Everful

Wholesale bibs

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Bibs

Find the perfect pieces: toys & games, kids bags, baby clothing & essentials and more

All products in bibs

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Soft Faux Cashmere Hand Tied Bowknot Baby Headband Elastic Nylon Infant Hairband Vintage Solid Color Kids Hair Accessories
Soft Faux Cashmere Hand Tied Bowknot Baby Headband Elastic Nylon Infant Hairband Vintage Solid Color Kids Hair Accessories
like
Find Similar
Black velvet bow headband with skin-tone nylon elastic band for babies and infants - Black
Creamy white imitation cashmere bow headband with soft nylon elastic for infants - Off-white
Elastic baby nylon headband featuring a warm camel cashmere-like bow hair accessory - Khaki
Elastic nylon baby headband with a dark brown faux cashmere bow for infants - Coffee
+9
Soft Faux Cashmere Hand Tied Bowknot Baby Headband Elastic Nylon Infant Hairband Vintage Solid Color Kids Hair Accessories
-4%
$0.60
No MOQ
Soft Baby Girl Elastic Nylon Headband With 3D Plush Flower Comfortable Infant Toddler Hair Band Fashion Hair Accessories
Soft Baby Girl Elastic Nylon Headband With 3D Plush Flower Comfortable Infant Toddler Hair Band Fashion Hair Accessories
like
Find Similar
Detailed shot of soft light blue nylon baby headband with cute felt flower ornaments - Blue
Detailed view of elastic nylon baby headband with 3D plush flowers and soft knit fabric - Purple
Detail of plush handmade flowers on a soft nylon elastic baby headband in beige - Beige Coffee
Macro detail of lavender nylon baby headband with two soft plush decorative flowers - Taro Purple
+6
Soft Baby Girl Elastic Nylon Headband With 3D Plush Flower Comfortable Infant Toddler Hair Band Fashion Hair Accessories
$0.73
No MOQ
Baby Bow Headbands For Girls Nylon Elastic Hair Bands Infant Toddler Soft Bowknot Hair Accessories Assorted Handmade Style
Baby Bow Headbands For Girls Nylon Elastic Hair Bands Infant Toddler Soft Bowknot Hair Accessories Assorted Handmade Style
like
Find Similar
10-piece set of newborn baby bow headbands featuring lace floral and leopard prints - Style (DP005-22)
Set of 10 handmade baby nylon headbands with floral and solid color bows on a card - Style (DP005-23)
Baby Bow Headbands For Girls Nylon Elastic Hair Bands Infant Toddler Soft Bowknot Hair Accessories Assorted Handmade Style
$4.84
No MOQ
Free Shipping
Baby Flower Headband Chiffon Artificial Pearl Rhinestone Soft Elastic Hair Band For Toddler Birthday Party Photography Props
Baby Flower Headband Chiffon Artificial Pearl Rhinestone Soft Elastic Hair Band For Toddler Birthday Party Photography Props
like
Find Similar
Red baby headband with two chiffon flowers and rhinestones on elastic nylon band - Red
Elastic baby headband with two bright yellow chiffon flowers and rhinestone center - Yellow
Teal blue baby headband featuring two hand-sewn chiffon flowers with pearls and rhinestones - Blue
Deep purple infant headband with two handmade chiffon flowers and rhinestone details - Purple
+11
Baby Flower Headband Chiffon Artificial Pearl Rhinestone Soft Elastic Hair Band For Toddler Birthday Party Photography Props
$0.55
No MOQ
Baby Flower Elastic Headband Polyester Fontanelle Protection Hair Band Floral Headpiece For Infant Girls Accessory Gift
Baby Flower Elastic Headband Polyester Fontanelle Protection Hair Band Floral Headpiece For Infant Girls Accessory Gift
like
Find Similar
Close-up detail of soft corduroy flower hairband for infants with high elastic nylon strap - Beige
Elastic baby headband with cute yellow and orange fabric flower on white background - Yellow
Detail of purple corduroy flower decoration on yellow elastic baby headband - Purple
Detail of baby elastic headband with handcrafted green corduroy flower and yellow center - Green
+1
Baby Flower Elastic Headband Polyester Fontanelle Protection Hair Band Floral Headpiece For Infant Girls Accessory Gift
$0.46
No MOQ
Soft Knitted Baby Headband Cute 3D Plush Bee Toddler Hair Band Elastic Winter Warm Headwrap For Newborn Infant Girls Accessory
Soft Knitted Baby Headband Cute 3D Plush Bee Toddler Hair Band Elastic Winter Warm Headwrap For Newborn Infant Girls Accessory
like
Find Similar
Close-up of soft knitted baby headband with cute 3D bee decoration and detailed knit texture - Beige
Detail of baby pink knitted headband with a soft plush honeybee character on center - Pink
Handmade purple knitted baby headband featuring a 3D cute plush bee accessory - Purple
Detailed view of the yellow knitted baby headband featuring a plush 3D cartoon bee motif - Yellow
+4
Soft Knitted Baby Headband Cute 3D Plush Bee Toddler Hair Band Elastic Winter Warm Headwrap For Newborn Infant Girls Accessory
$0.86
No MOQ
Knitted Bow Hair Tie For Baby Girls High Elastic Nylon Headband Soft Handmade Bowknot Hair Accessories For Toddler Infants
Knitted Bow Hair Tie For Baby Girls High Elastic Nylon Headband Soft Handmade Bowknot Hair Accessories For Toddler Infants
like
Find Similar
Detailed macro view of red knitted bow with high elastic seamless beige hair tie - Red
Detail of hand-knitted gray woolen bow attached to a beige elastic high-stretch hair tie - Gray
Cute knitted baby bow headband with khaki yarn bow and high elastic nude fabric band - Ginger Yellow
Chunky knit baby bow hair tie in soft pink and beige high elastic nylon material - Dusty Pink
+1
Knitted Bow Hair Tie For Baby Girls High Elastic Nylon Headband Soft Handmade Bowknot Hair Accessories For Toddler Infants
$0.33
Mix MOQ : 2
Baby Knitted Headband Soft Polyester Warm Winter Hairband With Embroidered Bow Floral Pattern Infant Hair Accessories
Baby Knitted Headband Soft Polyester Warm Winter Hairband With Embroidered Bow Floral Pattern Infant Hair Accessories
like
Find Similar
