Everful

Wholesale bibs

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Bibs

Find the perfect pieces: toys & games, kids bags, baby clothing & essentials and more

All products in bibs

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Kids Casual Leopard Print Ink Wash Anti Mosquito Summer Pants For Boys Girls Elastic Waist Breathable Cuffed Jogger Pants
Kids Casual Leopard Print Ink Wash Anti Mosquito Summer Pants For Boys Girls Elastic Waist Breathable Cuffed Jogger Pants
like
Find Similar
Kids black and grey leopard print joggers with elastic waist and cuffed ankles - 80 / Grey Leopard
Kids' breathable grey-green harem pants featuring artistic black ink splatter print - 80 / Green Inky
+11
Kids Casual Leopard Print Ink Wash Anti Mosquito Summer Pants For Boys Girls Elastic Waist Breathable Cuffed Jogger Pants
$6.77
Mix MOQ : 2
Infant Boy Cotton Plaid Cardigan With Long Sleeve Top And Pants Set Toddler Korean Style Breathable Daily Outfit
Infant Boy Cotton Plaid Cardigan With Long Sleeve Top And Pants Set Toddler Korean Style Breathable Daily Outfit
like
Find Similar
Three-piece boys' spring outfit with beige plaid cardigan, green tee and brown pants - Brown / 73cm
+4
Infant Boy Cotton Plaid Cardigan With Long Sleeve Top And Pants Set Toddler Korean Style Breathable Daily Outfit
$22.48
No MOQ
Free Shipping
Baby Girl Cute Rabbit Printed Cotton Blend Sweatshirt And Pink Pants Casual Korean Style Spring Daily Outfit
Baby Girl Cute Rabbit Printed Cotton Blend Sweatshirt And Pink Pants Casual Korean Style Spring Daily Outfit
like
Find Similar
Infant girl spring clothing set with grey rabbit sweatshirt and pink casual pants - 73cm / Pink
+4
Baby Girl Cute Rabbit Printed Cotton Blend Sweatshirt And Pink Pants Casual Korean Style Spring Daily Outfit
$17.58
No MOQ
Free Shipping
Baby Boys Casual Cotton Blend Clothing Set Color Block Elephant Print Sweatshirt Plaid Pants Spring Autumn Infant Toddler Outfit
Baby Boys Casual Cotton Blend Clothing Set Color Block Elephant Print Sweatshirt Plaid Pants Spring Autumn Infant Toddler Outfit
like
Find Similar
Toddler casual two-piece outfit featuring color-block sweatshirt and checkered jogger pants - Ivory / 73cm
+4
Baby Boys Casual Cotton Blend Clothing Set Color Block Elephant Print Sweatshirt Plaid Pants Spring Autumn Infant Toddler Outfit
$15.85
No MOQ
Free Shipping
Kids Fleece Lined Cargo Pants Winter Boys Girls Warm Casual Loose Elastic Waist Cotton Workwear Trousers Ribbed Cuffs
Kids Fleece Lined Cargo Pants Winter Boys Girls Warm Casual Loose Elastic Waist Cotton Workwear Trousers Ribbed Cuffs
like
Find Similar
Detail of kids black fleece-lined joggers showing elastic waist and side cargo pocket - 80cm / Black
Olive green fleece-lined cargo pants for children with elastic waist and ribbed cuffs - 80cm / Army Green
+10
Kids Fleece Lined Cargo Pants Winter Boys Girls Warm Casual Loose Elastic Waist Cotton Workwear Trousers Ribbed Cuffs
$12.10
No MOQ
Kids Lyocell Sun Protection Cardigan Lightweight Hooded Sunscreen Jacket Thin Breathable Button Up Shirt Coat For Boys Girls
Kids Lyocell Sun Protection Cardigan Lightweight Hooded Sunscreen Jacket Thin Breathable Button Up Shirt Coat For Boys Girls
like
Find Similar
Macro detail of breathable white knit fabric on children's hooded sun protection cardigan - 80cm / White
Detail of mint green hooded cardigan for children featuring white buttons and side pockets - 80cm / Bean Green
Detail view of the soft knitted fabric and white buttons on this beige hooded kids cardigan - 80cm / Khaki
Detail view of pink hooded sun-protection cardigan with white buttons and ribbed cuffs - 80cm / Water Pink
+20
Kids Lyocell Sun Protection Cardigan Lightweight Hooded Sunscreen Jacket Thin Breathable Button Up Shirt Coat For Boys Girls
$10.09
No MOQ
Free Shipping
Girls Cartoon Bear Raglan Long Sleeve T-Shirt 100% Cotton Breathable Soft Bottoming Shirt Beige Dark Grey Children Tops
Girls Cartoon Bear Raglan Long Sleeve T-Shirt 100% Cotton Breathable Soft Bottoming Shirt Beige Dark Grey Children Tops
like
Find Similar
Kids long sleeve raglan t-shirt with cartoon illustration and Good Luck print in beige - 90cm / Apricot/Dark Grey
+5
Girls Cartoon Bear Raglan Long Sleeve T-Shirt 100% Cotton Breathable Soft Bottoming Shirt Beige Dark Grey Children Tops
-4%
$4.08
No MOQ
Boys Cartoon Excavator Construction Vehicle Print Pajamas Pure Cotton Soft Lapel Button Down Home Wear Sleepwear Top And Pants
Boys Cartoon Excavator Construction Vehicle Print Pajamas Pure Cotton Soft Lapel Button Down Home Wear Sleepwear Top And Pants
