Everful

Wholesale checkered hats

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Checkered Hats

Find the perfect pieces: baseball caps, bucket hats, cowboy hats and more

Men's Hats

All products in checkered hats

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Double Sided Bucket Hat For Women Marble Print Tie Dye Acrylic Sun Protection Breathable Foldable Outdoor Summer Travel
Double Sided Bucket Hat For Women Marble Print Tie Dye Acrylic Sun Protection Breathable Foldable Outdoor Summer Travel
like
Find Similar
Blue marble patterned reversible sun bucket hat for women with wide brim UV protection - Style 1 (Blue Marble)
Double-sided sun hat with pink and blue tie-dye marble pattern for women outdoor summer - Style 2 (Pink Blue Marble)
Double Sided Bucket Hat For Women Marble Print Tie Dye Acrylic Sun Protection Breathable Foldable Outdoor Summer Travel
-4%
$2.33
Mix MOQ : 2
 · 
71 sold recently
Vintage Corduroy Newsboy Cap For Men Women Adjustable Ivy Flat Cap Retro Distressed Washed Newsboy Hat Spring Autumn Outdoor
Vintage Corduroy Newsboy Cap For Men Women Adjustable Ivy Flat Cap Retro Distressed Washed Newsboy Hat Spring Autumn Outdoor
like
Find Similar
Vintage corduroy newsboy cap in distressed black gray with adjustable metal buckle - Adjustable / Black
Retro corduroy flat cap in dark brown with adjustable metal buckle and vintage texture - Adjustable / Coffee
Vintage brown corduroy newsboy cap for men and women with adjustable side buckle - Adjustable / Khaki
Vintage navy corduroy flat cap with acid wash texture and adjustable metal side buckle - Adjustable / Blue
+1
Vintage Corduroy Newsboy Cap For Men Women Adjustable Ivy Flat Cap Retro Distressed Washed Newsboy Hat Spring Autumn Outdoor
$5.19
No MOQ
Retro Plaid Beret Hat For Men Women Cotton Breathable Flat Cap British Style Newsboy Hat Adjustable Sun Protection Ivy Cap
Retro Plaid Beret Hat For Men Women Cotton Breathable Flat Cap British Style Newsboy Hat Adjustable Sun Protection Ivy Cap
like
Find Similar
Detail view of red plaid beret with black brim and adjustable silver metal side buckle - Adjustable / Red
Detail of checkered flat cap with breathable texture and silver adjustable side buckle - Adjustable / Khaki
Breathable plaid beret hat in black and grey with adjustable metal buckle side - Adjustable / Black
Breathable plaid ivy cap for men and women featuring a classic beige and black grid pattern - Adjustable / White
+1
NewRetro Plaid Beret Hat For Men Women Cotton Breathable Flat Cap British Style Newsboy Hat Adjustable Sun Protection Ivy Cap
-4%
$3.83
Mix MOQ : 2
Vintage Wide Brim Fedora Hat Cotton Polyester Woolen Felt With Woven Band Tassel Retro British Style For Women Men
Vintage Wide Brim Fedora Hat Cotton Polyester Woolen Felt With Woven Band Tassel Retro British Style For Women Men
like
Find Similar
Detail of red wool felt fedora with a brown braided leather band and tassel accents - M (56-58cm) / Red
Detail of yellow wool fedora hat featuring a brown braided leather band and tassel - M (56-58cm) / Yellow
Close-up of royal blue wool fedora with brown braided band and tassel detail - M (56-58cm) / Blue
Detail of purple wool felt fedora featuring dark brown braided band and tassel decor - M (56-58cm) / Purple
+50
NewVintage Wide Brim Fedora Hat Cotton Polyester Woolen Felt With Woven Band Tassel Retro British Style For Women Men
$3.75
No MOQ
Men Women Flat Cap Wool Blend Tweed Herringbone Newsboy Ivy Hat British Vintage Plaid Corduroy Winter Warm Driving Cap
Men Women Flat Cap Wool Blend Tweed Herringbone Newsboy Ivy Hat British Vintage Plaid Corduroy Winter Warm Driving Cap
like
Find Similar
Classic brown herringbone tweed newsboy cap for men in a vintage british flat cap style - M (56-58cm) / Khaki
Detail of grey herringbone tweed fabric on a vintage newsboy cap for men - M (56-58cm) / Tan
Dark grey herringbone tweed newsboy cap for men in classic vintage flat cap style - M (56-58cm) / Dark Gray
Side view of retro tweed newsboy cap with classic wool blend plaid pattern detail - M (56-58cm) / Houndstooth Blue
+15
Men Women Flat Cap Wool Blend Tweed Herringbone Newsboy Ivy Hat British Vintage Plaid Corduroy Winter Warm Driving Cap
$3.60
No MOQ
Retro Plaid Flat Cap For Men Women Adjustable Cotton Newsboy Beret Hat Vintage British Style Casual Outdoor Ivy Cap
Retro Plaid Flat Cap For Men Women Adjustable Cotton Newsboy Beret Hat Vintage British Style Casual Outdoor Ivy Cap
like
Find Similar
Classic blue and pink plaid flat cap for men and women, minimalist summer sun protection hat - Adjustable / Black
Detailed side view of the orange plaid flat cap showing fabric texture and seams - Adjustable / Red
Classic plaid beret in brown and beige colors, stylish flat cap for men and women - Adjustable / Khaki
Side view of blue plaid flat cap showing textured fabric and structured brim detail - Adjustable / Blue
Retro Plaid Flat Cap For Men Women Adjustable Cotton Newsboy Beret Hat Vintage British Style Casual Outdoor Ivy Cap
$3.75
No MOQ
Vintage Acrylic Newsboy Cap For Women Distressed Ripped Denim Style Beret Hat Retro Solid Color Painter Hat For Daily Wear
Vintage Acrylic Newsboy Cap For Women Distressed Ripped Denim Style Beret Hat Retro Solid Color Painter Hat For Daily Wear
like
Find Similar
Retro black distressed denim newsboy cap with white frayed stripe texture for women - 56-58cm / Dark Grey
Retro light blue distressed denim newsboy cap with vintage ripped details for women - 56-58cm / Light Blue
Distressed blue denim newsboy hat with vintage ripped texture and octagonal cap shape - 56-58cm / Vintage Blue
Vintage Acrylic Newsboy Cap For Women Distressed Ripped Denim Style Beret Hat Retro Solid Color Painter Hat For Daily Wear
-4%
$5.75
No MOQ
Vintage Women Denim Star Sequin Beret Forward Hat Washed Cotton Newsboy Cap With Colorful Rhinestones British Style Painter Hat