Detail of baby knitted headband featuring cream wool texture and embroidered bow design - Beige
Close-up of pink knitted baby headband featuring a purple bow with floral embroidery - Pink
Detail of baby knitted headband featuring rose pink yarn and purple bow with white flower embroidery - Rose Red
Detail of mint blue knitted headband featuring an embroidered floral bow for kids - Mint Green
+4
Baby Knitted Headband Soft Polyester Warm Winter Hairband With Embroidered Bow Floral Pattern Infant Hair Accessories
$1.10
No MOQ
Infant Lace Embroidery Flower Headband Hollow Heart Daisy Bow Elastic Hairband Baby Girls Birthday Party Hair Accessories
Infant Lace Embroidery Flower Headband Hollow Heart Daisy Bow Elastic Hairband Baby Girls Birthday Party Hair Accessories
like
Find Similar
Elastic baby headband with white embroidered daisy flowers and gold thread lace trim - Michelia Style (MB677)
Baby embroidery lace headband with daisy flowers, golden stitching and white pearls - Wisteria Style (MB678)
Elegant white lace floral baby headband with gold embroidery and elastic band detail - Rose Style (MB679)
Baby lace headband with embroidered gold and white daisy flower patterns - Leaf Style (MB680)
+2
Infant Lace Embroidery Flower Headband Hollow Heart Daisy Bow Elastic Hairband Baby Girls Birthday Party Hair Accessories
$0.81-0.86
No MOQ
Free Shipping
Baby Girl Lace Bow Headband Vintage Hollow Out Elastic Nylon Hair Band Soft Floral Princess Headwear Toddler Hair Accessories
Baby Girl Lace Bow Headband Vintage Hollow Out Elastic Nylon Hair Band Soft Floral Princess Headwear Toddler Hair Accessories
like
Find Similar
Detailed close-up of dark brown hollow lace bow headband with vintage nylon texture - Band Style (FHML-2283) / Dark Coffee
Close-up of pink lace baby headband with delicate bow and elastic nylon band - Band Style (FHML-2283) / Dusty Pink
Close-up of white hollow lace double-layer bow headband with soft nylon band - Band Style (FHML-2283) / White
Detail of light blue floral lace bow on highly elastic nylon headband for infants - Band Style (FHML-2283) / Light Blue
Baby Girl Lace Bow Headband Vintage Hollow Out Elastic Nylon Hair Band Soft Floral Princess Headwear Toddler Hair Accessories
-4%
$0.69
Mix MOQ : 5
Baby Knit Hat Warm Winter Headband With Large Polka Dot Bow Soft Turban Cap For Infant Toddler Girls Photography Props
Baby Knit Hat Warm Winter Headband With Large Polka Dot Bow Soft Turban Cap For Infant Toddler Girls Photography Props
like
Find Similar
Cozy black baby knit turban hat with a cute white polka dot bow for winter warmth - Black
Cute baby knitted headband in light brown with a large brown polka dot bow - Coffee
Infant red knit hat featuring a large black polka dot bow for winter warmth - Red
Deep pink knitted baby headband featuring a large light pink polka dot bow decoration - Dusky Pink
+4
Baby Knit Hat Warm Winter Headband With Large Polka Dot Bow Soft Turban Cap For Infant Toddler Girls Photography Props
$1.27
No MOQ
Soft Cloth Bowknot Headband Elastic Nylon Hair Band For Baby Toddler Newborn Girl Kids Boutique Hair Accessories Princess Headwrap
Soft Cloth Bowknot Headband Elastic Nylon Hair Band For Baby Toddler Newborn Girl Kids Boutique Hair Accessories Princess Headwrap
like
Find Similar
Close-up of pink tweed bow on soft nylon infant headband showing high elasticity fabric - 10.5*10.5cm / Peach Pink
Close-up of a red textured fabric bow on a soft nude elastic nylon baby headband - 10.5*10.5cm / Red
Detail of mustard yellow tweed fabric bow and soft pink elastic headband for babies - 10.5*10.5cm / Yellow
Detail of tweed bow headband showing intricate black and gold woven fabric texture - 10.5*10.5cm / Caramel color
+7
NewSoft Cloth Bowknot Headband Elastic Nylon Hair Band For Baby Toddler Newborn Girl Kids Boutique Hair Accessories Princess Headwrap
$0.73
Mix MOQ : 2
Baby Girls Lace Bow Headband Soft Nylon Elastic Hairband Newborn Toddler Embroidery Flower Hair Accessories Sweet Headwear
Baby Girls Lace Bow Headband Soft Nylon Elastic Hairband Newborn Toddler Embroidery Flower Hair Accessories Sweet Headwear
like
Find Similar
Soft nylon baby headband with white lace embroidered butterfly bow on pink background - Style 1
Soft white lace embroidery cotton bow headband with seamless nude nylon band for babies - Style 2
Soft nylon baby headband featuring a white lace cotton butterfly bow on pink background - Style 3
Baby Girls Lace Bow Headband Soft Nylon Elastic Hairband Newborn Toddler Embroidery Flower Hair Accessories Sweet Headwear
$0.83
Mix MOQ : 2
Free Shipping
Soft Nylon Infant Headband Handmade Floral Bow Baby Hair Accessories Elastic Seamless Hairbands For Newborn Photography Props
Soft Nylon Infant Headband Handmade Floral Bow Baby Hair Accessories Elastic Seamless Hairbands For Newborn Photography Props
like
Find Similar
Set of 10 cute floral and bow nylon baby headbands in various colors and designs - MS2620 Set
Cute baby bow headband with pink felt wool balls and green leaves on soft nylon band - MB138 Pink Lychee
Elastic baby headband featuring a soft pale pink plush flower with white center detail - MB139 Light Pink Flower
Elastic baby headband featuring twin white felt flowers with gold pearls and green leaves - MB140 Artificial Pearl Green White Flower
+7
Soft Nylon Infant Headband Handmade Floral Bow Baby Hair Accessories Elastic Seamless Hairbands For Newborn Photography Props
$0.26-5.88
No MOQ
Free Shipping
Baby Knit Turban Hat With Large Leopard Print Bow Warm Soft Crochet Beanie Headwear For Newborn Infant Toddler Winter Elastic Cap
Baby Knit Turban Hat With Large Leopard Print Bow Warm Soft Crochet Beanie Headwear For Newborn Infant Toddler Winter Elastic Cap
like
Find Similar
Baby knit beanie hat in khaki with a large leopard print bow for autumn and winter wear - One Size / Yellow