like
Find Similar
Boys cotton pajamas set with cute blue and yellow excavator prints and button-down collar - 110 / White Long Sleeve Set
Boys short sleeve cotton pajama set with excavator print and elastic waist trousers - 110 / White Short Sleeve Set
Blue cotton boys pajamas set featuring cartoon excavator prints and short sleeve shirt - 110 / Blue Short Sleeve Set
Boys cotton pajamas set with blue cartoon excavator print and button-down collar - 110 / Blue Long Sleeve Set
+9
Boys Cartoon Excavator Construction Vehicle Print Pajamas Pure Cotton Soft Lapel Button Down Home Wear Sleepwear Top And Pants
-5%
$12.32-12.87
No MOQ
Kids Long Sleeve Ribbed Knit Bottoming Shirt Cotton Half High Neck Contrast Binding Pullover Top For Toddler Boys Girls
Kids Long Sleeve Ribbed Knit Bottoming Shirt Cotton Half High Neck Contrast Binding Pullover Top For Toddler Boys Girls
like
Find Similar
Detail of children's brown ribbed knit sweater with dark contrast piping on collar and cuffs - 80cm / Khaki
Close-up of kids ribbed knit sweater featuring grey fabric and black contrast trim - 80cm / Light Grey
Close-up of brown ribbed knit sweater featuring contrasting black trim at the neck and cuffs - 80cm / Dark Coffee
Detail of knit child sweater with contrast brown piping on high neck and cuffs - 80cm / Apricot
+20
Kids Long Sleeve Ribbed Knit Bottoming Shirt Cotton Half High Neck Contrast Binding Pullover Top For Toddler Boys Girls
$8.36
No MOQ
Infant Winter Hooded Down Jacket White Duck Down Thickened Warm Coat Floral Lining Outerwear For Toddler Baby Girls
Infant Winter Hooded Down Jacket White Duck Down Thickened Warm Coat Floral Lining Outerwear For Toddler Baby Girls
like
Find Similar
Thick hooded winter jacket for babies with white duck down and floral lining - Beige / 80cm
Infant Winter Hooded Down Jacket White Duck Down Thickened Warm Coat Floral Lining Outerwear For Toddler Baby Girls
$31.41
No MOQ
Free Shipping
Kids Striped Cotton Harem Pants Toddler Elastic Waist Loose Casual Trousers Boys Girls Spring Autumn Soft Bottoms
Kids Striped Cotton Harem Pants Toddler Elastic Waist Loose Casual Trousers Boys Girls Spring Autumn Soft Bottoms
like
Find Similar
Detailed close-up of striped kids harem pants showing elastic waist and cotton linen texture - 80 / Light Gray Stripe
Detailed close-up of grey vertical striped kids trousers with elastic waistband - 80 / Dark Grey Stripes
+10
Kids Striped Cotton Harem Pants Toddler Elastic Waist Loose Casual Trousers Boys Girls Spring Autumn Soft Bottoms
$9.22
No MOQ
Baby Girl Headband Lace Flower Rhinestone Princess Elastic Hair Accessories For Newborn Toddler Photography
Baby Girl Headband Lace Flower Rhinestone Princess Elastic Hair Accessories For Newborn Toddler Photography
like
Find Similar
Detailed view of pink embroidered lace flowers with rhinestones and mesh headband for babies - Pink (Six Flowers)
Elegant white lace flower headband for baby girls with rhinestones and tulle ribbon - White (Six Flowers)
Lace baby headband with six white embroidered flowers and central rhinestones - White Five Flowers (Beige Elastic)
Detail view of baby lace headband featuring white floral patterns and crystal rhinestones - Full White (Five Flowers)
+1
Baby Girl Headband Lace Flower Rhinestone Princess Elastic Hair Accessories For Newborn Toddler Photography
-5%
$1.31
No MOQ
Sweet Embroidered Flower Bow Hair Clips Gingham Plaid Cotton Fabric Handmade Hairpins For Baby Girls Kids Hair Accessories
Sweet Embroidered Flower Bow Hair Clips Gingham Plaid Cotton Fabric Handmade Hairpins For Baby Girls Kids Hair Accessories
like
Find Similar
Detail of embroidered mint green cotton bow with natural wooden ring for babies - Light Green
Detail of baby hair clip with blue floral embroidery bow on natural wooden rings - Blue
Detail view of cotton bow hair clip with flower embroidery and a natural wooden ring - Black
Detailed embroidery of white floral patterns on a beige lattice cotton bow clip - Off White
+2
Sweet Embroidered Flower Bow Hair Clips Gingham Plaid Cotton Fabric Handmade Hairpins For Baby Girls Kids Hair Accessories
$0.65
Mix MOQ : 2
Boys Striped Polo Shirt Short Sleeve Cotton Blend Embroidered Bear Summer Casual Top Korean Style Breathable Clothes
Boys Striped Polo Shirt Short Sleeve Cotton Blend Embroidered Bear Summer Casual Top Korean Style Breathable Clothes
like
Find Similar
Kids striped cotton polo shirt with navy blue collar and teddy bear embroidery - 90 / White Striped
Children's short sleeve striped Polo shirt with cute bear embroidery on chest - 90 / Black Stripe