Vintage Women Denim Star Sequin Beret Forward Hat Washed Cotton Newsboy Cap With Colorful Rhinestones British Style Painter Hat
like
Find Similar
Detail of light blue denim hat with sequins stars and colorful rhinestones embellishments - M(55-59cm) / Light Blue
Close-up of blue denim beret featuring sequin stars and colorful rhinestone details - M(55-59cm) / Medium Blue
Detail of vintage black denim newsboy cap with sequined stars and colorful rhinestones - M(55-59cm) / Black
Vintage Women Denim Star Sequin Beret Forward Hat Washed Cotton Newsboy Cap With Colorful Rhinestones British Style Painter Hat
$5.33
No MOQ
American Flag Stars And Stripes Reversible Bucket Hat For Men Women Cotton Sun Protection Outdoor Travel Fisherman Cap
American Flag Stars And Stripes Reversible Bucket Hat For Men Women Cotton Sun Protection Outdoor Travel Fisherman Cap
like
Find Similar
Reversible bucket hat with American flag stars and stripes print for sun protection - M / Stars And Stripes Reversible
American Flag Stars And Stripes Reversible Bucket Hat For Men Women Cotton Sun Protection Outdoor Travel Fisherman Cap
$2.59
No MOQ
Quilted Flat Cap Warm Windproof Padded Beret Hat Fashion Lattice Check Pattern Retro Forward Cap For Men Women
Quilted Flat Cap Warm Windproof Padded Beret Hat Fashion Lattice Check Pattern Retro Forward Cap For Men Women
like
Find Similar
Detail of black quilted newsboy cap showing geometric stitching and warm texture - One Size / Black
Detail view of khaki quilted texture and stitching on the windproof thermal beret hat - One Size / Khaki
Beige quilted flat cap with diamond lattice stitching for autumn and winter warmth - One Size / Off White
Quilted Flat Cap Warm Windproof Padded Beret Hat Fashion Lattice Check Pattern Retro Forward Cap For Men Women
$5.33
Mix MOQ : 2
Washed Corduroy Flat Cap Vintage Distressed Cotton Ivy Hat Adjustable Beret Newsboy Cabbie Cap For Men Women
Washed Corduroy Flat Cap Vintage Distressed Cotton Ivy Hat Adjustable Beret Newsboy Cabbie Cap For Men Women
like
Find Similar
Navy blue corduroy flat cap for men and women with washed retro finish and adjustable buckle - Adjustable / Navy Blue
Dark grey corduroy flat cap for men and women featuring adjustable side metal buckles - Adjustable / Gray
Khaki corduroy flat cap for men and women featuring adjustable metal buckle side - Adjustable / Khaki
Vintage coffee brown corduroy beret hat with adjustable metal buckle on white background - Adjustable / Coffee
+1
Washed Corduroy Flat Cap Vintage Distressed Cotton Ivy Hat Adjustable Beret Newsboy Cabbie Cap For Men Women
$5.19
No MOQ
Vintage Camouflage Baseball Cap For Women Pink Embroidery Cross Letters Distressed Sun Protection Streetwear Fashion Adjustable Hat
Vintage Camouflage Baseball Cap For Women Pink Embroidery Cross Letters Distressed Sun Protection Streetwear Fashion Adjustable Hat
like
Find Similar
Distressed camouflage baseball cap featuring pink embroidery and a vintage streetwear design - M / Khaki
Macro detail of purple camo fabric with pink Chase After embroidery and cross motif - M / Purple
Detail of pink embroidery with 'CHASE AFTER' text on camouflage ripstop baseball cap - M / Coffee
Retro camo baseball cap with pink gothic embroidery and cross design for women - M / Army Green
+1
Vintage Camouflage Baseball Cap For Women Pink Embroidery Cross Letters Distressed Sun Protection Streetwear Fashion Adjustable Hat
$4.32
No MOQ
Retro Denim Ivy Cap For Men Women Washed Cotton Flat Cap Newsboy Hat Adjustable Grid Stitching Forward Hat Casual Cap
Retro Denim Ivy Cap For Men Women Washed Cotton Flat Cap Newsboy Hat Adjustable Grid Stitching Forward Hat Casual Cap
like
Find Similar
Retro denim newsboy cap in dark blue with contrast stitching and adjustable buckle - Washed Style / Black
Retro denim flat cap in dark blue with contrast stitching and vintage distressed detail - Grey Blue
Japanese style light blue denim flat cap with adjustable metal side buckle and stitching - Light Blue
Classic blue denim flat cap with white contrast stitching and adjustable metal side buckle - Dark Blue
Retro Denim Ivy Cap For Men Women Washed Cotton Flat Cap Newsboy Hat Adjustable Grid Stitching Forward Hat Casual Cap
$4.76
No MOQ
Washed Cotton Bucket Hat Distressed Sunshade Outdoor Travel Casual Unisex Plain Solid Color Soft Breathable Foldable
Washed Cotton Bucket Hat Distressed Sunshade Outdoor Travel Casual Unisex Plain Solid Color Soft Breathable Foldable
like
Find Similar
Classic mustard yellow washed cotton bucket hat with breathable metal eyelets - M (56-58cm) / Yellow
Detailed view of washed cotton fisherman hat with metal eyelets and reinforced stitching - M (56-58cm) / Black
Detail view of white cotton bucket hat featuring wide brim and reinforced stitching lines - M (56-58cm) / White
Detail of brick red washed cotton bucket hat showing metal eyelets and stitched brim - M (56-58cm) / Orange
+11
Washed Cotton Bucket Hat Distressed Sunshade Outdoor Travel Casual Unisex Plain Solid Color Soft Breathable Foldable
-5%
$3.50
No MOQ
 · 
54 sold recently
Handmade Crochet Floral Bucket Hat With Ruffle Wavy Edge For Women Boho Knit Sun Hat Sweet Retro Warm Winter Beanie
Handmade Crochet Floral Bucket Hat With Ruffle Wavy Edge For Women Boho Knit Sun Hat Sweet Retro Warm Winter Beanie
like
Find Similar
Detail of handmade crochet purple ruffled sun hat with white flower patterns - M / Deep purple
Detail of crochet bucket hat featuring blue floral pattern and wavy ruffled purple brim - M / Light Purple
Detail of handmade crochet bucket hat featuring blue floral granny square patterns - M / White with Blue Flower
Detail of hand-knitted sky blue sun hat featuring floral patches and ruffled brim design - M / Blue
+8
Handmade Crochet Floral Bucket Hat With Ruffle Wavy Edge For Women Boho Knit Sun Hat Sweet Retro Warm Winter Beanie
$5.76
No MOQ
