Everful

Wholesale christmas tree toppers

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Christmas Tree Toppers

Find the perfect pieces: christmas supplies, halloween supplies and more

All products in christmas tree toppers

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Christmas Table Runner Linen Burlap Blue Truck Gnome Red Black Plaid Holiday Kitchen Dining Table Decor Merry Christmas
Christmas Table Runner Linen Burlap Blue Truck Gnome Red Black Plaid Holiday Kitchen Dining Table Decor Merry Christmas
like
Find Similar
2 options
Christmas Table Runner Linen Burlap Blue Truck Gnome Red Black Plaid Holiday Kitchen Dining Table Decor Merry Christmas
$7.20
Mix MOQ : 2
Christmas Placemats Burlap Linen Plaid Reindeer Pattern Cutlery Pocket Table Decoration Festive Party Home Decor
Christmas Placemats Burlap Linen Plaid Reindeer Pattern Cutlery Pocket Table Decoration Festive Party Home Decor
like
Find Similar
2 options
Christmas Placemats Burlap Linen Plaid Reindeer Pattern Cutlery Pocket Table Decoration Festive Party Home Decor
$2.54
Mix MOQ : 2
Christmas Table Runner Burlap Linen Gnome Long Legged Decor Faceless Santa Knitted 3D Holiday Party Home Dining Decor
Christmas Table Runner Burlap Linen Gnome Long Legged Decor Faceless Santa Knitted 3D Holiday Party Home Dining Decor
like
Find Similar
2 options
Christmas Table Runner Burlap Linen Gnome Long Legged Decor Faceless Santa Knitted 3D Holiday Party Home Dining Decor
$5.91
Mix MOQ : 2
Christmas Chair Back Covers Linen Red Truck Snowflake Print Dining Room Decorative Buffalo Plaid Trim Merry Christmas
Christmas Chair Back Covers Linen Red Truck Snowflake Print Dining Room Decorative Buffalo Plaid Trim Merry Christmas
like
Find Similar
2 options
Christmas Chair Back Covers Linen Red Truck Snowflake Print Dining Room Decorative Buffalo Plaid Trim Merry Christmas
$3.83
Mix MOQ : 2
Christmas Nutcracker Soldier Chair Covers Faux Linen Burlap Holiday Dining Room Decor Festive Home Party Decoration
Christmas Nutcracker Soldier Chair Covers Faux Linen Burlap Holiday Dining Room Decor Festive Home Party Decoration
like
Find Similar
2 options
Christmas Nutcracker Soldier Chair Covers Faux Linen Burlap Holiday Dining Room Decor Festive Home Party Decoration
$5.04
Mix MOQ : 2
Christmas Burlap Placemats With Cutlery Pocket Embroidery Red Truck Gnome Buffalo Plaid Rustic Farmhouse Holiday Table Decor
Christmas Burlap Placemats With Cutlery Pocket Embroidery Red Truck Gnome Buffalo Plaid Rustic Farmhouse Holiday Table Decor
like
Find Similar
2 options
Christmas Burlap Placemats With Cutlery Pocket Embroidery Red Truck Gnome Buffalo Plaid Rustic Farmhouse Holiday Table Decor
$1.87-2.31
Mix MOQ : 2
Knitted Gnome Wine Bottle Cover Christmas Table Decoration Fabric Festive Gnome Holiday Bottle Decor
Knitted Gnome Wine Bottle Cover Christmas Table Decoration Fabric Festive Gnome Holiday Bottle Decor
like
Find Similar
Christmas wine bottle cover featuring a red felt gnome with grey knit hat and ribbon - Gnome Santa / Red
Christmas gnome wine bottle cover with red knit hat and grey felt beard decoration - Gnome Santa / Gray
Knitted Gnome Wine Bottle Cover Christmas Table Decoration Fabric Festive Gnome Holiday Bottle Decor
-5%
$1.23
No MOQ
Christmas Placemats Polyester Cotton Embroidery Santa Reindeer Patterns Festive Dinner Table Decor Rectangular Washable
Christmas Placemats Polyester Cotton Embroidery Santa Reindeer Patterns Festive Dinner Table Decor Rectangular Washable
like
Find Similar
Christmas place mat with embroidery, red bow, baubles and chevron edge decor - Bells Style
Christmas place mat with embroidered reindeer and red checkered borders for table decor - Reindeer Style
Christmas Placemats Polyester Cotton Embroidery Santa Reindeer Patterns Festive Dinner Table Decor Rectangular Washable
-5%
$1.23
No MOQ
Christmas Wine Bottle Covers Gnome Design Knitted Hat Felt Drawstring Bag Holiday Table Decor Long Beard Swedish Tomte
Christmas Wine Bottle Covers Gnome Design Knitted Hat Felt Drawstring Bag Holiday Table Decor Long Beard Swedish Tomte
like
Find Similar
Christmas gnome wine bottle cover with red and grey knit design in festive kitchen setting - Red Cover Grey Hat Gnome
Gnome wine bottle cover with grey felt and red knit fabric for festive Christmas decor - Grey Cover Red Hat Gnome
Christmas Wine Bottle Covers Gnome Design Knitted Hat Felt Drawstring Bag Holiday Table Decor Long Beard Swedish Tomte