Baby purple grey knit hat featuring a stylish leopard print bow for infant winter warmth - One Size / Purple
Baby Knit Turban Hat With Large Leopard Print Bow Warm Soft Crochet Beanie Headwear For Newborn Infant Toddler Winter Elastic Cap
$0.84
No MOQ
Floral Bow Baby Headband Soft Nylon Elastic Hair Band For Infants Toddlers Kids Hair Accessories Pastoral Style Headwear
Floral Bow Baby Headband Soft Nylon Elastic Hair Band For Infants Toddlers Kids Hair Accessories Pastoral Style Headwear
like
Find Similar
Pink floral bow headband with a high-elastic seamless hair band for baby girls - Pink Floral Style (1)
Pink floral bow baby headband with elastic nylon band for newborn girls accessory - Pink Striped Floral Style (2)
Detail of floral baby headband with a cream-colored bow and elastic nylon strap - Beige Floral Style (3)
Detailed close-up of floral print fabric bow on a soft nude nylon baby headband - Gray Floral Style (4)
+1
Floral Bow Baby Headband Soft Nylon Elastic Hair Band For Infants Toddlers Kids Hair Accessories Pastoral Style Headwear
$0.95
Mix MOQ : 2
Cute Plaid Bow Baby Headband Soft Cotton Linen Elastic Hairband For Toddler Girls Infant Hair Accessories Vintage Plaid Headwrap
Cute Plaid Bow Baby Headband Soft Cotton Linen Elastic Hairband For Toddler Girls Infant Hair Accessories Vintage Plaid Headwrap
like
Find Similar
Detail of baby headband with a grey checkered cotton linen bow on elastic nylon band - Gray Plaid Bow (FHML-0107) / Grey Grid
Soft cotton linen plaid bow headband for infants featuring high-elastic nylon band - Black Plaid Bow (FHML-0107) / Black Plaid
Detailed view of red and beige checkered cotton linen bow with soft nylon elastic headband - Red Plaid Bow (FHML-0107) / Red Plaid
Soft cotton linen plaid bow baby headband with elastic nylon band for newborns - Brown Plaid Bow (FHML-0107) / Brown Grid
+2
Cute Plaid Bow Baby Headband Soft Cotton Linen Elastic Hairband For Toddler Girls Infant Hair Accessories Vintage Plaid Headwrap
$0.75
Mix MOQ : 2
Free Shipping
Baby Elastic Bow Headband Cotton Soft Rabbit Ear Hair Bands Polka Dot Flamingo Prints For Newborn Toddler Girls Hair Accessories
Baby Elastic Bow Headband Cotton Soft Rabbit Ear Hair Bands Polka Dot Flamingo Prints For Newborn Toddler Girls Hair Accessories
like
Find Similar
5-pack elastic baby headbands with rabbit ears and polka dot flamingo patterns - MS5316 Bowknot Headband
Baby Elastic Bow Headband Cotton Soft Rabbit Ear Hair Bands Polka Dot Flamingo Prints For Newborn Toddler Girls Hair Accessories
$4.27
No MOQ
Free Shipping
Lace Bow Baby Headband Soft Elastic Nylon Hairband For Infants Newborn Toddlers Cute Hair Accessories Photography Props Headwear
Lace Bow Baby Headband Soft Elastic Nylon Hairband For Infants Newborn Toddlers Cute Hair Accessories Photography Props Headwear
like
Find Similar
Baby lace bow headband with high-elastic nylon band on soft pink background - White Lace Bow Headband-Beige Band (Style 1)
Soft nylon baby headband with white lace bow on pink background for infant hair accessory - Hollow Lace Bow Headband-Light Coffee Band (Style 2)
Sweet baby headband with a delicate white lace bow and stretchy nylon elastic band - Exquisite Lace Bow Headband-Brown Band (Style 3)
NewLace Bow Baby Headband Soft Elastic Nylon Hairband For Infants Newborn Toddlers Cute Hair Accessories Photography Props Headwear
-5%
$0.60-0.65
Mix MOQ : 2
Baby Bow Headband Cotton Nylon Soft High Elastic Newborn Toddler Infant Bowknot Hair Accessory For Girls Cute Floral Headpiece
Baby Bow Headband Cotton Nylon Soft High Elastic Newborn Toddler Infant Bowknot Hair Accessory For Girls Cute Floral Headpiece
like
Find Similar
Soft cream cotton baby headband featuring a large double-layer bow and elastic nylon strap - Khaki
Soft cotton baby headband with mint green bow on a stretchable nude nylon band - Emerald Green
Light blue cotton gauze bow headband with soft stretch nylon band for newborns - Gray
Detail of soft cotton baby headband showing natural linen bow and seamless nylon band - Dark Khaki
+21
Baby Bow Headband Cotton Nylon Soft High Elastic Newborn Toddler Infant Bowknot Hair Accessory For Girls Cute Floral Headpiece
$0.65
Mix MOQ : 2
Free Shipping
Infant Baby Elastic Headband Strawberry Heart Flower Embroidery Hair Band Soft Fabric Headwear Photography Props Accessories
Infant Baby Elastic Headband Strawberry Heart Flower Embroidery Hair Band Soft Fabric Headwear Photography Props Accessories
like
Find Similar
Elastic baby headband featuring red embroidered strawberry patterns on a soft red band - Strawberry
Close-up of golden heart embroidery details on a soft high-elastic baby headband - Heart
Close-up of golden lace flower headband with elastic band for baby girl photography - Flower
NewInfant Baby Elastic Headband Strawberry Heart Flower Embroidery Hair Band Soft Fabric Headwear Photography Props Accessories
$0.57
Mix MOQ : 2
Baby Velvet Turban Hat Floral Polka Dot Headwrap Warm Beanie For Infant Toddler Girls Kids Soft Elastic Hair Accessories
Baby Velvet Turban Hat Floral Polka Dot Headwrap Warm Beanie For Infant Toddler Girls Kids Soft Elastic Hair Accessories
like
Find Similar
Detailed view of bronze velvet baby turban with a polka dot floral accent and button - Khaki/Earth Yellow
Detail of silver velvet baby beanie featuring a blue polka dot fabric flower ornament - Light Gray
Detail of baby velvet turban hat featuring a handcrafted pink polka dot flower detail - Beige
Detail of baby velvet turban hat with soft pleats and a decorative polka dot fabric flower - Taro Purple
+5
Baby Velvet Turban Hat Floral Polka Dot Headwrap Warm Beanie For Infant Toddler Girls Kids Soft Elastic Hair Accessories
$1.10
No MOQ
Independence Day Baby Girl Bow Headband American Flag Star Stripe Pattern Waffle Fabric Soft Elastic Hair Band Accessories