Vintage British Style Plaid Beret Hat Adjustable Cotton Flat Cap For Men Women Casual Outdoor Sun Protection Newsboy Cap
Vintage British Style Plaid Beret Hat Adjustable Cotton Flat Cap For Men Women Casual Outdoor Sun Protection Newsboy Cap
like
Find Similar
Detailed view of the classic black and white plaid pattern on the vintage cotton beret hat - Adjustable / White
Detail of grey plaid beret showing metallic side buckle and premium fabric texture - Adjustable / Black
Detailed view of the brown plaid beret featuring an adjustable side buckle and fabric texture - Adjustable / Coffee
Beige plaid ivy cap with adjustable metal buckle and vintage british style check pattern - Adjustable / Beige
NewVintage British Style Plaid Beret Hat Adjustable Cotton Flat Cap For Men Women Casual Outdoor Sun Protection Newsboy Cap
-5%
$3.97
Mix MOQ : 2
Mushroom Print Bucket Hat For Women Men Summer Sun Protection Wide Brim Foldable Polyester Casual Fisherman Hat Outdoor Travel
Mushroom Print Bucket Hat For Women Men Summer Sun Protection Wide Brim Foldable Polyester Casual Fisherman Hat Outdoor Travel
like
Find Similar
Black bucket hat with colorful mushroom prints featuring flat top and wide brim for sun protection - One Size (58CM Circumference) / Red Polka Dot Mushroom Black Base
Unisex white bucket hat with colorful mushroom print and reinforced stitched brim - One Size (58CM Circumference) / Colorful Mushroom White Base
Black bucket hat with colorful pop art mushroom print for summer sun protection - One Size (58CM Circumference) / Blue Orange Mushroom Black Base
Mushroom Print Bucket Hat For Women Men Summer Sun Protection Wide Brim Foldable Polyester Casual Fisherman Hat Outdoor Travel
$3.17
No MOQ
Women Fashion Denim Baseball Cap Rhinestone USA LOVE Butterfly Heart Pattern Distressed Washed Cotton Adjustable Outdoor Hat
Women Fashion Denim Baseball Cap Rhinestone USA LOVE Butterfly Heart Pattern Distressed Washed Cotton Adjustable Outdoor Hat
like
Find Similar
Detail of light blue denim baseball cap with rhinestone crown and pearl embellishments - Adult Adjustable / Pearl Crown Style / Light Blue
Detailed view of dark denim baseball cap with rhinestone crown and studded brim edge - Adult Adjustable / Pearl Crown Style / Dark Blue
Detailed view of denim baseball cap featuring rhinestone hearts and studded brim - Adult Adjustable / Heart Style / Dark Blue
Close-up of blue denim baseball cap with rhinestone Queen logo and crown embroidery - Adult Adjustable / Letter Crown Style / Dark Blue
+18
Women Fashion Denim Baseball Cap Rhinestone USA LOVE Butterfly Heart Pattern Distressed Washed Cotton Adjustable Outdoor Hat
$3.14
No MOQ
Fedora Hat Wide Brim Cotton Polyester Blend Retro British Style Jazz Hat With Belt Buckle Decor For Men Women
Fedora Hat Wide Brim Cotton Polyester Blend Retro British Style Jazz Hat With Belt Buckle Decor For Men Women
like
Find Similar
Close-up of red wool felt fedora hat featuring a brown leather buckle strap detail - M (56-58cm) / Red
Detail of a bright yellow wide-brim fedora hat featuring a brown leather belt with gold buckle - M (56-58cm) / Yellow
Top view of deep purple wide brim wool fedora hat with brown faux leather belt strap - M (56-58cm) / Purple
Classic wide-brim caramel felt jazz hat with brown leather belt and golden buckle - M (56-58cm) / Khaki
+25
NewFedora Hat Wide Brim Cotton Polyester Blend Retro British Style Jazz Hat With Belt Buckle Decor For Men Women
$4.18
Mix MOQ : 2
Reversible Bucket Hat Colorful Tropical Leaf Print Cotton Sun Protection Fisherman Hat For Men Women Outdoor Travel Travel
Reversible Bucket Hat Colorful Tropical Leaf Print Cotton Sun Protection Fisherman Hat For Men Women Outdoor Travel Travel
like
Find Similar
Reversible bucket hat featuring colorful maple leaf prints and sun protection design - One Size / Colorful Floral
Reversible Bucket Hat Colorful Tropical Leaf Print Cotton Sun Protection Fisherman Hat For Men Women Outdoor Travel Travel
$2.65
No MOQ
Vintage Two Tone Fedora Hat Wide Brim Cotton Polyester Felt British Style With Zebra Print Band Unisex Jazz Cap
Vintage Two Tone Fedora Hat Wide Brim Cotton Polyester Felt British Style With Zebra Print Band Unisex Jazz Cap
like
Find Similar
Two-tone burgundy and black wool fedora hat with zebra pattern leather band and buckle - Wine Red & Black
British style gradient fedora hat in camel and black with zebra print leather band - Camel and Black
Modern two-tone fedora hat in grey and black wool felt with zebra pattern band - Grey and Black
Vintage Two Tone Fedora Hat Wide Brim Cotton Polyester Felt British Style With Zebra Print Band Unisex Jazz Cap
$4.61
No MOQ
Women Leopard Print Ponytail Baseball Cap Criss Cross Messy Bun Cotton Adjustable Washed Distressed Hat Outdoor Sun Cap
Women Leopard Print Ponytail Baseball Cap Criss Cross Messy Bun Cotton Adjustable Washed Distressed Hat Outdoor Sun Cap
like
Find Similar
Pink leopard ponytail baseball cap with criss-cross elastic bands and knitted texture - Black
Knit leopard print ponytail baseball cap with red spots and cross elastic back - Burgundy
Leopard print ponytail baseball cap with criss-cross elastic bands and velcro strap - Navy Blue
Leopard print knit ponytail baseball cap with elastic criss-cross back for women - Beige
+2
Women Leopard Print Ponytail Baseball Cap Criss Cross Messy Bun Cotton Adjustable Washed Distressed Hat Outdoor Sun Cap
$3.75
No MOQ
Vintage Cow Print Fedora Hat Wide Brim Cotton Polyester Felt Jazz Cap For Women Men British Style Fashion Accessory
Vintage Cow Print Fedora Hat Wide Brim Cotton Polyester Felt Jazz Cap For Women Men British Style Fashion Accessory
like
Find Similar
British style fedora hat with wide flat brim featuring a bold cow print pattern - M (56-58cm) / Khaki
Orange jazz hat with black cow print pattern and a flat brim fedora style - M (56-58cm) / Burgundy