-5%
$1.23
No MOQ
Christmas Gift Packaging Bags Paper Handheld Santa Claus Reindeer Cartoon Shape For Candy Apple Holiday Party Favor
Christmas Gift Packaging Bags Paper Handheld Santa Claus Reindeer Cartoon Shape For Candy Apple Holiday Party Favor
like
Find Similar
Cartoon Santa Claus shaped paper gift bag for Christmas treats and small presents - 19*18.7*7cm / Santa Claus
Christmas gift paper bag featuring a cute 3D reindeer design with red nose and antlers - 19*18.7*7cm / Elk
Christmas Gift Packaging Bags Paper Handheld Santa Claus Reindeer Cartoon Shape For Candy Apple Holiday Party Favor
$0.30
No MOQ
Christmas Gnome Table Runner 3D Swedish Rudolph Knitted Faux Linen Holiday Dining Decor
Christmas Gnome Table Runner 3D Swedish Rudolph Knitted Faux Linen Holiday Dining Decor
like
Find Similar
Red Christmas table runner with 3D Swedish gnome and striped legs on festive dinner table - Nordic Gnome / Red
Christmas table runner with 3D grey gnome and red snowflake knit hat decor - Nordic Gnome / Gray
Christmas Gnome Table Runner 3D Swedish Rudolph Knitted Faux Linen Holiday Dining Decor
$5.76
Mix MOQ : 2
Christmas Cutlery Holders Mini Santa Clothes Trousers Knitted Fabric Table Silverware Pocket Decorative Holiday
Christmas Cutlery Holders Mini Santa Clothes Trousers Knitted Fabric Table Silverware Pocket Decorative Holiday
like
Find Similar
Mini Santa suit cutlery holders with weight tag on a brown wooden texture background - Plastic Button Top and Pants Set
Christmas silverware holder set featuring mini red knit shirt and pants on wood surface - Yellow Non-woven Button Top and Pants Set
Christmas Cutlery Holders Mini Santa Clothes Trousers Knitted Fabric Table Silverware Pocket Decorative Holiday
$0.95
No MOQ
Christmas Cutlery Holder Mini Santa Clothes And Pants Shape Knitted Fabric Table Dinner Decorative Ornament Holiday Party
Christmas Cutlery Holder Mini Santa Clothes And Pants Shape Knitted Fabric Table Dinner Decorative Ornament Holiday Party
like
Find Similar
Christmas miniature red clothing cutlery holder set on a light wood tabletop background - Plastic Button Clothes + Pants Set
Miniature Santa Claus coat and pants utensil holders with hanging ropes on wood background - Non-woven Button Clothes + Pants Set
Christmas Cutlery Holder Mini Santa Clothes And Pants Shape Knitted Fabric Table Dinner Decorative Ornament Holiday Party
$0.95
No MOQ
Christmas Chair Back Covers Fabric 3D Santa Snowman Reindeer Pattern Festive Dining Room Decoration Holiday Party Supplies
Christmas Chair Back Covers Fabric 3D Santa Snowman Reindeer Pattern Festive Dining Room Decoration Holiday Party Supplies
like
Find Similar
Linen Christmas chair cover with 3D snowman and red Merry Christmas flap decoration - Snowman
Close-up of a festive red and green Christmas chair cover with a 3D reindeer doll design - Reindeer
Christmas Chair Back Covers Fabric 3D Santa Snowman Reindeer Pattern Festive Dining Room Decoration Holiday Party Supplies
$5.39
No MOQ
Christmas Wine Bottle Covers Burlap Linen Embroidery Santa Snowman Drawstring Bag Festive Dining Table Decor
Christmas Wine Bottle Covers Burlap Linen Embroidery Santa Snowman Drawstring Bag Festive Dining Table Decor
like
Find Similar
Christmas burlap wine bag with Santa Claus applique and red ribbon tie 14x31cm - Santa Claus
Christmas burlap wine bottle bag with snowman embroidery and red bird, 31x14cm size - Snowman
Christmas Wine Bottle Covers Burlap Linen Embroidery Santa Snowman Drawstring Bag Festive Dining Table Decor
$1.44
Mix MOQ : 2
Christmas Chair Back Covers Santa Claus Snowman Printed Red Fabric For Dining Room Home Holiday Party Decorations
Christmas Chair Back Covers Santa Claus Snowman Printed Red Fabric For Dining Room Home Holiday Party Decorations
like
Find Similar
Christmas chair cover featuring Santa Claus, snowman and reindeer on red background - Santa Claus Print
Christmas chair back cover featuring a snowman and snowflake design in red and white - Snowman Print
Christmas Chair Back Covers Santa Claus Snowman Printed Red Fabric For Dining Room Home Holiday Party Decorations
$1.50
Mix MOQ : 2
Christmas Table Runner Linen Fabric Gnome Snowflake Print Holiday Home Dining Room Decoration Nordic Style Long Cloth
Christmas Table Runner Linen Fabric Gnome Snowflake Print Holiday Home Dining Room Decoration Nordic Style Long Cloth