+8
Boys Striped Polo Shirt Short Sleeve Cotton Blend Embroidered Bear Summer Casual Top Korean Style Breathable Clothes
-4%
$5.34
No MOQ
Newborn Baby Cotton Romper Kimono Side Tie Long Sleeve Jumpsuit Breathable Flat Seam Pajamas For Infant All Seasons Clothes
Newborn Baby Cotton Romper Kimono Side Tie Long Sleeve Jumpsuit Breathable Flat Seam Pajamas For Infant All Seasons Clothes
like
Find Similar
Quilted lavender baby romper with long sleeves, ribbon accents and side buttons - 52cm / Lavender Purple
Baby girl light pink long sleeve cotton romper with jacquard texture and ribbon tie - 52cm / Orange Pink
Creamy white 100% cotton newborn romper with blue scalloped trim and wood elephant toy - 52cm / Milk White
+6
Newborn Baby Cotton Romper Kimono Side Tie Long Sleeve Jumpsuit Breathable Flat Seam Pajamas For Infant All Seasons Clothes
$4.76
No MOQ
Baby Girl Summer Cotton Romper Floral Rabbit Print Fly Sleeve Bodysuit Cute Newborn Infant Jumpsuit Clothes
Baby Girl Summer Cotton Romper Floral Rabbit Print Fly Sleeve Bodysuit Cute Newborn Infant Jumpsuit Clothes
like
Find Similar
Short sleeve baby bodysuit in cream with cute rabbit prints and lace collar detail - Milky White / 66CM
Baby Girl Summer Cotton Romper Floral Rabbit Print Fly Sleeve Bodysuit Cute Newborn Infant Jumpsuit Clothes
$9.22
No MOQ
Free Shipping
Little Maven Girls 100% Cotton Set Pink Bunny Print Short Sleeve T-Shirt And Grey Ruffle Shorts 2 Piece Summer Outfit
Little Maven Girls 100% Cotton Set Pink Bunny Print Short Sleeve T-Shirt And Grey Ruffle Shorts 2 Piece Summer Outfit
like
Find Similar
Girl summer cotton set featuring pink rabbit t-shirt with tutu bow and grey ruffle shorts - 2Y(90cm) / Pink Rabbit Set (2216)
+5
Little Maven Girls 100% Cotton Set Pink Bunny Print Short Sleeve T-Shirt And Grey Ruffle Shorts 2 Piece Summer Outfit
$7.64
No MOQ
Infant Baby Girl Ruffled Collar Romper Long Sleeve Cotton Moon Print Jumpsuit Princess Style Newborn One Piece Outfit
Infant Baby Girl Ruffled Collar Romper Long Sleeve Cotton Moon Print Jumpsuit Princess Style Newborn One Piece Outfit
like
Find Similar
Pink cotton baby romper with ruffled collar, white moon prints and cute bunny patch - 66 / Pink Print
Infant Baby Girl Ruffled Collar Romper Long Sleeve Cotton Moon Print Jumpsuit Princess Style Newborn One Piece Outfit
$7.78
No MOQ
Baby Fleece Jumpsuit Flannel Winter Warm Romper Cartoon Animal Panda Rabbit Bear Long Sleeve For Infant Toddler
Baby Fleece Jumpsuit Flannel Winter Warm Romper Cartoon Animal Panda Rabbit Bear Long Sleeve For Infant Toddler
like
Find Similar
Creamy white plush baby romper with a cute rabbit pocket and 3D ears for winter warmth - 66CM / Off-white [Plush Pocket Rabbit Romper]
Plush panda themed baby winter bodysuit with zip-up design and soft fleece texture - 66CM / Black & White [Plush Pocket Panda Romper]
Plush brown teddy fleece baby romper with cute bear face pocket for winter warmth - 66CM / Brown [Plush Pocket Bear Romper]
Plush black and white panda jumpsuit for infants made of warm coral fleece fabric - 66CM / Black & White [Plush Panda Romper No Pocket]
+12
NewBaby Fleece Jumpsuit Flannel Winter Warm Romper Cartoon Animal Panda Rabbit Bear Long Sleeve For Infant Toddler
$5.73-6.60
No MOQ
Kids Summer Pure Cotton Casual Shorts Unisex Boys Girls Elastic Waist Loose Half Pants Soft Breathable Daily Outdoor Shorts
Kids Summer Pure Cotton Casual Shorts Unisex Boys Girls Elastic Waist Loose Half Pants Soft Breathable Daily Outdoor Shorts
like
Find Similar
Detail view of khaki cotton casual shorts with comfortable elastic waist for kids - 80cm / Light Khaki
Detail of dark grey cotton shorts showing elastic waist with belt loops and side pockets - 80cm / Dark Gray
+10
Kids Summer Pure Cotton Casual Shorts Unisex Boys Girls Elastic Waist Loose Half Pants Soft Breathable Daily Outdoor Shorts
$8.36
No MOQ
Toddler Baby Flannel Fleece Loungewear Hooded Jacket And Pants Animal Ears Zipper Pajamas Warm Winter Outfits
Toddler Baby Flannel Fleece Loungewear Hooded Jacket And Pants Animal Ears Zipper Pajamas Warm Winter Outfits
like
Find Similar
Kids' beige flannel pajama set featuring a cute lamb-ear hood and fuzzy warm texture - 80cm / Rice White Rabbit Hooded Set
Brown toddler fleece pajamas set with bear ear hoodie and matching trousers for winter - 80cm / Brown Bear Hooded Set
Cozy panda-themed flannel pajama set for toddlers with a hooded zip jacket and pants - 80cm / Black & White Panda Hooded Set
+12
Toddler Baby Flannel Fleece Loungewear Hooded Jacket And Pants Animal Ears Zipper Pajamas Warm Winter Outfits