Jazz style fedora hat featuring a bold black and white cow print and wide flat brim - M (56-58cm) / Gray
Khaki fedora hat with black cow print pattern and wide brim in felt material - M (56-58cm) / Camel
+2
NewVintage Cow Print Fedora Hat Wide Brim Cotton Polyester Felt Jazz Cap For Women Men British Style Fashion Accessory
$3.80
No MOQ
Acrylic Solid Color Large Head Circumference Bucket Hat Sun Protection Foldable Fisherman Hat For Women Men Outdoor Travel
Acrylic Solid Color Large Head Circumference Bucket Hat Sun Protection Foldable Fisherman Hat For Women Men Outdoor Travel
like
Find Similar
Unisex light pink cotton bucket hat for wide heads with stitched brim and casual style - 56-60cm / Pink
Classic dark blue bucket hat in cotton fabric with wide brim for sun protection - 56-60cm / Navy Blue
Minimalist purple cotton bucket hat for sun protection in a stylish lifestyle setting - 56-60cm / Purple
Classic black oversized bucket hat for men and women on a stylish minimalist background - 56-60cm / Black
+12
Acrylic Solid Color Large Head Circumference Bucket Hat Sun Protection Foldable Fisherman Hat For Women Men Outdoor Travel
-4%
$4.38
No MOQ
Leopard Print Fedora Hat Wide Brim Cotton Polyester Felt Bohemian Ethnic Shell Decoration Retro Jazz Travel Unisex
Leopard Print Fedora Hat Wide Brim Cotton Polyester Felt Bohemian Ethnic Shell Decoration Retro Jazz Travel Unisex
like
Find Similar
Classic leopard print wool felt fedora hat with brown band and shell decoration - M (56-58cm) / White
Detail of leopard print wool fedora with seashell bead band and striped ribbon accent - M (56-58cm) / Camel
Detail of leopard print wool fedora featuring bohemian shell and ethnic striped ribbons - M (56-58cm) / Khaki
Classic leopard print wool fedora hat with bohemian shell band and colorful stripe trim - M (56-58cm) / Burgundy
+2
Leopard Print Fedora Hat Wide Brim Cotton Polyester Felt Bohemian Ethnic Shell Decoration Retro Jazz Travel Unisex
$5.19
Mix MOQ : 2
Camouflage Baseball Cap For Men Women Cotton Adjustable Structured Outdoor Sun Protection Sport Hat Camo Duckbill Cap
Camouflage Baseball Cap For Men Women Cotton Adjustable Structured Outdoor Sun Protection Sport Hat Camo Duckbill Cap
like
Find Similar
Camo baseball cap with yellow, blue, and grey-green panels in six-panel structured design - One Size / Yellow Grey Camouflage
Pink and beige camouflage baseball cap with structured six-panel design and curved brim - One Size / Rose Red Pink Camouflage
Outdoor camouflage baseball cap in orange, red and beige palette with stiff crown - One Size / Orange Camouflage
Structured colorful camouflage baseball cap with six-panel design and curved visor - One Size / Red Khaki Camouflage
+13
Camouflage Baseball Cap For Men Women Cotton Adjustable Structured Outdoor Sun Protection Sport Hat Camo Duckbill Cap
$2.83
No MOQ
 · 
14 views
Vintage Unisex Fedora Hat Houndstooth Pattern Jazz Hat With Leather Strap Rivets Cotton Polyester Blend Sunshade Cap
Vintage Unisex Fedora Hat Houndstooth Pattern Jazz Hat With Leather Strap Rivets Cotton Polyester Blend Sunshade Cap
like
Find Similar
Classic black and white houndstooth fedora hat with brown leather belt and metal buckle - Houndstooth Plaid Style
Classic black wool felt fedora with a studded leather band and houndstooth lining - Black With Pattern Lining Style
Vintage Unisex Fedora Hat Houndstooth Pattern Jazz Hat With Leather Strap Rivets Cotton Polyester Blend Sunshade Cap
$4.67
No MOQ
Vintage Houndstooth Fedora Hat British Style Wide Brim Jazz Cap Unisex Polyester Cotton Fashion Accessory
Vintage Houndstooth Fedora Hat British Style Wide Brim Jazz Cap Unisex Polyester Cotton Fashion Accessory
like
Find Similar
Classic houndstooth felt fedora hat for men and women featuring a black grosgrain ribbon band - M (56-58cm) / Black Grey Houndstooth (01)
Classic houndstooth fedora hat with black ribbon band on a white background - M (56-58cm) / Black White Houndstooth (02)
Detail of classic black and white houndstooth wool fedora hat with black decorative ribbon - M (56-58cm) / Classic Houndstooth (03)
Vintage Houndstooth Fedora Hat British Style Wide Brim Jazz Cap Unisex Polyester Cotton Fashion Accessory
$3.03
No MOQ
Retro Fedora Hat Polyester Felt Wide Brim Pinched Crown Solid Color Elegant Jazz Cap For Men Women Versatile Style
Retro Fedora Hat Polyester Felt Wide Brim Pinched Crown Solid Color Elegant Jazz Cap For Men Women Versatile Style
like
Find Similar
Macro detail of camel wool fedora showing smooth felt texture and classic indented crown - One Size / Khaki
Detailed view of white wide-brim wool fedora hat with elegant minimalist design - One Size / White
Classic mint green wool felt fedora hat with wide brim and pinch crown for a retro look - One Size / Mint Green
Elegant royal blue wide brim wool felt fedora hat featuring a classic western jazz design - One Size / Sapphire Blue
+24
Retro Fedora Hat Polyester Felt Wide Brim Pinched Crown Solid Color Elegant Jazz Cap For Men Women Versatile Style
$3.49
No MOQ
Embroidered Cherry Cotton Twill Baseball Cap Adjustable Casual Dad Hat Sun Protection Outdoor Sports For Women Men
Embroidered Cherry Cotton Twill Baseball Cap Adjustable Casual Dad Hat Sun Protection Outdoor Sports For Women Men
like
Find Similar
Detail of red cherry embroidery on black cotton twill baseball cap with soft top design - M (56-58cm) / Black
Close-up of red cherry embroidery and cotton twill texture on a beige baseball cap - M (56-58cm) / White
Detailed view of cherry embroidery and stitching on a vibrant orange cotton baseball cap - M (56-58cm) / Orange
Dark grey cotton baseball cap with embroidered cherry pattern and adjustable strap - M (56-58cm) / Gray
+4
Embroidered Cherry Cotton Twill Baseball Cap Adjustable Casual Dad Hat Sun Protection Outdoor Sports For Women Men
$3.89
No MOQ