Independence Day Baby Girl Bow Headband American Flag Star Stripe Pattern Waffle Fabric Soft Elastic Hair Band Accessories
like
Find Similar
Detail view of baby bow headband featuring red and white striped waffle fabric and nylon strap - Red and White Striped Bow
Detailed view of large red popcorn fabric baby headband with textured waffle knit bow - Red Bow
Independence Day baby headband with blue star pattern and waffle texture fabric - Blue with White Stars Bow
Navy blue waffle knit bow headband with elastic nude nylon band for babies - Blue Bow
NewIndependence Day Baby Girl Bow Headband American Flag Star Stripe Pattern Waffle Fabric Soft Elastic Hair Band Accessories
$0.54
Mix MOQ : 2
Infant Turban Hat With Large Satin Bow Soft Knit Baby Beanie Bohemian Style Headwrap For Toddler Girls Daily Photography
Infant Turban Hat With Large Satin Bow Soft Knit Baby Beanie Bohemian Style Headwrap For Toddler Girls Daily Photography
like
Find Similar
Close-up of baby knit turban hat featuring white textured fabric and green satin bow - Green Bow Style / White
Newborn baby turban hat with cream knit texture and a large golden satin bow decoration - Gold Bow Style / Beige
Detailed view of pink knitted baby turban hat featuring a large satin bow and texture - Snow Bud
Detailed close-up of a lavender infant turban hat featuring a large satin bow and knit texture - Purple
+6
Infant Turban Hat With Large Satin Bow Soft Knit Baby Beanie Bohemian Style Headwrap For Toddler Girls Daily Photography
$0.98
No MOQ
Baby Turban Hat Ribbed Knit Large Bow With Gold Polka Dots Soft Headwrap Beanie For Toddler Infants
Baby Turban Hat Ribbed Knit Large Bow With Gold Polka Dots Soft Headwrap Beanie For Toddler Infants
like
Find Similar
Bright yellow baby turban hat with golden polka dot bow in soft ribbed knit fabric - Yellow
Grass green baby turban with ribbed knit fabric and gold polka dot chiffon bow - Green
Light blue ribbed knit baby turban featuring a large gold foil polka dot chiffon bow - Blue
Purple newborn turban hat with large gold polka dot mesh bow and ribbed knit fabric - Purple
+8
Baby Turban Hat Ribbed Knit Large Bow With Gold Polka Dots Soft Headwrap Beanie For Toddler Infants
$0.85
No MOQ
 · 
18 views
Vintage Baby Headbands Embroidered Cotton Bow Elastic Soft Nylon Hair Bands For Infant Toddler Kids Hair Accessories
Vintage Baby Headbands Embroidered Cotton Bow Elastic Soft Nylon Hair Bands For Infant Toddler Kids Hair Accessories
like
Find Similar
Detailed macro view of mustard yellow cotton eyelet embroidered bow with elastic baby headband - Turmeric
Close-up of pink embroidered lace bow with high-elastic band for baby hair accessory - Deep Pink
Detailed view of brick red embroidered cotton bow on soft elastic baby headband - Orange Red
Close-up of cream embroidered cotton bow headband with soft nylon strap on ceramic plate - Off White
+5
Vintage Baby Headbands Embroidered Cotton Bow Elastic Soft Nylon Hair Bands For Infant Toddler Kids Hair Accessories
$0.69
Mix MOQ : 2
Free Shipping
Baby Girls Lace Bow Headband High Elastic Soft Nylon Hair Band Handcrafted Embroidery Flower Infant Toddler Hair Accessories
Baby Girls Lace Bow Headband High Elastic Soft Nylon Hair Band Handcrafted Embroidery Flower Infant Toddler Hair Accessories
like
Find Similar
Close-up of red lace embroidery bow on soft elastic nylon headband for babies - 8.5x5cm / Red
Detail of white lace bow headband with soft elastic nylon band for baby girls - 8.5x5cm / White
Detailed macro view of cream lace bow baby headband with intricate floral embroidery - 8.5x5cm / Beige
Detail of baby lace bow headband with purple floral embroidery on soft nylon elastic band - 8.5x5cm / Purple
+4
Baby Girls Lace Bow Headband High Elastic Soft Nylon Hair Band Handcrafted Embroidery Flower Infant Toddler Hair Accessories
$0.72
Mix MOQ : 2
Baby Girls Knit Turban Hat Large Bow With Artificial Pearls Lace Warm Winter Beanie Infant Toddler Pullover Hat Photography Props
Baby Girls Knit Turban Hat Large Bow With Artificial Pearls Lace Warm Winter Beanie Infant Toddler Pullover Hat Photography Props
like
Find Similar
Close-up of pink knit baby turban featuring satin bow with lace and pearl details - Pink
Detail of baby winter hat featuring a black bow with white lace and pearl cluster - Black
Detail of yellow knit baby hat featuring a lace bow with decorative pearls - Yellow
Detailed knit texture of grey baby winter hat with large white pearl bow and lace accent - Gray
+5
Baby Girls Knit Turban Hat Large Bow With Artificial Pearls Lace Warm Winter Beanie Infant Toddler Pullover Hat Photography Props
$1.10
No MOQ
Kids Glitter Crown Headband Elastic Fabric Sequin Tiara For Baby Girls Birthday Party Photography Props Princess Hair Accessories
Kids Glitter Crown Headband Elastic Fabric Sequin Tiara For Baby Girls Birthday Party Photography Props Princess Hair Accessories
like
Find Similar
Glitter crown baby headbands set in pink, gold, purple and blue for party photos - 4 Pieces Set (MS5404)
Sparkly gold glitter crown headband for baby birthday parties and photo shoots - Gold (MB5808)
Pink glitter heart crown baby headband with high elastic band for birthday photo prop - Rose Red (MB5809)
Elastic baby headband with purple glitter crown for birthday party photoshoot - Purple (MB5810)
+1
Kids Glitter Crown Headband Elastic Fabric Sequin Tiara For Baby Girls Birthday Party Photography Props Princess Hair Accessories
$0.86-3.46
No MOQ
Free Shipping
Baby Flower Headband Nylon Elastic Chiffon Fabric Hair Band Soft Seamless For Infant Toddler Photography Props
Baby Flower Headband Nylon Elastic Chiffon Fabric Hair Band Soft Seamless For Infant Toddler Photography Props
like
Find Similar
Close-up of a soft beige nylon baby headband with a light green chiffon flower decoration - Pale Green