$6.60-7.75
No MOQ
Baby Girl Long Sleeve Romper Cotton Peter Pan Collar Ruffle Trim Solid Color Infant Bodysuit Jumpsuit Spring Autumn Clothing
Baby Girl Long Sleeve Romper Cotton Peter Pan Collar Ruffle Trim Solid Color Infant Bodysuit Jumpsuit Spring Autumn Clothing
like
Find Similar
Detail of white long-sleeved baby bodysuit with ruffled Peter Pan collar and buttons - 66CM / White
Close-up of light blue baby romper featuring ruffled doll collar and wooden table setting - 100cm / Blue
Baby Girl Long Sleeve Romper Cotton Peter Pan Collar Ruffle Trim Solid Color Infant Bodysuit Jumpsuit Spring Autumn Clothing
-4%
$8.47
Mix MOQ : 2
Girls Cotton Summer Clothing Set Cartoon Ballerina Print Short Sleeve T-Shirt And Star Print Shorts Kids Casual Outfit
Girls Cotton Summer Clothing Set Cartoon Ballerina Print Short Sleeve T-Shirt And Star Print Shorts Kids Casual Outfit
like
Find Similar
Girls summer pajama set with ballet girl print purple tee and navy blue printed shorts - 2Y(90cm) / Purple Ballerina Girl Set (2239)
Girls Cotton Summer Clothing Set Cartoon Ballerina Print Short Sleeve T-Shirt And Star Print Shorts Kids Casual Outfit
-4%
$6.52
No MOQ
Infant Baby Girl Casual Cotton Blend Long Sleeve T-Shirt And Colorblock Denim Overalls Two Piece Fall Clothing Set
Infant Baby Girl Casual Cotton Blend Long Sleeve T-Shirt And Colorblock Denim Overalls Two Piece Fall Clothing Set
like
Find Similar
Baby denim overall set with blue patchwork trousers and white long sleeve shirt - Blue / 73cm
Infant Baby Girl Casual Cotton Blend Long Sleeve T-Shirt And Colorblock Denim Overalls Two Piece Fall Clothing Set
$16.71
No MOQ
Baby Girls Autumn Striped Fleece Sweatshirt And Long Pants Outfits Toddler Casual Korean Style Soft Cotton Blend Clothes
Baby Girls Autumn Striped Fleece Sweatshirt And Long Pants Outfits Toddler Casual Korean Style Soft Cotton Blend Clothes
like
Find Similar
Pink striped baby girl sweatshirt and pants set with cute bunny embroidery and print - Pink / 100cm
Baby Girls Autumn Striped Fleece Sweatshirt And Long Pants Outfits Toddler Casual Korean Style Soft Cotton Blend Clothes
$16.71
No MOQ
Toddler Girls 2 Piece Cotton Sweatshirt And Striped Pants Set Rabbit Print Ruffle Hem Pink Casual Autumn Spring Outfit
Toddler Girls 2 Piece Cotton Sweatshirt And Striped Pants Set Rabbit Print Ruffle Hem Pink Casual Autumn Spring Outfit
like
Find Similar
Pink girls tracksuit with bunny print sweatshirt and striped pants casual two-piece set - 73cm / Pink
Toddler Girls 2 Piece Cotton Sweatshirt And Striped Pants Set Rabbit Print Ruffle Hem Pink Casual Autumn Spring Outfit
$17.29
No MOQ
Free Shipping
Little Maven Girls Summer Clothing Cotton Short Sleeve Unicorn Print Top And Shorts Outfit For Kids European Style
Little Maven Girls Summer Clothing Cotton Short Sleeve Unicorn Print Top And Shorts Outfit For Kids European Style
like
Find Similar
Pink cotton T-shirt with unicorn print and purple shorts summer set for girls - 7Y (140cm) / Pink Unicorn (2Y0101)
Kids cotton summer pajama set with unicorn graphic short sleeve t-shirt and pink shorts - 7Y (140cm) / Cream Unicorn (K2181)
+10
Little Maven Girls Summer Clothing Cotton Short Sleeve Unicorn Print Top And Shorts Outfit For Kids European Style
-4%
$7.26
No MOQ
Boys Hooded Zip Sweatshirt Autumn Cotton Blend Bear Embroidery Thickened Fleece Jacket Toddler Striped Casual Outerwear
Boys Hooded Zip Sweatshirt Autumn Cotton Blend Bear Embroidery Thickened Fleece Jacket Toddler Striped Casual Outerwear
like
Find Similar
Kids black and white striped hooded jacket with cute bear embroidery and front zipper - 90cm / Black & White Stripes
Classic grey kids zip-up hooded sweatshirt with cute cartoon bear embroidery - 90cm / Gray
Thickened dark blue kids zip-up hoodie with cartoon bear embroidery and pockets - 90cm / Navy Blue
+12
Boys Hooded Zip Sweatshirt Autumn Cotton Blend Bear Embroidery Thickened Fleece Jacket Toddler Striped Casual Outerwear
$8.62
No MOQ
Kids Cotton Long Sleeve Polka Dot T-Shirt Korean Style Round Neck Top With Chest Pocket For Boys And Girls Daily Wear
Kids Cotton Long Sleeve Polka Dot T-Shirt Korean Style Round Neck Top With Chest Pocket For Boys And Girls Daily Wear
like
Find Similar
Close-up of kids polka dot sweatshirt with rib cuffs and contrast pocket detail - 80cm / Grey Brown
Detailed close-up of dot pattern fabric and ribbed cuffs on kids long sleeve tee - 80cm / Grey-Beige
+10
Kids Cotton Long Sleeve Polka Dot T-Shirt Korean Style Round Neck Top With Chest Pocket For Boys And Girls Daily Wear
$8.93
No MOQ
