No MOQ
Kids Summer Cotton Cargo Shorts Boys Girls Casual Elastic Waist Solid Color Pants With Multi Pockets Toddler Baby Loose Bottoms
Kids Summer Cotton Cargo Shorts Boys Girls Casual Elastic Waist Solid Color Pants With Multi Pockets Toddler Baby Loose Bottoms
like
Find Similar
Brown cotton cargo shorts for kids featuring elastic waist and large side flap pockets - 80cm / Dark Coffee
Flat lay of khaki cotton cargo shorts featuring drawstring waist and side utility pockets - 80cm / Khaki
+10
Kids Summer Cotton Cargo Shorts Boys Girls Casual Elastic Waist Solid Color Pants With Multi Pockets Toddler Baby Loose Bottoms
$9.51
No MOQ
Free Shipping
Korean Style Kids Cotton Short Sleeve T-Shirt Letter Print Summer Loose Casual Top For Toddler Boys Girls
Korean Style Kids Cotton Short Sleeve T-Shirt Letter Print Summer Loose Casual Top For Toddler Boys Girls
like
Find Similar
Detailed flat lay of children's cotton T-shirt with OR print in charcoal grey - Grey Coffee / 80cm
Detailed flat lay of children minimalist short-sleeved t-shirt with black graphic print - Milk Tea Apricot / 80cm
+10
Korean Style Kids Cotton Short Sleeve T-Shirt Letter Print Summer Loose Casual Top For Toddler Boys Girls
$7.20
No MOQ
Free Shipping
Toddler Boys Long Sleeve Striped Shirt And Denim Pants Christmas Tree Printed Clothes For Autumn Spring Boys Clothing
Toddler Boys Long Sleeve Striped Shirt And Denim Pants Christmas Tree Printed Clothes For Autumn Spring Boys Clothing
like
Find Similar
Boy's two-piece set featuring striped printed shirt and elastic waist denim pants - 80cm / Blue
Children's long-sleeve Christmas tree print shirt and dark blue denim jeans outfit set - 80cm / Purple
Toddler boys long sleeve Christmas tree print striped shirt and denim jeans set - 80cm / Green
+12
Toddler Boys Long Sleeve Striped Shirt And Denim Pants Christmas Tree Printed Clothes For Autumn Spring Boys Clothing
-5%
$9.03
No MOQ
Kids Cotton Long Sleeve Polo Shirt Korean Retro Letter Print Lapel Top For Boys Girls Casual Daily School Wear
Kids Cotton Long Sleeve Polo Shirt Korean Retro Letter Print Lapel Top For Boys Girls Casual Daily School Wear
like
Find Similar
Detailed view of the ribbed cuffs and KWAY printed logo on a black cotton Polo shirt - 80cm / Charcoal Black
Close-up of kids long sleeve polo shirt with classic collar and chest print detail - 80cm / Apricot
+10
Kids Cotton Long Sleeve Polo Shirt Korean Retro Letter Print Lapel Top For Boys Girls Casual Daily School Wear
$9.22
No MOQ
Free Shipping
Round Cotton Pads Pure Cotton Disposable Dual Sided Makeup Remover Pads For Facial Cleansing Skin Care Lint Free
Round Cotton Pads Pure Cotton Disposable Dual Sided Makeup Remover Pads For Facial Cleansing Skin Care Lint Free
like
Find Similar
100pcs round cotton pads in pink Di Bear drawstring bag for makeup removal - Plain & Mesh Sides - Pink Chinese Pack / 100Pcs/Pack
Three packs of premium round cotton pads for makeup removal, 100 pieces per bag - Plain & Mesh Sides - New English Pack / 100Pcs/Pack
100 PCS white round cotton pads with embossing design and multi layer soft texture - Large Pearl Pattern - English Pack / 100Pcs/Pack
100 count pack of round white quilted cotton pads with a lint-free embossing design - Wave Pattern - English Pack / 100Pcs/Pack
+1
Round Cotton Pads Pure Cotton Disposable Dual Sided Makeup Remover Pads For Facial Cleansing Skin Care Lint Free
$0.98