Detail of pink fabric flower with faux pearl on beige elastic nylon baby headband - Pink Pearl
Detailed view of elastic khaki baby headband featuring white 3D flower with yellow stamen - White Flower Center
Detail of beige elastic baby headband with soft orange and black fabric flowers and pearl - Orange and Black
+7
Baby Flower Headband Nylon Elastic Chiffon Fabric Hair Band Soft Seamless For Infant Toddler Photography Props
-6%
$0.33-4.10
No MOQ
 · 
15 views
Baby Turban Hat With Large Flower Soft Stretchy Polyester Beanie For Newborns Infants Toddlers Warm Headwrap Photography Prop
Baby Turban Hat With Large Flower Soft Stretchy Polyester Beanie For Newborns Infants Toddlers Warm Headwrap Photography Prop
like
Find Similar
White baby turban hat with a 3D floral decoration made of soft elastic knit cotton - White
Baby white knit turban hat featuring a delicate light pink fabric flower accessory - White And Nude Pink
Infant winter turban hat in soft grey knit with a peach fabric flower ornament - Gray
Pink infant turban hat with a large white flower detail and soft pleated knit fabric - Pink
+9
Baby Turban Hat With Large Flower Soft Stretchy Polyester Beanie For Newborns Infants Toddlers Warm Headwrap Photography Prop
$1.01
No MOQ
Handmade Cotton Linen Bow Baby Headband Soft Elastic Nylon Newborn Toddler Knit Bow Hair Band Kids Accessories
Handmade Cotton Linen Bow Baby Headband Soft Elastic Nylon Newborn Toddler Knit Bow Hair Band Kids Accessories
like
Find Similar
Soft pink knit bow baby headband with stretchy nylon strap for infants and newborns - Taro Purple
Macro shot of light blue hand-knitted bow and ultra-soft elastic headband for infants - Gray
Detailed view of soft knit bow on high-elastic nylon headband for infants and babies - White
Detail of soft knit apricot pink bow headband with elastic seamless band for baby girls - Light Orange
+8
Handmade Cotton Linen Bow Baby Headband Soft Elastic Nylon Newborn Toddler Knit Bow Hair Band Kids Accessories
$0.57
Mix MOQ : 2
Handmade Kids Grosgrain Ribbon Flower Headband Toddler Girls Multi Layer Bow Hair Band Soft Headpiece Hair Accessory
Handmade Kids Grosgrain Ribbon Flower Headband Toddler Girls Multi Layer Bow Hair Band Soft Headpiece Hair Accessory
like
Find Similar
Kids' purple handmade multilayer ribbon flower headband for girls hair accessories - Purple (5)
Green layered grosgrain ribbon flower headband for girls featuring a handmade bow design - Grass Green (20)
Handmade Kids Grosgrain Ribbon Flower Headband Toddler Girls Multi Layer Bow Hair Band Soft Headpiece Hair Accessory
$0.63
Mix MOQ : 2
Vintage Floral Lace Bow Baby Headband Soft Nylon Elastic Hair Band For Infant Toddler Girl Pastoral Style Hair Accessory
Vintage Floral Lace Bow Baby Headband Soft Nylon Elastic Hair Band For Infant Toddler Girl Pastoral Style Hair Accessory
like
Find Similar
Baby floral lace bow headband with blue embroidery on high elastic nylon band - Blue Flower
Close-up of baby nylon headband featuring vintage floral embroidery on lace bow - Red Small Flower
Detailed close-up of cream lace bow with floral embroidery on pink nylon headband - Blue And Red Floral
Detail view of baby bow headband with vintage floral embroidery and lace texture - Red and Green Floral
+1
NewVintage Floral Lace Bow Baby Headband Soft Nylon Elastic Hair Band For Infant Toddler Girl Pastoral Style Hair Accessory
$0.48
Mix MOQ : 2
Baby Bow Headband Floral Polka Dot Printed Cotton Headwear For Infants Toddlers Cute Elastic Hair Bands Accessory For Girls
Baby Bow Headband Floral Polka Dot Printed Cotton Headwear For Infants Toddlers Cute Elastic Hair Bands Accessory For Girls
like
Find Similar
3-pack floral and polka dot baby bow headbands for girls made of stretchy fabric - Floral Polka Dot Red Style (1)
Detailed view of three purple baby bow headbands on a decorative display card - Purple Heart Butterfly Style (2)
Detailed view of 3-piece floral and polka dot infant headbands on display card - Yellow Floral Butterfly Polka Dot Style (3)
Detailed view of three-piece baby bow headband set with whale and stripe patterns - Pink Stripe Whale Style (4)
+4
Baby Bow Headband Floral Polka Dot Printed Cotton Headwear For Infants Toddlers Cute Elastic Hair Bands Accessory For Girls
$3.17
Mix MOQ : 2
Soft Elastic Baby Headband With 3D Cartoon Cat Patch Embroidery Stretchy Nylon Hair Band For Infant Toddler Newborn Accessories
Soft Elastic Baby Headband With 3D Cartoon Cat Patch Embroidery Stretchy Nylon Hair Band For Infant Toddler Newborn Accessories
like
Find Similar
Elastic nylon baby headband with a cute plush pink cat doll and soft knitted texture - Light Pink
Detail of white nylon baby headband with a soft purple plush cat cartoon ornament - White
Detail of baby headband with a cute 3D plush cartoon cat on soft elastic pink fabric - Pink
Close-up of pink nylon baby headband with a cute 3D plush cat doll and soft embroidery - Pink
+10
Soft Elastic Baby Headband With 3D Cartoon Cat Patch Embroidery Stretchy Nylon Hair Band For Infant Toddler Newborn Accessories
$0.61
No MOQ
Baby Flower Headband Elastic Hair Band For Infant Toddler Girls Soft Polyester Floral Hair Accessories Sweet Style
Baby Flower Headband Elastic Hair Band For Infant Toddler Girls Soft Polyester Floral Hair Accessories Sweet Style
like
Find Similar
Close-up of baby stretchy headband featuring a soft pink multi-layered fabric flower - Beige
Close-up of baby headband featuring a textured elastic pink band with 3D fabric flower - Pink
Detail of mint green elastic baby headband with 3D fabric flower on white display card - Mint Green
Detail showing high-elastic pink baby headband with a handmade layered fabric flower - Snow Bud
+6
NewBaby Flower Headband Elastic Hair Band For Infant Toddler Girls Soft Polyester Floral Hair Accessories Sweet Style
$0.58
No MOQ