Baby First Walkers Soft Sole Anti Slip Infant Toddler Shoes Cartoon Bear Quilted Synthetic Leather Prewalker Shoes For Boys Girls
Baby First Walkers Soft Sole Anti Slip Infant Toddler Shoes Cartoon Bear Quilted Synthetic Leather Prewalker Shoes For Boys Girls
like
Find Similar
Soft-soled beige baby walking shoes with quilted pattern and cute cartoon bear motif - Off White / Size 14 (Inner Length 10.5CM)
Pink and white baby walking shoes with soft soles and cute cartoon bear velcro strap - Pink / Size 14 (Inner Length 10.5CM)
+6
Baby First Walkers Soft Sole Anti Slip Infant Toddler Shoes Cartoon Bear Quilted Synthetic Leather Prewalker Shoes For Boys Girls
$5.04
No MOQ
Baby Boys 3-Piece Clothing Set Cotton Cardigan Jacket Bear Print T-Shirt And Denim Jeans Casual Toddler Spring Outfit
Baby Boys 3-Piece Clothing Set Cotton Cardigan Jacket Bear Print T-Shirt And Denim Jeans Casual Toddler Spring Outfit
like
Find Similar
Three-piece boys' spring outfit with beige cardigan, white bear tee and denim trousers - 73cm / Beige/Blue Set
Baby Boys 3-Piece Clothing Set Cotton Cardigan Jacket Bear Print T-Shirt And Denim Jeans Casual Toddler Spring Outfit
$25.94
No MOQ
Free Shipping
Kids Cotton Bloomers Geometric Tribal Printed Harem Pants Loose Summer Lantern Trousers For Toddler Boys Girls
Kids Cotton Bloomers Geometric Tribal Printed Harem Pants Loose Summer Lantern Trousers For Toddler Boys Girls
like
Find Similar
Detail of kids linen bloomers with geometric patterns and elastic waistband - Beige 7-Point Pants / 80cm
Detailed flat lay of toddler cotton harem pants featuring black and white geometric stripes - White 9-Point Pants / 80cm
+10
Kids Cotton Bloomers Geometric Tribal Printed Harem Pants Loose Summer Lantern Trousers For Toddler Boys Girls
$7.49
No MOQ
Baby Boys Hooded Down Jacket Cartoon Planet Embroidery Winter Warm White Duck Down Padded Quilted Coat For Infants Kids
Baby Boys Hooded Down Jacket Cartoon Planet Embroidery Winter Warm White Duck Down Padded Quilted Coat For Infants Kids
like
Find Similar
Grey hooded baby down jacket with 85% white duck down for toddlers aged 0-10°C - Gray / 80cm
Baby Boys Hooded Down Jacket Cartoon Planet Embroidery Winter Warm White Duck Down Padded Quilted Coat For Infants Kids
$23.34
No MOQ
Free Shipping
Infant Striped Long Sleeve Thermal Romper With Silk Wool Blend Fabric Soft Knitted Baby Bodysuit Autumn Winter Baby Clothes
Infant Striped Long Sleeve Thermal Romper With Silk Wool Blend Fabric Soft Knitted Baby Bodysuit Autumn Winter Baby Clothes
like
Find Similar
Detail of baby pink knit bodysuit featuring cute puppy embroidery and snap buttons - 66 / Pink
Infant Striped Long Sleeve Thermal Romper With Silk Wool Blend Fabric Soft Knitted Baby Bodysuit Autumn Winter Baby Clothes
$5.48
No MOQ
Toddler Girls Casual Cotton Pants With Mushroom Embroidery Ruffle Pocket Korean Style Soft Trousers Off White
Toddler Girls Casual Cotton Pants With Mushroom Embroidery Ruffle Pocket Korean Style Soft Trousers Off White
like
Find Similar
Cream-colored toddler sweatpants with mushroom embroidery and ruffle pocket details - 73cm / Off White
+4
Toddler Girls Casual Cotton Pants With Mushroom Embroidery Ruffle Pocket Korean Style Soft Trousers Off White
-5%
$9.58
No MOQ
Free Shipping
Toddler Kids Fleece Lined Denim Harem Pants Winter Thickened Warm Jeans Ribbed Cuffs Cartoon Bear Print Elastic Waist Bottoms
Toddler Kids Fleece Lined Denim Harem Pants Winter Thickened Warm Jeans Ribbed Cuffs Cartoon Bear Print Elastic Waist Bottoms
like
Find Similar
Kids warm fleece lined denim jogger pants with elastic waist and bear embroidery - 80cm / Denim Blue
+5
Toddler Kids Fleece Lined Denim Harem Pants Winter Thickened Warm Jeans Ribbed Cuffs Cartoon Bear Print Elastic Waist Bottoms
$16.14
No MOQ
Floral Printed Baby Girls Winter Down Jumpsuit Hooded Thick Warm Snowsuit With Ruffle Bow Details Infant Outdoor Romper
Floral Printed Baby Girls Winter Down Jumpsuit Hooded Thick Warm Snowsuit With Ruffle Bow Details Infant Outdoor Romper
like
Find Similar
Floral print baby hooded romper with warm white duck down filling and pink ruffles - 66 / Pink Floral
+4
Floral Printed Baby Girls Winter Down Jumpsuit Hooded Thick Warm Snowsuit With Ruffle Bow Details Infant Outdoor Romper
$38.04
No MOQ
Free Shipping
Toddler Kids Cotton Jogger Sweatpants Casual Solid Color Elastic Waist Ribbed Cuffs Pants For Boys Girls Daily Wear
Toddler Kids Cotton Jogger Sweatpants Casual Solid Color Elastic Waist Ribbed Cuffs Pants For Boys Girls Daily Wear
like
Find Similar
Detailed view of dark green kids joggers showing elastic waistband and ribbed cuffs - 80cm / Green