No MOQ
 · 
36 views
Boys Summer Sleeveless Cargo Romper 100% Cotton Letter Print Summer One Piece Jumpsuit With Belt Zipper Kids Casual Clothes
Boys Summer Sleeveless Cargo Romper 100% Cotton Letter Print Summer One Piece Jumpsuit With Belt Zipper Kids Casual Clothes
like
Find Similar
Boys beige sleeveless utility romper with zipper closure and black buckle belt - 80 / Off-white
Toddler boys black sleeveless utility jumpsuit with zipper and multi-pocket detail - 80 / Black
+8
Boys Summer Sleeveless Cargo Romper 100% Cotton Letter Print Summer One Piece Jumpsuit With Belt Zipper Kids Casual Clothes
-34%
$8.34
No MOQ
Toddler Kids Striped Denim Pants Casual Loose Straight Leg Jeans With Elastic Waist Vintage Sand Washed Cotton Trousers
Toddler Kids Striped Denim Pants Casual Loose Straight Leg Jeans With Elastic Waist Vintage Sand Washed Cotton Trousers
like
Find Similar
Detailed shot of kids vertical striped denim shorts with elastic waistband and button - 80cm / Retro Blue Stripes
+5
Toddler Kids Striped Denim Pants Casual Loose Straight Leg Jeans With Elastic Waist Vintage Sand Washed Cotton Trousers
$13.26
No MOQ
Free Shipping
Baby Girls Sweet Floral Long Sleeve Lace Top And Cotton Overalls Two Piece Outfits Spring Toddler Soft Clothing
Baby Girls Sweet Floral Long Sleeve Lace Top And Cotton Overalls Two Piece Outfits Spring Toddler Soft Clothing
like
Find Similar
Floral baby romper with lace collar and long sleeves, sweet spring outfit for toddlers - 73cm / Pink
Baby Girls Sweet Floral Long Sleeve Lace Top And Cotton Overalls Two Piece Outfits Spring Toddler Soft Clothing
$17.87
No MOQ
Free Shipping
Baby Girl Knitted Turban Hat With 3D Chiffon Flowers Artificial Pearl Rhinestone Soft Ribbed Beanie For Infants Toddlers
Baby Girl Knitted Turban Hat With 3D Chiffon Flowers Artificial Pearl Rhinestone Soft Ribbed Beanie For Infants Toddlers
like
Find Similar
Close-up of baby red knitted turban hat with decorative mesh flowers and red pearls - One Size / Red
Detail of yellow knit baby turban hat with chiffon flowers, pearls and rhinestones - One Size / Yellow
Detailed texture of lavender knitted baby hat with chiffon flowers, pearls, and rhinestones - One Size / Purple
Detail of baby knitted hat with three black fabric flowers and beaded centers - One Size / Black
+8
Baby Girl Knitted Turban Hat With 3D Chiffon Flowers Artificial Pearl Rhinestone Soft Ribbed Beanie For Infants Toddlers
$1.33
No MOQ
Little Maven Girls Cotton Sweatshirt Leggings Set Long Sleeve Pink Heart Letter Print Toddler Casual 2 Piece Autumn Outfit
Little Maven Girls Cotton Sweatshirt Leggings Set Long Sleeve Pink Heart Letter Print Toddler Casual 2 Piece Autumn Outfit
like
Find Similar
Pink cotton girls sweatshirt with Do What You Love heart print and ribbed cuffs - 4Y(110cm) / Rose Pink Top Only (Without Pants) (22041T)
Girls pink cotton leggings with red heart pattern and ribbed texture detail - 2Y(90cm) / Pink Heart Leggings Only (Without Top) (22041K)
+6
Little Maven Girls Cotton Sweatshirt Leggings Set Long Sleeve Pink Heart Letter Print Toddler Casual 2 Piece Autumn Outfit
$4.81-5.36
No MOQ
Girls Winter Quilted Fleece Lined Warm Pants Cute Rabbit Embroidery Pink Jogger Cotton Padded Trousers For Kids Cold Weather
Girls Winter Quilted Fleece Lined Warm Pants Cute Rabbit Embroidery Pink Jogger Cotton Padded Trousers For Kids Cold Weather
like
Find Similar