Baby Girls Sweet 3D Butterfly Lace Headband Toddler Elastic Floral Bow Hairband Princess Hair Accessories Headwear
Baby Girls Sweet 3D Butterfly Lace Headband Toddler Elastic Floral Bow Hairband Princess Hair Accessories Headwear
like
Find Similar
Sweet pink floral bow headband for babies with beige lace elastic band on pink background - Pink Butterfly Headband
Baby Girls Sweet 3D Butterfly Lace Headband Toddler Elastic Floral Bow Hairband Princess Hair Accessories Headwear
$1.24
Mix MOQ : 2
Free Shipping
Bohemian Knot Baby Turban Hat Polyester Soft Stretchy Headwrap Infant Toddler India Style Beanie Cap For Daily Photography
Bohemian Knot Baby Turban Hat Polyester Soft Stretchy Headwrap Infant Toddler India Style Beanie Cap For Daily Photography
like
Find Similar
Soft light pink baby turban hat with Bohemian knot detail for infants and toddlers - White
Pink bohemian style knotted baby turban hat made of soft knitted fabric for infants - Pink
Soft bright yellow baby turban hat with Bohemian knot detail for infants and toddlers - Yellow
Red baby turban hat with twisted knot design in soft knit fabric for infants - Red
+7
Bohemian Knot Baby Turban Hat Polyester Soft Stretchy Headwrap Infant Toddler India Style Beanie Cap For Daily Photography
$0.75
No MOQ
Baby Girl Floral Bow Headband Soft Nylon Ribbed Knit Hair Band Elastic Wide Headwraps For Infants Toddlers Kids Hair Accessories
Baby Girl Floral Bow Headband Soft Nylon Ribbed Knit Hair Band Elastic Wide Headwraps For Infants Toddlers Kids Hair Accessories
like
Find Similar
Detail of soft ribbed nylon baby headband with deep red floral pattern and bow knot - Brown Small Floral
Detail of baby headband featuring large bow and yellow sunflower print on knit fabric - Bright Sunflower
Close-up of baby nylon headband with purple floral bow and soft cable knit texture - Shades of Purple
Detail view of baby nylon headband with red rose print and large cable knit bow - White with Rose Print
+4
NewBaby Girl Floral Bow Headband Soft Nylon Ribbed Knit Hair Band Elastic Wide Headwraps For Infants Toddlers Kids Hair Accessories
-4%
$1.97
Mix MOQ : 2
Free Shipping
Baby Girl Lace Bow Headband Elastic Breathable Soft Hairband For Infants Toddlers Princess Style Daily Accessory Jewelry
Baby Girl Lace Bow Headband Elastic Breathable Soft Hairband For Infants Toddlers Princess Style Daily Accessory Jewelry
like
Find Similar
Detailed view of beige lace baby headband featuring floral embroidery and big bow - Khaki
Detailed texture of light blue baby headband with large bow and leaf patterns - Blue
Baby Girl Lace Bow Headband Elastic Breathable Soft Hairband For Infants Toddlers Princess Style Daily Accessory Jewelry
$0.81
Mix MOQ : 2
Newborn Baby Turban Hat Breathable Lace Mesh Beanie With Large Gold Polka Dot Bow Knot For Toddler Girls Headwear
Newborn Baby Turban Hat Breathable Lace Mesh Beanie With Large Gold Polka Dot Bow Knot For Toddler Girls Headwear
like
Find Similar
Detailed macro view of purple lace baby turban with gold polka dot bow decoration - Purple
Detail of pink baby turban hat with golden dot bow and lace openwork texture - Pink
Detailed texture of dusty pink baby hat with gold polka dot bow and sequin band decoration - Dusty Pink
Close-up of baby bonnet featuring cream lace pattern and pink polka dot bow decoration - Off White
+2
Newborn Baby Turban Hat Breathable Lace Mesh Beanie With Large Gold Polka Dot Bow Knot For Toddler Girls Headwear
-4%
$0.88
No MOQ
Baby Girl Jacquard Knit Bow Headband Soft High Elastic Nylon Hair Band For Newborn Infant Toddler Kids Hair Accessories
Baby Girl Jacquard Knit Bow Headband Soft High Elastic Nylon Hair Band For Newborn Infant Toddler Kids Hair Accessories
like
Find Similar
Detailed view of red jacquard knitted bow headband with soft nude nylon hair band - Dark Red
Detailed close-up of a black jacquard bow on a soft nylon headband for babies - Black
Detailed view of sage green textured jacquard bow on soft nylon elastic baby headband - Bean Green
Detailed close-up of light khaki jacquard knit bow with soft nylon baby headband texture - Camel
+8
Baby Girl Jacquard Knit Bow Headband Soft High Elastic Nylon Hair Band For Newborn Infant Toddler Kids Hair Accessories
$0.68
Mix MOQ : 2
Elastic Baby Headband Large Knitted Flower Soft Ribbed Hairband Gingham Center Headwrap Toddler Girls Daily Hair Accessories
Elastic Baby Headband Large Knitted Flower Soft Ribbed Hairband Gingham Center Headwrap Toddler Girls Daily Hair Accessories
like
Find Similar
Soft nylon baby headband in light brown featuring a large sunflower with plaid center - Caramel color
Beige ribbed nylon baby headband featuring a soft large floral bloom with pink checkered core - Apricot
Elastic Baby Headband Large Knitted Flower Soft Ribbed Hairband Gingham Center Headwrap Toddler Girls Daily Hair Accessories
$0.86
Mix MOQ : 2
Handmade Knit Bow Baby Headband With Plush Trim Elastic Nylon Hairband For Newborn Infant Toddler Christmas Hair Accessories
Handmade Knit Bow Baby Headband With Plush Trim Elastic Nylon Hairband For Newborn Infant Toddler Christmas Hair Accessories
like
Find Similar
Detail of a black knit hairband with white plush edges and high-stretch nylon band - Black
Detail of dark brown knitted bow headband with white ruffled trim and elastic nylon band - Camel
Detail of pink knitted plush bow headband with high elastic nylon band for baby girls - Pink
Detail of red knitted bow baby headband with soft white fuzzy trim and elastic nylon band - Red
+1
Handmade Knit Bow Baby Headband With Plush Trim Elastic Nylon Hairband For Newborn Infant Toddler Christmas Hair Accessories
$0.61
Mix MOQ : 2
Boho Printed Baby Nylon Headband Soft Elastic Donut Knot Headwrap For Toddler Infant Newborn Girls Cute Hair Accessories
Boho Printed Baby Nylon Headband Soft Elastic Donut Knot Headwrap For Toddler Infant Newborn Girls Cute Hair Accessories