Women Vintage Cotton Newsboy Cap Floral Embroidery Beret Hat With Black Contrast Brim Textured Casual Cabbie Flat Cap Accessory
Women Vintage Cotton Newsboy Cap Floral Embroidery Beret Hat With Black Contrast Brim Textured Casual Cabbie Flat Cap Accessory
like
Find Similar
Black vintage flat cap with colorful floral embroidery and textured fabric finish - Black
Beige retro newsboy cap with white floral embroidery and black brim for women - White
Purple retro newsboy cap with floral embroidery and black brim for women - Dark Gray
Retro vintage newsboy cap in dusty red fabric with 3D floral embroidery and black brim - Pink
+3
Women Vintage Cotton Newsboy Cap Floral Embroidery Beret Hat With Black Contrast Brim Textured Casual Cabbie Flat Cap Accessory
$5.76
No MOQ
Women Sweet Cartoon Dog Embroidery Acrylic Baseball Cap Adjustable Casual Fashion Sun Shade Peaked Hat For Outdoor Travel
Women Sweet Cartoon Dog Embroidery Acrylic Baseball Cap Adjustable Casual Fashion Sun Shade Peaked Hat For Outdoor Travel
like
Find Similar
Light blue denim baseball cap featuring white bear embroidery in a minimalist style - 56-58cm Adjustable / Blue
Red cotton baseball cap with cute white bear embroidery and a curved brim for women - 56-58cm Adjustable / Red
Pink washed cotton baseball cap featuring a white cartoon dog embroidery and soft crown - 56-58cm Adjustable / Pink
Navy blue cotton baseball cap featuring a cute white bear embroidery with soft top design - 56-58cm Adjustable / Navy Blue
+5
Women Sweet Cartoon Dog Embroidery Acrylic Baseball Cap Adjustable Casual Fashion Sun Shade Peaked Hat For Outdoor Travel
-5%
$4.93
No MOQ
Fashion Rhinestone Cross Baseball Cap Women Men Cotton Denim Adjustable Sun Hat Distressed Encrusted Hip Hop Snapback Outdoor Hat
Fashion Rhinestone Cross Baseball Cap Women Men Cotton Denim Adjustable Sun Hat Distressed Encrusted Hip Hop Snapback Outdoor Hat
like
Find Similar
Detail of red baseball cap with sparkling silver rhinestone cross and studded brim - Adjustable / Red
Close-up of a black baseball cap with rhinestone cross patch and shimmering diamond brim - Adjustable / Black
Close-up of white baseball cap with rhinestone cross patch and shimmering diamond brim - Adjustable / White
Close-up of pink baseball cap with sparkling silver rhinestone cross and studded brim detail - Adjustable / Pink
+5
Fashion Rhinestone Cross Baseball Cap Women Men Cotton Denim Adjustable Sun Hat Distressed Encrusted Hip Hop Snapback Outdoor Hat
$4.03
Mix MOQ : 2
Women Bucket Hat Polyester Grid Pattern Bow Decor Sun Protection Foldable Casual Fisherman Hat For Elderly Lady Accessory
Women Bucket Hat Polyester Grid Pattern Bow Decor Sun Protection Foldable Casual Fisherman Hat For Elderly Lady Accessory
like
Find Similar
Classic red checkered bucket hat for elderly women with decorative side bow detail - Red
Elegant dusty rose bucket hat for women with checkered texture and bow decoration - Khaki
Deep purple women fisherman hat with geometric patterns and a bow decoration - Coffee
Vintage checkered women's cloche hat in brick red with a stylish fabric bow detail - Pink
+1
Women Bucket Hat Polyester Grid Pattern Bow Decor Sun Protection Foldable Casual Fisherman Hat For Elderly Lady Accessory
$3.17
Mix MOQ : 2
Vintage Plaid Newsboy Cap For Men Women British Octagonal Beret Hat Warm Woolen Corduroy Cotton Painter Cabbie Flat Hat
Vintage Plaid Newsboy Cap For Men Women British Octagonal Beret Hat Warm Woolen Corduroy Cotton Painter Cabbie Flat Hat
like
Find Similar
Classic black and gray plaid newsboy cap in vintage wool blend for autumn and winter style - One Size 56-58cm / Woolen-Black
Retro purple plaid newsboy hat with woolen texture for autumn and winter fashion - One Size 56-58cm / Woolen-Purple
British style checkered newsboy hat in cream with blue and khaki plaid wool finish - One Size 56-58cm / Woolen-Beige
Classic grey plaid newsboy cap with brown and pink stripes in warm wool texture - One Size 56-58cm / Woolen-Light Coffee
+11
Vintage Plaid Newsboy Cap For Men Women British Octagonal Beret Hat Warm Woolen Corduroy Cotton Painter Cabbie Flat Hat
$4.90-6.48
No MOQ
 · 
14 views
Vintage Wide Brim Fedora Hat With Leopard Print Lining Cotton Polyester Jazz Hat With Belt Buckle For Women Men
Vintage Wide Brim Fedora Hat With Leopard Print Lining Cotton Polyester Jazz Hat With Belt Buckle For Women Men
like
Find Similar
Red wide-brim fedora hat with bold leopard print lining and decorative black band - One Size / Red
Yellow wool fedora hat with leopard print lining and black faux leather strap detail - One Size / Yellow
Elegant purple wool fedora hat with leopard print lining and black belt buckle detail - One Size / Purple
Ginger yellow wide brim Fedora hat with leopard print lining and black belt detail - One Size / Khaki
+10
NewVintage Wide Brim Fedora Hat With Leopard Print Lining Cotton Polyester Jazz Hat With Belt Buckle For Women Men
-4%
$4.11
No MOQ
Unisex Vintage Wool Blend Fedora Hat With Leopard Print Ribbed Band Decorative Metal Badge Winter Warm Jazz Hat
Unisex Vintage Wool Blend Fedora Hat With Leopard Print Ribbed Band Decorative Metal Badge Winter Warm Jazz Hat
like
Find Similar
Classic camel wool fedora hat for men and women with black ribbon and metallic logo detail - M / 56-58cm / Khaki
Classic warm brown wool fedora with black grosgrain ribbon and silver emblem detail - M / 56-58cm / Dark Khaki
Elegant black wool fedora hat with matching ribbon and silver metal emblem - M / 56-58cm / Black
Elegant wine red wool fedora hat with black grosgrain band and silver metal badge - M / 56-58cm / Burgundy
+22
Unisex Vintage Wool Blend Fedora Hat With Leopard Print Ribbed Band Decorative Metal Badge Winter Warm Jazz Hat
$3.75
No MOQ
Unisex Cotton Graffiti Bucket Hat Cartoon Print Sun Protection Breathable Double Sided Foldable Outdoor Travel Street Sun Hat
Unisex Cotton Graffiti Bucket Hat Cartoon Print Sun Protection Breathable Double Sided Foldable Outdoor Travel Street Sun Hat