Pink fleece lined quilted pants for girls with cute white rabbit embroidery detail - 80 / Pink
+6
Girls Winter Quilted Fleece Lined Warm Pants Cute Rabbit Embroidery Pink Jogger Cotton Padded Trousers For Kids Cold Weather
$15.82
No MOQ
Baby Padded Romper Chinese Style Knot Button Newborn Thickened Cotton Jumpsuit Winter Outwear For Boys Girls 1st Birthday Outfit
Baby Padded Romper Chinese Style Knot Button Newborn Thickened Cotton Jumpsuit Winter Outwear For Boys Girls 1st Birthday Outfit
like
Find Similar
Pink Chinese style baby quilted winter romper with traditional knot buttons and fur trim - 59 / Ancient Rhyme Pink
+4
Baby Padded Romper Chinese Style Knot Button Newborn Thickened Cotton Jumpsuit Winter Outwear For Boys Girls 1st Birthday Outfit
$12.39
No MOQ
Baby Girls Floral Romper Cotton Lace Collar Long Sleeve Jumpsuit Newborn Infant Bodysuit Spring Autumn Casual Clothes
Baby Girls Floral Romper Cotton Lace Collar Long Sleeve Jumpsuit Newborn Infant Bodysuit Spring Autumn Casual Clothes
like
Find Similar
Infant long sleeve floral cotton romper with lace collar in cream white finish - Size 59 / Light Apricot Vine Style
Baby cotton floral romper with elegant white lace collar and front button closure - Size 59 / Milk White Floral Style
+8
Baby Girls Floral Romper Cotton Lace Collar Long Sleeve Jumpsuit Newborn Infant Bodysuit Spring Autumn Casual Clothes
$5.76
No MOQ
Baby Headbands Soft Elastic Nylon Hair Bands Handmade Floral Bow Accessories For Newborn Toddler Girls Infant Kids
Baby Headbands Soft Elastic Nylon Hair Bands Handmade Floral Bow Accessories For Newborn Toddler Girls Infant Kids
like
Find Similar
Handmade Morandi pink flower nylon headband for baby girls with high elastic nude band - Morandi Pink Cloth Flower (1)
Sunflower nylon baby headband with yellow felt petals and elastic soft nylon band - Sunflower Felt Style (2)
Brown knitted flower nylon headband for babies with elastic soft hair band for infants - Dark Brown Knitted Rose (3)
Detail of pink fabric flower baby headband with soft plush balls on nylon band - Pink Twill Sunflower Pom Pom (4)
+7
Baby Headbands Soft Elastic Nylon Hair Bands Handmade Floral Bow Accessories For Newborn Toddler Girls Infant Kids
-6%
$0.45-4.94
Mix MOQ : 2
Baby Long Sleeve Romper Polka Dot Giraffe Pattern Viscose Blend Jumpsuit Class A Soft Infant Spring Autumn One Piece Clothes
Baby Long Sleeve Romper Polka Dot Giraffe Pattern Viscose Blend Jumpsuit Class A Soft Infant Spring Autumn One Piece Clothes
like
Find Similar
Baby cotton romper in cream with brown polka dots and giraffe motif decoration - Apricot / 66CM
Baby Long Sleeve Romper Polka Dot Giraffe Pattern Viscose Blend Jumpsuit Class A Soft Infant Spring Autumn One Piece Clothes
$14.99
No MOQ
Free Shipping
Toddler Kids Winter Fleece Plaid Hoodie Pants Set Panda Crossbody Bag Bear Embroidery Thick Warm Baby Clothes Outfit
Toddler Kids Winter Fleece Plaid Hoodie Pants Set Panda Crossbody Bag Bear Embroidery Thick Warm Baby Clothes Outfit
like
Find Similar
Winter fleece children plaid tracksuit with bear embroidery and panda shoulder bag - Dark Gray / 80cm
Winter fleece children tracksuit with teddy embroidery and panda crossbody bag - Tan / 80cm
+8
Toddler Kids Winter Fleece Plaid Hoodie Pants Set Panda Crossbody Bag Bear Embroidery Thick Warm Baby Clothes Outfit
$14.41
No MOQ
Cotton Cable Knit Baby Cardigan Sweater For Infants Toddlers Vintage Crew Neck Long Sleeve Outerwear Top With Wood Buttons