Detailed close-up of dark grey kids joggers with elastic waist and ribbed cuffs - 80cm / Dark Gray
Close-up of children's cotton jogger pants with elastic waistband and ribbed cuffs detail - 120cm / Apricot
Close-up of kids brown cotton sweatpants with elastic waist and ribbed cuffs for autumn - 90cm / Brown
+12
Toddler Kids Cotton Jogger Sweatpants Casual Solid Color Elastic Waist Ribbed Cuffs Pants For Boys Girls Daily Wear
$8.65
No MOQ
Korean Style Kids Cotton Cargo Overalls Casual Solid Color Jumpsuit With Pockets For Boys Girls Toddler Fashion Pants
Korean Style Kids Cotton Cargo Overalls Casual Solid Color Jumpsuit With Pockets For Boys Girls Toddler Fashion Pants
like
Find Similar
Detail of dark grey kids overalls with adjustable straps and vintage gold buttons - Gray / 80cm
Flat lay detail of brown cotton kids overalls with pockets and striped canvas sneakers - Brown / 80cm
+10
Korean Style Kids Cotton Cargo Overalls Casual Solid Color Jumpsuit With Pockets For Boys Girls Toddler Fashion Pants
$14.12
No MOQ
Little Maven Toddler Girls 2-Piece Autumn Set Long Sleeve Cartoon Capybara Print Sweatshirt Brown Leggings Kids Casual Clothing Outfit
Little Maven Toddler Girls 2-Piece Autumn Set Long Sleeve Cartoon Capybara Print Sweatshirt Brown Leggings Kids Casual Clothing Outfit
like
Find Similar
Cute capybara pattern beige sweatshirt and brown pants two-piece cotton kids set - 2Y(90cm) / Cartoon Capybara Print (K2051)
+5
Little Maven Toddler Girls 2-Piece Autumn Set Long Sleeve Cartoon Capybara Print Sweatshirt Brown Leggings Kids Casual Clothing Outfit
-29%
$4.54
No MOQ
Toddler Girls Summer Cotton Clothes Top And Shorts Pink Bunny Rainbow Print Flutter Sleeve Ruffle Outfit For Kids
Toddler Girls Summer Cotton Clothes Top And Shorts Pink Bunny Rainbow Print Flutter Sleeve Ruffle Outfit For Kids
like
Find Similar
Pink toddler girls cotton pajama set with cute rabbit print and flutter sleeves - 2Y(90cm) / Pink Bunny Print Set (K2180)
NewToddler Girls Summer Cotton Clothes Top And Shorts Pink Bunny Rainbow Print Flutter Sleeve Ruffle Outfit For Kids
$8.59
No MOQ
Toddler Baby Long Sleeve Cotton Blend T-Shirt With Shoulder Buttons Cartoon Hedgehog Print Round Neck Casual Undershirt Top
Toddler Baby Long Sleeve Cotton Blend T-Shirt With Shoulder Buttons Cartoon Hedgehog Print Round Neck Casual Undershirt Top
like
Find Similar
Infant long sleeve cotton t-shirt in light coffee with hangry embroidery and shoulder snaps - 73cm / Brown
Toddler Baby Long Sleeve Cotton Blend T-Shirt With Shoulder Buttons Cartoon Hedgehog Print Round Neck Casual Undershirt Top
$7.49
No MOQ
Kids Plaid Pajamas Set 100% Cotton Brushed Long Sleeve Top And Pants Cute Fruit Buttons Sleepwear For Boys Girls
Kids Plaid Pajamas Set 100% Cotton Brushed Long Sleeve Top And Pants Cute Fruit Buttons Sleepwear For Boys Girls
like
Find Similar
Kids pink checkered pajamas set with long sleeves and colorful fruit shaped buttons - 120 / Red Check
Kids orange gingham brushed cotton pajama set with fruit buttons and long sleeves - 120 / Yellow Plaid
+6
NewKids Plaid Pajamas Set 100% Cotton Brushed Long Sleeve Top And Pants Cute Fruit Buttons Sleepwear For Boys Girls
$14.99-17.87
No MOQ
Kids Cargo Jogger Pants Solid Color Cotton Knit Trousers With Elastic Waist And Pockets Casual Sports Pants For Boys Girls
Kids Cargo Jogger Pants Solid Color Cotton Knit Trousers With Elastic Waist And Pockets Casual Sports Pants For Boys Girls
like
Find Similar
Kids khaki cargo joggers with elastic waist and large side pockets for daily comfort - 90 / Khaki
Children's cargo jogger pants in cream beige with elastic waist and flap side pockets - 130 / Apricot
Boy's black fleece lined cargo pants with elastic waist and ribbed cuffs for winter - 140 / Black (Fleece-lined)
Children's grey cotton joggers with elastic waist and large cargo pockets for boys - 140 / Gray
+6
Kids Cargo Jogger Pants Solid Color Cotton Knit Trousers With Elastic Waist And Pockets Casual Sports Pants For Boys Girls
$12.94-14.38
No MOQ
Free Shipping
Korean Style Cotton Harem Pants For Kids Unisex Loose Solid Color Casual Lantern Trousers For Boys Girls Autumn Clothing
Korean Style Cotton Harem Pants For Kids Unisex Loose Solid Color Casual Lantern Trousers For Boys Girls Autumn Clothing
like
Find Similar
Detail of children's wide-leg cotton pants with elastic high waist and cuffed hems - 80 / Tea Brown
Flat lay of dark grey cotton kids wide-leg trousers with an elastic waist and cuffed hem - 80 / Dark Gray
+10