like
Find Similar
Graffiti print cotton bucket hat for men and women featuring colorful cartoon artwork - One Size / Gray
Reversible cotton bucket hat with colorful graffiti letters and cartoon character prints - One Size / Beige
Unisex Cotton Graffiti Bucket Hat Cartoon Print Sun Protection Breathable Double Sided Foldable Outdoor Travel Street Sun Hat
$3.75
No MOQ
Unisex Reversible Bucket Hat Polyester Double Sided Sun Hat Cute Cartoon Printed Foldable Fisherman Hat For Outdoor Travel
Unisex Reversible Bucket Hat Polyester Double Sided Sun Hat Cute Cartoon Printed Foldable Fisherman Hat For Outdoor Travel
like
Find Similar
Reversible bucket hat in black and white checkerboard pattern and solid black style - Geometric Checkerboard
Double-sided reversible bucket hat featuring classic black and fresh watermelon embroidery - Watermelon
Detail of black and white cotton bucket hats featuring cute butterfly embroidery - Butterfly Pattern
Double-sided bucket hat featuring black fabric and vibrant red cherry embroidery - Cherry Pattern
+6
Unisex Reversible Bucket Hat Polyester Double Sided Sun Hat Cute Cartoon Printed Foldable Fisherman Hat For Outdoor Travel
-4%
$2.71
Mix MOQ : 2
 · 
24 sold recently
Unisex Cotton Reversible Tropical Plants Print Bucket Hat Birds Of Paradise Floral Sun Protection Beach Summer Hat
Unisex Cotton Reversible Tropical Plants Print Bucket Hat Birds Of Paradise Floral Sun Protection Beach Summer Hat
like
Find Similar
Unisex cotton reversible sun hat with tropical blue leaves and orange flower patterns - One Size / Tropical Rainforest Print
NewUnisex Cotton Reversible Tropical Plants Print Bucket Hat Birds Of Paradise Floral Sun Protection Beach Summer Hat
$2.59
No MOQ
Cotton Baseball Cap Vintage Rodeo Cowboy Association Embroidery Color Block Adjustable Snapback Trucker Hat
Cotton Baseball Cap Vintage Rodeo Cowboy Association Embroidery Color Block Adjustable Snapback Trucker Hat
like
Find Similar
Retro colorblock baseball cap with Vintage Rodeo cowboy embroidery in cream and black - Black
Detailed close-up of retro cowboy embroidery and rodeo text on a two-tone baseball cap - Navy Blue
Detailed view of vintage rodeo 1954 embroidery on a contrast panel trucker cap - Khaki
Vintage color block 5-panel baseball cap with rodeo embroidery and curved brim - Light Blue
+14
NewCotton Baseball Cap Vintage Rodeo Cowboy Association Embroidery Color Block Adjustable Snapback Trucker Hat
-5%
$3.56
No MOQ
British Style Chain Fedora Hat For Women Wide Brim Jazz Felt Hat Solid Color Elegant Vintage Party Cap Outdoor Sun Hat
British Style Chain Fedora Hat For Women Wide Brim Jazz Felt Hat Solid Color Elegant Vintage Party Cap Outdoor Sun Hat
like
Find Similar
Detailed view of white fedora hat featuring a black leather band and gold chain accent - One Size / White
Detail of rose red fedora hat featuring black leather band and gold metal chain link - One Size / Rose Red
Detailed view of red felt fedora hat featuring black leather band and gold chain accents - One Size / Red
Close-up of grey felt fedora featuring a black faux leather band and gold chain detail - One Size / Gray
+23
British Style Chain Fedora Hat For Women Wide Brim Jazz Felt Hat Solid Color Elegant Vintage Party Cap Outdoor Sun Hat
$3.46
No MOQ
 · 
10 views
Women Vintage Plaid Bucket Hat Elegant Bowknot Tweed Style Cloche Hat Autumn Winter Warm Knitted Sun Hat For Lady Fashion
Women Vintage Plaid Bucket Hat Elegant Bowknot Tweed Style Cloche Hat Autumn Winter Warm Knitted Sun Hat For Lady Fashion
like
Find Similar
Detail of red and blue plaid tweed cloche hat with a bow, perfect for winter fashion - One Size / Orange
Vintage dark leopard print wool bucket hat for women with a stylish round top for autumn - One Size / Gray
Women's plaid wool bucket hat with bow detail in navy blue, stylish autumn winter headwear - One Size / Blue
Checkered wool cloche hat for women with bow detail in orange and brown plaid pattern - One Size / Khaki
Women Vintage Plaid Bucket Hat Elegant Bowknot Tweed Style Cloche Hat Autumn Winter Warm Knitted Sun Hat For Lady Fashion
$4.61
Mix MOQ : 2
Tie Dye Fedora Hat Colorful Felt Wide Brim Jazz Cap With Leopard Print Ribbon For Men Women Vintage Style
Tie Dye Fedora Hat Colorful Felt Wide Brim Jazz Cap With Leopard Print Ribbon For Men Women Vintage Style
like
Find Similar
Fashionable pink and yellow tie-dye fedora wool hat with a stylish leopard print band - Pink Yellow Tie-Dye Style
Colorful tie-dye fedora wool felt hat with leopard print band and wide flat brim for unisex - Red Green Purple Tie-Dye Style
Tie-dye felt fedora hat with leopard print band and bow in blue, pink and white hues - Blue Pink White Tie-Dye Style
Tie-dye blue and yellow wool fedora hat with leopard print ribbon for fashion - Blue Yellow White Tie-Dye Style
+1
Tie Dye Fedora Hat Colorful Felt Wide Brim Jazz Cap With Leopard Print Ribbon For Men Women Vintage Style
$4.61
No MOQ
Unisex Vintage Newspaper Print Bucket Hat Retro Streetwear Cotton Foldable Sun Protection Fisherman Cap For Men Women
Unisex Vintage Newspaper Print Bucket Hat Retro Streetwear Cotton Foldable Sun Protection Fisherman Cap For Men Women
like
Find Similar
Retro unisex fisherman hat featuring unique black and white newspaper print patterns - One Size / White
Unisex cream bucket hat featuring vintage newspaper print design for a chic look - One Size / Beige
Unisex Vintage Newspaper Print Bucket Hat Retro Streetwear Cotton Foldable Sun Protection Fisherman Cap For Men Women
$2.45
No MOQ
Cotton Polyester Printed Letter Bride Squad Trucker Hat Adjustable Mesh Baseball Cap For Wedding Bachelorette Party Women
Cotton Polyester Printed Letter Bride Squad Trucker Hat Adjustable Mesh Baseball Cap For Wedding Bachelorette Party Women
like
Find Similar