Cotton Cable Knit Baby Cardigan Sweater For Infants Toddlers Vintage Crew Neck Long Sleeve Outerwear Top With Wood Buttons
like
Find Similar
Detailed close-up of cream cable knit cardigan with vintage wooden buttons and matching cap - 66CM / Off White
Detail of cable-knit baby cardigan with dark wooden buttons on white fabric - 90cm / Light Coffee
Close-up of brown cable knit baby cardigan with vintage wooden buttons and cotton cap - 90cm / Brown
+4
Cotton Cable Knit Baby Cardigan Sweater For Infants Toddlers Vintage Crew Neck Long Sleeve Outerwear Top With Wood Buttons
-4%
$11.76
Mix MOQ : 2
Free Shipping
Winter Baby Thickened Romper Mink Velvet Acetate Fiber Tie-Dye Monster Hooded Jumpsuit For Infant Toddler Warm Outdoor Clothes
Winter Baby Thickened Romper Mink Velvet Acetate Fiber Tie-Dye Monster Hooded Jumpsuit For Infant Toddler Warm Outdoor Clothes
like
Find Similar
Baby colorful monster fleece hooded romper with pastel tie-dye pattern and soft ears - Size 73 / Blue Tie Dye
Winter Baby Thickened Romper Mink Velvet Acetate Fiber Tie-Dye Monster Hooded Jumpsuit For Infant Toddler Warm Outdoor Clothes
$19.60
No MOQ
Baby Boy Cartoon Dog Patchwork Long Sleeve Sweatshirt And Jogger Pants Cotton Outfit Spring Autumn Soft Infant Clothing
Baby Boy Cartoon Dog Patchwork Long Sleeve Sweatshirt And Jogger Pants Cotton Outfit Spring Autumn Soft Infant Clothing
like
Find Similar
Baby boy spring cotton two-piece set featuring a cartoon dog print in beige and khaki - 73 / Beige
Baby Boy Cartoon Dog Patchwork Long Sleeve Sweatshirt And Jogger Pants Cotton Outfit Spring Autumn Soft Infant Clothing
-4%
$17.80
No MOQ
Free Shipping
Infant Baby Girls Soft Sole First Walker Sandals Summer Breathable Cotton Bow Tie Elastic Strap Anti-Slip Toddler Shoes
Infant Baby Girls Soft Sole First Walker Sandals Summer Breathable Cotton Bow Tie Elastic Strap Anti-Slip Toddler Shoes
like
Find Similar
Infant yellow bow sandals with soft breathable fabric and elastic heel straps - 13cm / Yellow
Light blue infant sandals with a large bow and elastic strap for a stylish summer look - 13cm / Blue
Infant girls summer sandals in peach pink featuring a large decorative bow and elastic strap - 13cm / Rose Pink
+6
Infant Baby Girls Soft Sole First Walker Sandals Summer Breathable Cotton Bow Tie Elastic Strap Anti-Slip Toddler Shoes
$3.75
No MOQ
Free Shipping
Toddler Boys Cotton Raglan Long Sleeve T-Shirt Cartoon Dinosaur Construction Vehicle Printed Contrast Crew Neck Kids Top
Toddler Boys Cotton Raglan Long Sleeve T-Shirt Cartoon Dinosaur Construction Vehicle Printed Contrast Crew Neck Kids Top
like
Find Similar
Kids orange and white raglan sleeve T-shirt with modern cartoon print and lettering - 90cm / White/Orange Ready Go
Kids long sleeve t-shirt with grey body, orange raglan sleeves and dinosaur print - 90cm / Gray/Orange Dino
Kids long sleeve t-shirt in blue and white raglan style with a cute dinosaur print - White/Blue Letter / 100cm
Kids long sleeve raglan t-shirt in white and light blue featuring cartoon dinosaur prints - White/light Blue Hi Dinosaur / 90cm
+5
Toddler Boys Cotton Raglan Long Sleeve T-Shirt Cartoon Dinosaur Construction Vehicle Printed Contrast Crew Neck Kids Top
$3.60
No MOQ
Baby Mock Neck Thermal Shirt Soft Fleece Lined Bottoming Shirt Acetate Cotton Blend Long Sleeve Top Winter Embroidery