like
Find Similar
Detailed macro view of green baby headband with lime fruit prints and twisted donut knot - Lime Avocado
Bohemian floral baby headband with soft pink nylon and large donut knot flower - Cartoon Small Flower
Colorful tie-dye baby headband with 3D donut knot made of soft stretch nylon fabric - Tie-dye Aurora
Close-up of soft floral nylon baby headband with 3D donut knot on pink background - White Background Pink Floral
+4
Boho Printed Baby Nylon Headband Soft Elastic Donut Knot Headwrap For Toddler Infant Newborn Girls Cute Hair Accessories
-10%
$2.29
Mix MOQ : 2
Free Shipping
Baby Headbands Wide Jacquard Nylon Knitted Double Bow Soft Elastic Hair Bands For Toddler Infants Newborns
Baby Headbands Wide Jacquard Nylon Knitted Double Bow Soft Elastic Hair Bands For Toddler Infants Newborns
like
Find Similar
Detailed close-up of khaki knit baby headband with large bow and cable stitch texture - Dark Brown
Detail of soft white knitted baby headband with oversized bow and intricate jacquard texture - White
Detail of pink knitted baby headband showing the soft texture and large double bow design - Pink
Detail of navy blue knitted baby headband featuring a large textured double layer bow - Dark Blue
+8
Baby Headbands Wide Jacquard Nylon Knitted Double Bow Soft Elastic Hair Bands For Toddler Infants Newborns
$1.25
Mix MOQ : 2
 · 
72 sold recently
Infant Headbands Bows Flowers Elastic Nylon Hair Bands Newborn Toddler Handmade Cute Hair Accessories Gift Collection
Infant Headbands Bows Flowers Elastic Nylon Hair Bands Newborn Toddler Handmade Cute Hair Accessories Gift Collection
like
Find Similar
Handmade orange felt flower baby headband with green leaves on soft elastic band - Three Orange Fruit Style (MB128)
Pink and white handmade floral baby headband with a soft nylon elastic band - Pink Center White Flower Style (MB129)
Pinkish coral suede bow baby headband with elastic beige nylon band for infants - Watermelon Red Slim Bow Style (MB130)
Pink textured faux leather bow headband for babies with beige high elasticity strap - Pink Faux Leather Bow Style (MB131)
+7
Infant Headbands Bows Flowers Elastic Nylon Hair Bands Newborn Toddler Handmade Cute Hair Accessories Gift Collection
$0.26-6.02
No MOQ
Free Shipping
Independence Day Baby Headbands Red White Blue Bow Stars Stripes Elastic Hair Bands Infants Toddlers Kids Festive Party Hair Accessories
Independence Day Baby Headbands Red White Blue Bow Stars Stripes Elastic Hair Bands Infants Toddlers Kids Festive Party Hair Accessories
like
Find Similar
Set of 3 Patriotic Fourth of July baby headbands with red white and blue star bow knots - 1# American Flag Style
Baby headband set featuring red white and blue stars and stripes bow designs - 2# American Flag Style
Independence Day Baby Headbands Red White Blue Bow Stars Stripes Elastic Hair Bands Infants Toddlers Kids Festive Party Hair Accessories
-4%
$1.92
No MOQ
Newborn Baby Nylon Headband Set Soft Fabric Bow Flower Elastic Hairband For Toddler Infants Girls Mesh Embroidered Hair Accessories
Newborn Baby Nylon Headband Set Soft Fabric Bow Flower Elastic Hairband For Toddler Infants Girls Mesh Embroidered Hair Accessories
like
Find Similar
8-pack baby nylon headbands with linen fabric bows in various colors and floral patterns - Cotton Linen Bow Style (FHMLT-0009)
10-piece set of floral baby headbands with assorted fabric flowers and elastic nylon bands - Fabric Flower Style (FHMLT-0009)
Set of 10 soft nylon baby bow headbands in various colors on a cardboard display card - Embroidered Mesh Bow Style (FHMLT-0009)
Newborn Baby Nylon Headband Set Soft Fabric Bow Flower Elastic Hairband For Toddler Infants Girls Mesh Embroidered Hair Accessories
-5%
$4.52-5.89
Mix MOQ : 2
Soft Velvet Bow Baby Headband Elastic Nylon Infant Hairband Solid Color Toddler Headwear Sweet Princess Hair Accessories
Soft Velvet Bow Baby Headband Elastic Nylon Infant Hairband Solid Color Toddler Headwear Sweet Princess Hair Accessories
like
Find Similar
Detail of soft velvet burgundy bow on elastic nylon headband for babies and toddlers - 10.5*7.5cm / Burgundy
Detail shot of a soft pink velvet bow on a high-elastic nylon baby headband - 10.5*7.5cm / Light Pink
Detailed view of dark pink suede bow attached to a soft beige elastic nylon headband - 10.5*7.5cm / Dark Purple
Sweet mustard yellow velvet bow headband for infants with soft nylon elastic band - 10.5*7.5cm / Ginger Yellow
+10
Soft Velvet Bow Baby Headband Elastic Nylon Infant Hairband Solid Color Toddler Headwear Sweet Princess Hair Accessories
$0.68
Mix MOQ : 2
Baby Girls Elastic Crochet Headband Large Chiffon Flower Artificial Pearl Hair Band For Kids Handmade Hair Accessories
Baby Girls Elastic Crochet Headband Large Chiffon Flower Artificial Pearl Hair Band For Kids Handmade Hair Accessories
like
Find Similar
Elastic baby headband featuring a large pink chiffon flower and yellow knitted band - Pink Flower Yellow Band
Green crochet baby headband featuring a large white fabric flower with silver glitter details - White Flower Green Band
Pink chiffon floral headband with elastic lace band for infants and baby girls - Pink Flower Cream Band
White crochet elastic headband with coral pink chiffon flower and mint green leaves - Coral Pink Flower White Band
+6
Baby Girls Elastic Crochet Headband Large Chiffon Flower Artificial Pearl Hair Band For Kids Handmade Hair Accessories
-4%
$0.47
No MOQ
Kids Fashion Heart Shaped Sunglasses Bow Headband Set For Girls UV400 Protection Outdoor Party Plastic Polyester Accessories
Kids Fashion Heart Shaped Sunglasses Bow Headband Set For Girls UV400 Protection Outdoor Party Plastic Polyester Accessories
like
Find Similar
Pink heart-shaped sunglasses with a white waffle-knit lips-print bow headband set - Lipstick Printed / Rose Red