Close-up of black trucker hat with gold TEAM BRIDE lettering and breathable mesh back - Adjustable / Gold TEAM BRIDE (Black)
Pink and white Team Bride mesh trucker hat for wedding parties and events - Adjustable / Black TEAM (Pink)
Front view of black and white mesh trucker hat featuring bold GROOM text on the front - Adjustable / Black GROOM (Black and White)
Detailed front view of white mesh trucker hat featuring bold black BRIDE lettering - Adjustable / Black BRIDE (White)
+2
Cotton Polyester Printed Letter Bride Squad Trucker Hat Adjustable Mesh Baseball Cap For Wedding Bachelorette Party Women
$2.59-2.88
No MOQ
 · 
118 sold recently
Vintage Unisex Flat Top Fedora Hat Woolen Felt Boater Hat With Wide Brim Leather Belt Buckle Solid Color Jazz Cap
Vintage Unisex Flat Top Fedora Hat Woolen Felt Boater Hat With Wide Brim Leather Belt Buckle Solid Color Jazz Cap
like
Find Similar
Close-up of neon green wool fedora hat featuring a black leather band and silver buckle - One Size / Fruit Green
Detail of army green flat top wool fedora with a black faux leather belted buckle strap - One Size / Army Green
Detail of grey wool felt flat top hat featuring black leather band and silver buckle - One Size / Gray
Detail of teal wool boater hat featuring a black leather belt strap with silver buckle - One Size / Sky Blue
+21
Vintage Unisex Flat Top Fedora Hat Woolen Felt Boater Hat With Wide Brim Leather Belt Buckle Solid Color Jazz Cap
$3.49
No MOQ
Vintage Newsboy Cap Herringbone Windowpane Check Acrylic Autumn Winter Hat Retro British Style Flat Cap For Unisex
Vintage Newsboy Cap Herringbone Windowpane Check Acrylic Autumn Winter Hat Retro British Style Flat Cap For Unisex
like
Find Similar
Close-up of dark grey wool newsboy cap with red windowpane check and tweed texture - Black
Close-up of herringbone pattern wool newsboy cap with subtle red grid texture - Gray
Classic dark brown herringbone newsboy cap with wool octagonal panels for autumn and winter - Coffee
Vintage Newsboy Cap Herringbone Windowpane Check Acrylic Autumn Winter Hat Retro British Style Flat Cap For Unisex
-5%
$3.28
Mix MOQ : 2
British Style Lightweight Polyester Felt Fedora Hat With Turquoise Leather Belt Bohemian Jazz Hat For Party Travel Unisex
British Style Lightweight Polyester Felt Fedora Hat With Turquoise Leather Belt Bohemian Jazz Hat For Party Travel Unisex
like
Find Similar
Detail of red wool fedora with black leather band, silver studs and turquoise stone inlay - Red
British style yellow felt fedora hat with turquoise leather band and studs - Yellow
Detail view of purple wool fedora with leather band, silver studs and turquoise stones - Purple
Detail of black fedora hat with turquoise stones and silver studs on a leather band - Black
+14
British Style Lightweight Polyester Felt Fedora Hat With Turquoise Leather Belt Bohemian Jazz Hat For Party Travel Unisex
$3.46
No MOQ
Fedora Hat Woolen Felt Two-Tone Contrast Color Wide Brim Belt Buckle Retro Jazz Unisex Flat Top
Fedora Hat Woolen Felt Two-Tone Contrast Color Wide Brim Belt Buckle Retro Jazz Unisex Flat Top
like
Find Similar
Detail view of winter wool felt fedora hats with stylish leather band and color block design - M(56-58cm) / Outer Red Inner Blue Contrast
Close-up of yellow wool fedora featuring black leather band and purple color-block brim - M(56-58cm) / Outer Yellow Inner Purple Two-Tone
Detail view of purple wool fedora with yellow contrast brim and golden buckle belt - M(56-58cm) / Outer Purple Inner Yellow Two-Tone
Autumn winter two-tone wool fedora hat with red brim underside and brown belt buckle - M(56-58cm) / Outer Black Inner Red Two-Tone
+11
Fedora Hat Woolen Felt Two-Tone Contrast Color Wide Brim Belt Buckle Retro Jazz Unisex Flat Top
$4.03
Mix MOQ : 2
Two Tone Fedora Hat Wool Felt Wide Brim Contrast Color Jazz Style Vintage Fashion Unisex
Two Tone Fedora Hat Wool Felt Wide Brim Contrast Color Jazz Style Vintage Fashion Unisex
like
Find Similar
Classic red and royal blue wool fedora hat with stylish two-tone contrast design - M (56-58cm) / Red
Stylish two-tone wool felt fedora hat in yellow and purple with a flat brim design - M (56-58cm) / Yellow
Classic wide brim fedora hat with dark green exterior and contrasting red lining - M (56-58cm) / Green
Two-tone wool fedora hat in royal blue and red with a stylish flat brim for men and women - M (56-58cm) / Blue
+20
NewTwo Tone Fedora Hat Wool Felt Wide Brim Contrast Color Jazz Style Vintage Fashion Unisex
$3.17
No MOQ
Leopard Print Corduroy Baseball Cap Vintage Adjustable Curved Visor Sun Hat For Men Women Streetwear Fashion
Leopard Print Corduroy Baseball Cap Vintage Adjustable Curved Visor Sun Hat For Men Women Streetwear Fashion
like
Find Similar
Leopard print corduroy baseball cap with a classic curved brim and six-panel structure - Adjustable / Khaki
Detailed view of light grey corduroy baseball cap with dark blue leopard print patterns - Adjustable / Gray
Close-up of leopard print corduroy baseball cap showing thick texture and curved brim - Adjustable / Light Yellow
Leopard Print Corduroy Baseball Cap Vintage Adjustable Curved Visor Sun Hat For Men Women Streetwear Fashion
$2.68
No MOQ
 · 
16 views
Classic British Style Woolen Felt Fedora Hat For Men Women Wide Brim Jazz Hat With Decorative Gold Chain Belt Headwear
Classic British Style Woolen Felt Fedora Hat For Men Women Wide Brim Jazz Hat With Decorative Gold Chain Belt Headwear
like
Find Similar
Detail of red wide-brim wool fedora hat with black leather band and gold metal accent - Red
Detail of grey wool fedora hat with black leather strap and gold buckle accent - Gray
Detail of wool felt fedora hat featuring a black band and gold metallic buckle - Black
Classic brown wide brim wool fedora hat with black leather band and tassel detail - Camel
+7
Classic British Style Woolen Felt Fedora Hat For Men Women Wide Brim Jazz Hat With Decorative Gold Chain Belt Headwear