Baby Mock Neck Thermal Shirt Soft Fleece Lined Bottoming Shirt Acetate Cotton Blend Long Sleeve Top Winter Embroidery
like
Find Similar
Pinkish purple warm long sleeve fleece t-shirt for toddlers with winter embroidery - 73cm / Purple
Baby Mock Neck Thermal Shirt Soft Fleece Lined Bottoming Shirt Acetate Cotton Blend Long Sleeve Top Winter Embroidery
$7.78
No MOQ
Baby Girls Cartoon Rabbit Print Sweatshirt Raglan Sleeve Color Block Pullover Top Cotton Blend Autumn Long Sleeve Shirt For Kids
Baby Girls Cartoon Rabbit Print Sweatshirt Raglan Sleeve Color Block Pullover Top Cotton Blend Autumn Long Sleeve Shirt For Kids
like
Find Similar
Toddler raglan sleeve sweatshirt with pink bunny print and brown-pink contrast design - 80 / Brown
+5
Baby Girls Cartoon Rabbit Print Sweatshirt Raglan Sleeve Color Block Pullover Top Cotton Blend Autumn Long Sleeve Shirt For Kids
-24%
$8.68
Mix MOQ : 2
Kids Fashion Cotton Blend Knitted Vest Boys Solid Color Zipper Waistcoat Spring Autumn Casual Sleeveless Jacket Top
Kids Fashion Cotton Blend Knitted Vest Boys Solid Color Zipper Waistcoat Spring Autumn Casual Sleeveless Jacket Top
like
Find Similar
Kids black zip-up fashion vest with leather patch and ribbed hem for autumn wear - 90cm / Black
Blue knitted kids vest with full zipper, ribbed edges, and stylish brown leather patch - 90cm / Blue
Grey knitted kids zipper vest with vertical stripes and stylish leather chest patch - 90cm / Gray
+8
Kids Fashion Cotton Blend Knitted Vest Boys Solid Color Zipper Waistcoat Spring Autumn Casual Sleeveless Jacket Top
-4%
$6.00
No MOQ
Halloween Kids Cotton Clothing Set Bat Moon Print Long Sleeve Sweatshirt And Pants Casual Outfits For Boys Girls
Halloween Kids Cotton Clothing Set Bat Moon Print Long Sleeve Sweatshirt And Pants Casual Outfits For Boys Girls
like
Find Similar
Kids Halloween loungewear set with bat print sweatshirt and pants in soft yellow - 2Y(90) / Beige Bat Print
+5
Halloween Kids Cotton Clothing Set Bat Moon Print Long Sleeve Sweatshirt And Pants Casual Outfits For Boys Girls
$13.83
No MOQ
Baby Girl Bow Headband And Flower Sunglasses Accessory Matching For Toddler Kids Infant Fabric Plastic Cute
Baby Girl Bow Headband And Flower Sunglasses Accessory Matching For Toddler Kids Infant Fabric Plastic Cute
like
Find Similar
Detail of baby headband with blue bow and green flower sunglasses on display card - Deep Blue Bow With Green Flower Glasses (1)
Detail view of mint green bow headband and grey flower sunglasses set on display card - Mint Green Bow With Grey Flower Glasses (2)
Detail of blue textured bow headband and gray floral sunglasses set on white card - Blue Bow With Grey Flower Glasses (3)
Kids flower sunglasses and light blue bow headband set on a display card - Light Blue Bow With Light Grey Flower Glasses (4)
+6
Baby Girl Bow Headband And Flower Sunglasses Accessory Matching For Toddler Kids Infant Fabric Plastic Cute
$2.35
Mix MOQ : 2
Kids Cotton Casual Pants Soft Elastic Waist Trousers For Boys Girls Korean Style Spring Autumn Solid Color Toddler Bottoms
Kids Cotton Casual Pants Soft Elastic Waist Trousers For Boys Girls Korean Style Spring Autumn Solid Color Toddler Bottoms
like
Find Similar
Detail of kids cotton casual pants featuring elastic waist and knee stitching accents - 80 / Tea Brown
Close-up of beige cotton kids trousers with elastic waistband and pocket details - 80 / Khaki