Kids heart sunglasses and red heart print waffle bow headband set in white - Heart Printed / Red
Kids Fashion Heart Shaped Sunglasses Bow Headband Set For Girls UV400 Protection Outdoor Party Plastic Polyester Accessories
-5%
$1.35
No MOQ
Baby Girl Floral Bow Headband Soft Nylon Elastic Hair Band Infant Toddler Sweet Cotton Bowknot Headwrap Hair Accessories
Baby Girl Floral Bow Headband Soft Nylon Elastic Hair Band Infant Toddler Sweet Cotton Bowknot Headwrap Hair Accessories
like
Find Similar
Close-up of floral print cotton bow headband with soft nude elastic nylon strap - Purple Print
Floral print soft cotton baby headband with oversized bow and seamless nylon band - Red Floral
Floral cotton bow headband for baby girls with soft nylon band on pink background - Green Floral
Soft floral cotton bow baby headband with elastic nylon band for toddlers - Blue Floral Print
Baby Girl Floral Bow Headband Soft Nylon Elastic Hair Band Infant Toddler Sweet Cotton Bowknot Headwrap Hair Accessories
-29%
$0.58
Mix MOQ : 2
Handmade Elastic Fabric Baby Headbands For Infants Toddlers Cute Floral Polka Dot Bow Knot Donut Headwear Hair Accessories
Handmade Elastic Fabric Baby Headbands For Infants Toddlers Cute Floral Polka Dot Bow Knot Donut Headwear Hair Accessories
like
Find Similar
3-piece baby headband set with floral and polka dot prints and doughnut knots - MS2051 Style
3-piece baby headband set with leopard print and coral solid color donut knots - MS2053 Style
Three-pack baby bow headbands featuring pink heart, purple dot, and leopard patterns - MS2055 Style
3-pack baby headbands with lemon, red, and cherry prints for cute infant hair accessories - MS2059 Style
+1
Handmade Elastic Fabric Baby Headbands For Infants Toddlers Cute Floral Polka Dot Bow Knot Donut Headwear Hair Accessories
$3.40-3.60
No MOQ
Baby Turban Hat Soft Knitted Beanie With Large Sequin Bow Cute Infant Newborn Toddler Headwrap Fashion Accessories
Baby Turban Hat Soft Knitted Beanie With Large Sequin Bow Cute Infant Newborn Toddler Headwrap Fashion Accessories
like
Find Similar
White baby beanie with a sparkling gold sequin bow detail on a knitted turban cap - White
Detail of beige knitted baby hat featuring a large shimmering gold sequin bow accent - Beige
Detail of light purple baby turban hat with a large deep purple sequin bow decoration - Purple
Pink knit baby beanie featuring a large sparkling sequin bow on a soft white background - Snow Bud
+5
Baby Turban Hat Soft Knitted Beanie With Large Sequin Bow Cute Infant Newborn Toddler Headwrap Fashion Accessories
$1.15
No MOQ
Glitter Sequin Bow Baby Headband Soft Nylon Headwear For Newborn Infants Toddlers Girls Christmas Birthday Hair Accessory
Glitter Sequin Bow Baby Headband Soft Nylon Headwear For Newborn Infants Toddlers Girls Christmas Birthday Hair Accessory
like
Find Similar
Close-up of baby headband with double-layered red glitter bow and soft nylon band - Red
Glittery green layered bow baby headband with soft high-elastic nylon band on pink background - Green
Glitter bow baby headband with stretchy nude nylon band for infants and toddlers - Gold
Glitter Sequin Bow Baby Headband Soft Nylon Headwear For Newborn Infants Toddlers Girls Christmas Birthday Hair Accessory
$0.57
Mix MOQ : 2
Baby Girls Cotton Floral Bow Headband Soft Seamless Nylon Elastic Hair Band For Infant Toddler Hair Accessories
Baby Girls Cotton Floral Bow Headband Soft Seamless Nylon Elastic Hair Band For Infant Toddler Hair Accessories
like
Find Similar
Soft floral cotton bow baby headband with stretchy nude nylon band for infant photography - Pink Floral Style
Soft nylon baby headband with a vintage floral cotton bow on a pink background - Vintage Multicolor Floral Style
Soft floral cotton bow baby headband with stretchy nude nylon band on pink background - Blue-Purple Floral Style
Baby Girls Cotton Floral Bow Headband Soft Seamless Nylon Elastic Hair Band For Infant Toddler Hair Accessories
-42%
$0.55
Mix MOQ : 2
Free Shipping
Baby Girl Turban Hat Ribbed Floral Printed Cap Large Mesh Bow Golden Polka Dot Infant Toddler Bohemian Headwrap Accessories
Baby Girl Turban Hat Ribbed Floral Printed Cap Large Mesh Bow Golden Polka Dot Infant Toddler Bohemian Headwrap Accessories
like
Find Similar
Floral print baby turban hat with a purple chiffon bow and gold foil polka dots decoration - Purple Floral (A)
Floral ribbed baby turban hat with pink sequin bow for infants and toddlers - Pink Floral (B)
Deep purple floral baby turban hat with a large pink polka dot mesh bow decoration - Dark Purple Floral (Style C)
Beige ribbed baby hat with teal floral prints and a gold polka dot tulle bow - Letter D
+2
Baby Girl Turban Hat Ribbed Floral Printed Cap Large Mesh Bow Golden Polka Dot Infant Toddler Bohemian Headwrap Accessories
$1.01
No MOQ
Baby Flower Headband Handmade Chiffon Floral Elastic Nylon Hair Band For Newborn Infant Toddler Girls Photography Props
Baby Flower Headband Handmade Chiffon Floral Elastic Nylon Hair Band For Newborn Infant Toddler Girls Photography Props
like
Find Similar
Detail of purple floral baby headband with soft fabric roses, pearls and elastic nylon strap - Style 07
Detail of baby floral headband with handmade fabric flowers, pearls and rhinestones - Style 03
Detail view of baby flower headband with chiffon petals, pearls and elastic nylon band - Style 11
Detail of pink fabric flowers and green leaves on a soft elastic baby headband - Style 12
+20
Baby Flower Headband Handmade Chiffon Floral Elastic Nylon Hair Band For Newborn Infant Toddler Girls Photography Props
$0.63-1.83
Mix MOQ : 3
 · 
52 sold recently
Free Shipping
Go to

More in baby & kids

Explore more in bibs

babylayerpolyesterboysstrapbandhandmaterialkerchiefface
solid colorstylepetkidsheartwarmdesignmetalwhiteears

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access