Korean Style Cotton Harem Pants For Kids Unisex Loose Solid Color Casual Lantern Trousers For Boys Girls Autumn Clothing
$9.51
No MOQ
Free Shipping
Baby Boy Tiger Pattern Cotton Long Sleeve Sweatshirt And Pants Outfit Kids Cute Cartoon Spring Autumn Clothes
Baby Boy Tiger Pattern Cotton Long Sleeve Sweatshirt And Pants Outfit Kids Cute Cartoon Spring Autumn Clothes
like
Find Similar
Baby cotton tracksuit with cute cartoon tiger embroidery in beige and sage green - 73 / Green
Baby Boy Tiger Pattern Cotton Long Sleeve Sweatshirt And Pants Outfit Kids Cute Cartoon Spring Autumn Clothes
$15.56
No MOQ
Free Shipping
Girls Academy Style Cotton Sweatshirt And Pleated Skirt Two Piece Set Cartoon Bear Embroidery Long Sleeve Preppy Outfit
Girls Academy Style Cotton Sweatshirt And Pleated Skirt Two Piece Set Cartoon Bear Embroidery Long Sleeve Preppy Outfit
like
Find Similar
Girls' grey and blue polo sweatshirt and pants set with a small bear embroidery detail - 80 / Sweatshirt + Sweatpants Set / Blue (Boys)
Girls school style polo sweatshirt and pleated skirt set with bear embroidery - 80 / Sweatshirt + Pleated Skirt Set / Blue (Girls)
Pink and white polo sweatshirt and pleated skirt two-piece set with bear embroidery - 80 / Sweatshirt + Pleated Skirt Set / Pink (Girls)
+16
Girls Academy Style Cotton Sweatshirt And Pleated Skirt Two Piece Set Cartoon Bear Embroidery Long Sleeve Preppy Outfit
$14.38-19.28
No MOQ
Baby Prewalker Shoes Soft Sole Sock Shoes For Infants Toddlers Non-Slip Warm Cotton Knit Ribbed High Top Walker Shoes
Baby Prewalker Shoes Soft Sole Sock Shoes For Infants Toddlers Non-Slip Warm Cotton Knit Ribbed High Top Walker Shoes
like
Find Similar
Soft non-slip baby sock shoes with ribbed cuffs and breathable linen fabric for walking - US 11 / Khaki
Creamy white baby sock shoes with ribbed cuffs and soft anti-slip soles for toddlers - US 11 / Off White
+4
Baby Prewalker Shoes Soft Sole Sock Shoes For Infants Toddlers Non-Slip Warm Cotton Knit Ribbed High Top Walker Shoes
$4.58
Mix MOQ : 3
Free Shipping
Infant Winter Down Romper Thickened Warm Hooded Snowsuit With 3D Antlers Deer Pattern For Baby Boys Girls Outerwear
Infant Winter Down Romper Thickened Warm Hooded Snowsuit With 3D Antlers Deer Pattern For Baby Boys Girls Outerwear
like
Find Similar
Baby winter hooded jumpsuit with reindeer ears and festive forest pattern print - 66CM / Green
+4
Infant Winter Down Romper Thickened Warm Hooded Snowsuit With 3D Antlers Deer Pattern For Baby Boys Girls Outerwear
$30.26
No MOQ
Free Shipping
Kids Mosquito Pants Viscose Lightweight Breathable Lantern Pants For Toddler Boys Girls Casual Summer Solid Color Long Trousers
Kids Mosquito Pants Viscose Lightweight Breathable Lantern Pants For Toddler Boys Girls Casual Summer Solid Color Long Trousers
like
Find Similar
Kids lightweight apricot mosquito pants with elastic waist and cuffed ankles - Orange / 80
Kids breathable mosquito pants in cream white featuring elastic high waist and cuffs - White / 90
Kids breathable mosquito pants in misty blue featuring elastic waist and cuffs - Blue / 80
Light green toddler mosquito pants with elastic waist and cuffs in a breathable fabric - Green / 80
+16
Kids Mosquito Pants Viscose Lightweight Breathable Lantern Pants For Toddler Boys Girls Casual Summer Solid Color Long Trousers
$6.60
No MOQ
Free Shipping
Kids Boys Faux Two-Piece Polo Shirt Cotton Blend Spliced Striped Long Sleeve Korean Style Casual Toddler Bear Embroidery Top
Kids Boys Faux Two-Piece Polo Shirt Cotton Blend Spliced Striped Long Sleeve Korean Style Casual Toddler Bear Embroidery Top
like
Find Similar
Detail of kids polo shirt with blue bear embroidery and striped patchwork sleeves - 100cm / White
Detail of navy blue kids polo shirt featuring a polar bear embroidery and striped sleeves - 90cm / Navy Blue
+10
Kids Boys Faux Two-Piece Polo Shirt Cotton Blend Spliced Striped Long Sleeve Korean Style Casual Toddler Bear Embroidery Top
-4%
$6.17
No MOQ
Cotton Toddler Dinosaur Print Short Sleeve Polo Shirt And Shorts Outfit Summer Breathable Kids Casual Clothing For Boys
Cotton Toddler Dinosaur Print Short Sleeve Polo Shirt And Shorts Outfit Summer Breathable Kids Casual Clothing For Boys
like
Find Similar
Kids cotton summer set with white dinosaur print polo shirt and red drawstring shorts - 80cm / White
Kids cotton summer set with yellow dinosaur polo shirt and dark green shorts - 80cm / Yellow
Toddler summer cotton POLO set with red dinosaur print shirt and beige shorts - 80cm / Red
+9
Cotton Toddler Dinosaur Print Short Sleeve Polo Shirt And Shorts Outfit Summer Breathable Kids Casual Clothing For Boys