Detail view of deep olive green cotton kids pants with elastic waistband and pockets - 80 / Dark Gray
+15
Kids Cotton Casual Pants Soft Elastic Waist Trousers For Boys Girls Korean Style Spring Autumn Solid Color Toddler Bottoms
$9.51
No MOQ
Toddler Girls Long Sleeve Sweatshirt And Pants Cotton Blend Floral Plaid Lace Trim Casual Outfit For Baby Girls
Toddler Girls Long Sleeve Sweatshirt And Pants Cotton Blend Floral Plaid Lace Trim Casual Outfit For Baby Girls
like
Find Similar
Beige baby girl two-piece tracksuit with cute floral embroidery and lace details - 73cm / Beige
+4
NewToddler Girls Long Sleeve Sweatshirt And Pants Cotton Blend Floral Plaid Lace Trim Casual Outfit For Baby Girls
$16.71
No MOQ
Baby Girl Rabbit Ear Padded Vest Quilted Thickened Warm Autumn Winter Waistcoat Pink Bow Ruffle Collar Toddler Clothes
Baby Girl Rabbit Ear Padded Vest Quilted Thickened Warm Autumn Winter Waistcoat Pink Bow Ruffle Collar Toddler Clothes
like
Find Similar
Quilted toddler bunny ear vest with pink bow and warm hood in minimalist flat lay - 73
Detailed view of baby white ribbed knit sweater with ruffle collar and bow shoes in a basket - 73
+7
Baby Girl Rabbit Ear Padded Vest Quilted Thickened Warm Autumn Winter Waistcoat Pink Bow Ruffle Collar Toddler Clothes
$9.48-12.07
Mix MOQ : 2
Free Shipping
Baby Flower Headbands Elastic Nylon Hair Bands Floral Infant Toddler Headwear Accessories Cute Photography Props
Baby Flower Headbands Elastic Nylon Hair Bands Floral Infant Toddler Headwear Accessories Cute Photography Props
like
Find Similar
Detailed view of baby headband featuring large red mesh flower on beige elastic band - #1 Red Ball Flower
Detailed close-up of a baby headband featuring orange fabric flowers and center pearls - #3 Orange Green Pearl Flower
Detail of pink silk flower with pearl on beige elastic baby headband set - #8 Dusty Rose Green Flower
Close-up of baby headband with gradient pink and white fabric flower on nude elastic band - #2 Rice Pink Snow Flower
+2
Baby Flower Headbands Elastic Nylon Hair Bands Floral Infant Toddler Headwear Accessories Cute Photography Props
-4%
$0.41-0.69
Mix MOQ : 2
Chinese Style Newborn Baby Romper 100% Cotton Seamless Soft Infant Jumpsuit Floral Bird Print Traditional Frog Button Outfit
Chinese Style Newborn Baby Romper 100% Cotton Seamless Soft Infant Jumpsuit Floral Bird Print Traditional Frog Button Outfit
like
Find Similar
Floral Chinese style newborn cotton bodysuit with headband and wooden bear teether - 66CM
NewChinese Style Newborn Baby Romper 100% Cotton Seamless Soft Infant Jumpsuit Floral Bird Print Traditional Frog Button Outfit
-4%
$6.00
No MOQ
Kids Mock Neck Long Sleeve T-Shirt Soft Cotton Blend Solid Color Fall Winter Base Layer Top For Boys Girls
Kids Mock Neck Long Sleeve T-Shirt Soft Cotton Blend Solid Color Fall Winter Base Layer Top For Boys Girls
like
Find Similar
Flat lay detail of a beige thermal turtleneck sweater for kids showing soft knit texture - 80cm / Off-white
Detailed view of neatly folded dark pink mock neck knit sweater for kids in soft cotton - 80cm / Water Pink
Detailed close-up of the soft olive green ribbed texture and turtleneck of this kids top - 80cm / Fruit Green
Detail view of the soft knitted texture and stitching on a sage green toddler thermal shirt - 80cm / Light Blue
+26
Kids Mock Neck Long Sleeve T-Shirt Soft Cotton Blend Solid Color Fall Winter Base Layer Top For Boys Girls
$7.78
No MOQ