-4%
$3.81
No MOQ
 · 
34 sold recently
Vintage Striped Cotton Blend Newsboy Cap For Women Men Retro Flat Cap Adjustable Beret Hat For Summer Daily Travel
Vintage Striped Cotton Blend Newsboy Cap For Women Men Retro Flat Cap Adjustable Beret Hat For Summer Daily Travel
like
Find Similar
Detail of green and white striped ivy cap on fabric with artistic window shadows - Adjustable / Teal
Detail of classic striped flat cap with red and brown vertical stripes on soft fabric - Adjustable / Dark Red
Detailed texture of a striped vintage newsboy cap on a sunlit background - Adjustable / Beige
Vintage Striped Cotton Blend Newsboy Cap For Women Men Retro Flat Cap Adjustable Beret Hat For Summer Daily Travel
$3.89
No MOQ
Classic Tall Top Hat Lincoln Magician Performance Party Costume Felt Material With Satin Ribbon Decor Adult
Classic Tall Top Hat Lincoln Magician Performance Party Costume Felt Material With Satin Ribbon Decor Adult
like
Find Similar
Classic white 20cm high top hat with matching satin ribbon for formal wedding party - Adult (Height 20cm/Circumference 61cm) / White
Elegant white 20cm Lincoln top hat with black ribbon for stage performances and parties - Adult (Height 20cm/Circumference 61cm) / White With Black Ribbon
Elegant 20cm tall brown top hat with satin ribbon for stage performance and parties - Adult (Height 20cm/Circumference 61cm) / Dark Brown
St. Patrick's Day green felt top hat with satin ribbon for party performances - Adult (Height 20cm/Circumference 61cm) / Green
+5
Classic Tall Top Hat Lincoln Magician Performance Party Costume Felt Material With Satin Ribbon Decor Adult
$2.18-2.33
No MOQ
 · 
21 sold recently
Fedora Hat Woolen Felt Wide Brim White Flower Petal Metal Rivet Decorative Leather Band Retro British Style Accessory
Fedora Hat Woolen Felt Wide Brim White Flower Petal Metal Rivet Decorative Leather Band Retro British Style Accessory
like
Find Similar
Magenta wide brim fedora hat with black leather band and white floral rivets - M (56-58cm) / Red
Detail view of olive green fedora with black decorative belt, white flowers, and silver rivets - M (56-58cm) / Green
Classic royal blue wool fedora hat with white flower petals and silver metal rivets - M (56-58cm) / Blue
Close-up of brown wool jazz hat with black leather belt, white flowers and silver rivets - M (56-58cm) / Khaki
+6
Fedora Hat Woolen Felt Wide Brim White Flower Petal Metal Rivet Decorative Leather Band Retro British Style Accessory
$3.11
Mix MOQ : 2
Two-Tone Fedora Hat Wide Brim Woolen Felt Jazz Style Vintage Contrast Color Fashion Unisex Classic Winter Sun Hat
Two-Tone Fedora Hat Wide Brim Woolen Felt Jazz Style Vintage Contrast Color Fashion Unisex Classic Winter Sun Hat
like
Find Similar
Two-tone wide brim wool felt fedora hat in dark brown with red interior lining - M (56-58cm) / Coffee + Red
Detail of the white wool fedora hat featuring a contrasting vibrant yellow inner lining - M (56-58cm) / White + Yellow
Detailed view of gray fedora hat with white interior lining and wide brim design - M (56-58cm) / Light Grey + White
Detail of classic black wool fedora featuring a vibrant orange brim interior and inner lining - M (56-58cm) / Black + Orange
+20
Two-Tone Fedora Hat Wide Brim Woolen Felt Jazz Style Vintage Contrast Color Fashion Unisex Classic Winter Sun Hat
$3.31
Mix MOQ : 2
 · 
25 sold recently
Fedora Hat Zebra Tiger Print Woolen Wide Brim Vintage Jazz Cap With Leather Band Metal Rivet For Men Women
Fedora Hat Zebra Tiger Print Woolen Wide Brim Vintage Jazz Cap With Leather Band Metal Rivet For Men Women
like
Find Similar
Close-up of zebra pattern fedora hat featuring a brown leather band and metal buckle - M (56-58cm) / Khaki
Detailed view of the tiger print felt hat with leather band and vintage metal concho - M (56-58cm) / Burgundy
Zebra print wool fedora hat with a brown leather band and metal buckle on white background - M (56-58cm) / Gray
Zebra print wool fedora hat with brown leather band and wide brim for winter fashion - M (56-58cm) / Camel
+2
Fedora Hat Zebra Tiger Print Woolen Wide Brim Vintage Jazz Cap With Leather Band Metal Rivet For Men Women
$4.90
Mix MOQ : 2
Ponytail Baseball Cap Cotton Twill Adjustable Sun Hat Solid Color Plain Duck Tongue Cap For Women Men Outdoor Sports
Ponytail Baseball Cap Cotton Twill Adjustable Sun Hat Solid Color Plain Duck Tongue Cap For Women Men Outdoor Sports
like
Find Similar
Classic white ponytail cotton baseball cap with twill texture and minimalist design - White
Classic pink cotton ponytail baseball cap for women with adjustable back opening design - Pink
Classic light grey ponytail baseball cap in pure cotton with a minimalist sun hat design - Gray
Classic black ponytail cotton baseball cap with six-panel structure and curved visor - Black
+7
Ponytail Baseball Cap Cotton Twill Adjustable Sun Hat Solid Color Plain Duck Tongue Cap For Women Men Outdoor Sports
$2.74
Mix MOQ : 2
 · 
387 sold recently
Vintage Newsboy Cap Cotton Polyester Retro British Herringbone Adjustable Flat Ivy Hat For Men Women Warm
Vintage Newsboy Cap Cotton Polyester Retro British Herringbone Adjustable Flat Ivy Hat For Men Women Warm
like
Find Similar
Classic dark grey newsboy cap with vintage herringbone pattern in wool-like texture - Adjustable / Chevron / Dark Gray
Classic newsboy cap in gray herringbone tweed fabric with a button top detail - Adjustable / Chevron / Light Gray
Classic newsboy cap featuring vintage brown and black herringbone wool fabric texture - Adjustable / Chevron / Khaki
Vintage Newsboy Cap Cotton Polyester Retro British Herringbone Adjustable Flat Ivy Hat For Men Women Warm
$3.75
No MOQ
Go to

More in accessories

Explore more in checkered hats

adjustablestyleberet hatwoolpartyearwhiteboytravelcolor
warmbucketcurvedwidegirlsmetalkidsfestivalcasual sun hatlogo

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access