-4%
$6.30
No MOQ
Toddler Boys Cotton Short Sleeve T-Shirt Cartoon Jungle Animal Peaceful Print Round Neck Summer Casual Tee Top
Toddler Boys Cotton Short Sleeve T-Shirt Cartoon Jungle Animal Peaceful Print Round Neck Summer Casual Tee Top
like
Find Similar
Kids fog blue cotton t-shirt with peaceful cartoon animal prints and crew neck design - Army Blue / 90cm
+5
NewToddler Boys Cotton Short Sleeve T-Shirt Cartoon Jungle Animal Peaceful Print Round Neck Summer Casual Tee Top
-4%
$3.43
Mix MOQ : 2
Baby Girl Cotton Floral Long Sleeve Shirt Knitted Cardigan And Wide Leg Pants Spring Sweet Toddler Clothing Outfit
Baby Girl Cotton Floral Long Sleeve Shirt Knitted Cardigan And Wide Leg Pants Spring Sweet Toddler Clothing Outfit
like
Find Similar
Toddler girl floral knit cardigan with beige wide-leg trousers in a sweet 2-piece set - Rainbow / 73cm
+4
Baby Girl Cotton Floral Long Sleeve Shirt Knitted Cardigan And Wide Leg Pants Spring Sweet Toddler Clothing Outfit
$25.07
No MOQ
Free Shipping
Baby Girls Clothing Set Spring Long Sleeve Ruffle Sweatshirt And Denim Flare Pants With Bow Two-Piece Korean Style Outfit
Baby Girls Clothing Set Spring Long Sleeve Ruffle Sweatshirt And Denim Flare Pants With Bow Two-Piece Korean Style Outfit
like
Find Similar
Infant girl two-piece outfit featuring a grey ruffled sweatshirt and blue bow-detail jeans - 73cm / Blue
Baby Girls Clothing Set Spring Long Sleeve Ruffle Sweatshirt And Denim Flare Pants With Bow Two-Piece Korean Style Outfit
$19.60
No MOQ
Free Shipping
Toddler Boys Striped Polo Shirt Short Sleeve Turn-down Collar Cotton Blend Casual Summer Top Comfortable Kids Apparel
Toddler Boys Striped Polo Shirt Short Sleeve Turn-down Collar Cotton Blend Casual Summer Top Comfortable Kids Apparel
like
Find Similar
Classic black and white striped boys' cotton polo shirt with contrast collar and buttons - Black Stripe / 90cm
Classic blue and white striped short-sleeve polo shirt for boys with a white collar - Blue Striped / 90cm
+8
Toddler Boys Striped Polo Shirt Short Sleeve Turn-down Collar Cotton Blend Casual Summer Top Comfortable Kids Apparel
$5.73
No MOQ
Toddler Boys Casual Polyester Two Piece Spring Outfit Cartoon Bear Printed Long Sleeve Sweatshirt And Long Pants Apparel Suit For Kids
Toddler Boys Casual Polyester Two Piece Spring Outfit Cartoon Bear Printed Long Sleeve Sweatshirt And Long Pants Apparel Suit For Kids
like
Find Similar
Cute three bears light green sweatshirt and brown trousers two-piece set for toddler boys - Aqua / 73cm
+4
Toddler Boys Casual Polyester Two Piece Spring Outfit Cartoon Bear Printed Long Sleeve Sweatshirt And Long Pants Apparel Suit For Kids
$16.43
No MOQ
Free Shipping
Infant Baby Girl Winter Floral Hooded Down Jumpsuit Thickened Warm Romper Outerwear With White Duck Down Filling For Newborns
Infant Baby Girl Winter Floral Hooded Down Jumpsuit Thickened Warm Romper Outerwear With White Duck Down Filling For Newborns
like
Find Similar
Winter infant girl floral hooded romper with warm lining and front snap buttons - Pink / 66CM
+4
Infant Baby Girl Winter Floral Hooded Down Jumpsuit Thickened Warm Romper Outerwear With White Duck Down Filling For Newborns
$31.41
No MOQ
Free Shipping
Kids Casual Cotton Cargo Pants Solid Color Elastic Waist Multi Pocket Trousers For Boys Girls Spring Autumn Clothing
Kids Casual Cotton Cargo Pants Solid Color Elastic Waist Multi Pocket Trousers For Boys Girls Spring Autumn Clothing
like
Find Similar
Detailed view of kids cargo pants with elastic waistband and large side flap pockets - Light Gray / 80cm
Close-up of children's washed dark grey denim cargo shorts with elastic waist and large pockets - Dark Gray / 80cm
+10
Kids Casual Cotton Cargo Pants Solid Color Elastic Waist Multi Pocket Trousers For Boys Girls Spring Autumn Clothing
$14.99
No MOQ
Free Shipping
Baby Girls Spring Three-Piece Clothing Set Cotton Floral Ruffle Top Vest And Pants Korean Casual Infant Toddler Outfits
Baby Girls Spring Three-Piece Clothing Set Cotton Floral Ruffle Top Vest And Pants Korean Casual Infant Toddler Outfits
like
Find Similar
Infant girl ruffled cream knit set with floral Peter Pan collar and matching pants - 73cm / Beige
+4
Baby Girls Spring Three-Piece Clothing Set Cotton Floral Ruffle Top Vest And Pants Korean Casual Infant Toddler Outfits
$25.65
No MOQ
Free Shipping
Go to

More in baby & kids

Explore more in bibs

babylayerpolyesterboysstrapbandhandmaterialkerchiefface
solid colorstylepetkidsheartwarmdesignmetalwhiteears

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access