Free Shipping
Baby Boys Winter Thick Fleece Pajamas Cartoon Bear Long Sleeve Top And Pants Infant Toddler Warm Home Wear
Baby Boys Winter Thick Fleece Pajamas Cartoon Bear Long Sleeve Top And Pants Infant Toddler Warm Home Wear
like
Find Similar
Flat lay of baby winter fleece pajamas set with cute brown bear prints on cream fabric - 73cm / White
Detail of baby bear print fleece pajamas with button-up top, trousers, and soft booties - 73cm / Gray
+10
Baby Boys Winter Thick Fleece Pajamas Cartoon Bear Long Sleeve Top And Pants Infant Toddler Warm Home Wear
-4%
$10.93
Mix MOQ : 2
Pastoral Style Artificial Flower Headband Elastic Nylon Hair Band For Baby Kids Girls Hair Accessories Photography Props
Pastoral Style Artificial Flower Headband Elastic Nylon Hair Band For Baby Kids Girls Hair Accessories Photography Props
like
Find Similar
Pink and white peony flowers headband for baby girls with stretchable nylon band - Off White
Pastoral style baby floral headband with white flowers and yellow buds on nylon band - Off-white
Floral baby headband with white and pink faux flowers on a soft cream nylon band - Light Pink
Pastoral baby headband with olive green peony and white rose on a soft cream band - Grass Green
+6
Pastoral Style Artificial Flower Headband Elastic Nylon Hair Band For Baby Kids Girls Hair Accessories Photography Props
-4%
$1.84
No MOQ
Free Shipping
Toddler Girls Hooded Long Sleeve Cotton Star Print Sweatshirt And Pants Two Piece Set Casual Kids Winter Fall Clothing
Toddler Girls Hooded Long Sleeve Cotton Star Print Sweatshirt And Pants Two Piece Set Casual Kids Winter Fall Clothing
like
Find Similar
Yellow velvet hooded sweatshirt set for girls featuring black star patches and matching pants - Yellow / 80cm
Toddler girls red velvet hooded tracksuit with black sequin star patches and joggers - Red / 80cm
Pink velvet hooded sweatshirt and pants set for girls with black star patches and soft shoes - Pink / 80cm
+9
Toddler Girls Hooded Long Sleeve Cotton Star Print Sweatshirt And Pants Two Piece Set Casual Kids Winter Fall Clothing
-4%
$7.12
No MOQ
Infant Baby Girl Ruffled Collar Romper Long Sleeve Cotton Moon Print Jumpsuit Princess Style Newborn One Piece Outfit
Infant Baby Girl Ruffled Collar Romper Long Sleeve Cotton Moon Print Jumpsuit Princess Style Newborn One Piece Outfit
like
Find Similar
Pink cotton baby romper with ruffled collar, white moon prints and cute bunny patch - 66 / Pink Print
Infant Baby Girl Ruffled Collar Romper Long Sleeve Cotton Moon Print Jumpsuit Princess Style Newborn One Piece Outfit
$7.78
No MOQ
Toddler Kids Casual Cotton Sweatshirt And Pants Outfit Set Letter Printed Long Sleeve Sporty Top And Trousers For Boys Girls
Toddler Kids Casual Cotton Sweatshirt And Pants Outfit Set Letter Printed Long Sleeve Sporty Top And Trousers For Boys Girls
like
Find Similar
Toddler casual three-piece sports set with letter print sweatshirt and joggers in pink - Pink / 80cm
Kids casual two-piece tracksuit with letter print in yellow, white and grey colorblock - Yellow / 80cm
+6
Toddler Kids Casual Cotton Sweatshirt And Pants Outfit Set Letter Printed Long Sleeve Sporty Top And Trousers For Boys Girls
$7.49
No MOQ
Go to

More in baby & kids

Explore more in bibs

babylayerpolyesterboysstrapbandhandmaterialkerchiefface
solid colorstylepetkidsheartwarmdesignmetalwhiteears

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access