like
Find Similar
Gray and white Christmas gnome table runner with snowflake prints and linen texture - Grey Gnome Table Runner / Gray
Christmas table runner with red festive gnome print and white snowflake patterns - Red Gnome Table Runner / Red
Christmas Table Runner Linen Fabric Gnome Snowflake Print Holiday Home Dining Room Decoration Nordic Style Long Cloth
-5%
$3.97
No MOQ
Christmas Chair Back Covers Burlap Linen Gnome Snowflake Print Dining Room Holiday Table Decoration
Christmas Chair Back Covers Burlap Linen Gnome Snowflake Print Dining Room Holiday Table Decoration
like
Find Similar
Christmas chair cover featuring grey fabric with white snowflakes and three holiday gnomes - Grey Three Gnomes Style / Gray
Christmas chair cover featuring red fabric with white snowflakes and cute gnome illustrations - Red Three Gnomes Style / Red
Christmas Chair Back Covers Burlap Linen Gnome Snowflake Print Dining Room Holiday Table Decoration
-5%
$2.41
No MOQ
Christmas Stickers Round Self Adhesive Labels Snowman Santa Claus Designs For Gift Box Envelope Holiday Decoration
Christmas Stickers Round Self Adhesive Labels Snowman Santa Claus Designs For Gift Box Envelope Holiday Decoration
like
Find Similar
Christmas snowman and Santa gift labels stickers roll with 8 festive holiday designs - 3.8CM
Christmas Stickers Round Self Adhesive Labels Snowman Santa Claus Designs For Gift Box Envelope Holiday Decoration
$1.30-2.48
No MOQ
Christmas Gnome Refrigerator Handle Covers Sequin Plush Fabric Kitchen Appliance Door Protective Sleeves Holiday Decor
Christmas Gnome Refrigerator Handle Covers Sequin Plush Fabric Kitchen Appliance Door Protective Sleeves Holiday Decor
like
Find Similar
Christmas gnome wine bottle cover in red felt with sequined hat and white beard detail - 512A Male Style 1Pc / 1PC
Christmas gnome refrigerator handle cover or wine bottle topper in red knitted fabric - 512B Female Style 1Pc / 1PC
Christmas Gnome Refrigerator Handle Covers Sequin Plush Fabric Kitchen Appliance Door Protective Sleeves Holiday Decor
-4%
$1.59
No MOQ
Christmas Chair Back Covers Linen Look Plaid Retro Truck Merry Christmas Print Farmhouse Dining Room Decor Holiday Party
Christmas Chair Back Covers Linen Look Plaid Retro Truck Merry Christmas Print Farmhouse Dining Room Decor Holiday Party
like
Find Similar
Linen Christmas chair cover with truck print and black-white checkered edge accent - Black and White Lattice Truck Lettering Style
Christmas chair cover featuring red plaid burlap and vintage red truck with tree - Red and Black Lattice Truck Lettering Style
Christmas Chair Back Covers Linen Look Plaid Retro Truck Merry Christmas Print Farmhouse Dining Room Decor Holiday Party
$2.54
No MOQ
Christmas Wine Bottle Cover Gnome Plaid Burlap Drawstring Gift Bag Forest Man Doll Holiday Dining Table Decoration
Christmas Wine Bottle Cover Gnome Plaid Burlap Drawstring Gift Bag Forest Man Doll Holiday Dining Table Decoration
like
Find Similar
Christmas gnome wine bottle cover with red burlap, black plaid hat and snowflake motifs - Red Forest Gnome / Red
Grey burlap Christmas gnome wine bottle cover with red plaid trim and white snowflake decor - Grey Forest Gnome / Gray
Christmas Wine Bottle Cover Gnome Plaid Burlap Drawstring Gift Bag Forest Man Doll Holiday Dining Table Decoration
-4%
$1.97
Mix MOQ : 2
Christmas Chair Cover Faux Linen Gnomes Pattern Buffalo Plaid Dining Room Kitchen Party Home Decor Festive Nordic
Christmas Chair Cover Faux Linen Gnomes Pattern Buffalo Plaid Dining Room Kitchen Party Home Decor Festive Nordic
like
Find Similar
Christmas gnome chair cover with 3 Gnomes For The Holidays design and size markings - Black and White Plaid
Christmas gnome chair cover with Merry Christmas text and specific size dimensions - Red and Black Plaid
Christmas Chair Cover Faux Linen Gnomes Pattern Buffalo Plaid Dining Room Kitchen Party Home Decor Festive Nordic
-5%
$2.46
Mix MOQ : 2
Christmas Gnome Wine Bottle Covers Knitted Snowflake Reindeer Pattern Faux Fur Beard Holiday Party Table Decoration
Christmas Gnome Wine Bottle Covers Knitted Snowflake Reindeer Pattern Faux Fur Beard Holiday Party Table Decoration
like
Find Similar
Red and white knitted gnome wine bottle topper with plush beard and pom pom hat - Red and White Hat
Knitted Christmas wine bottle cover featuring a red gnome design with reindeer and snowflake patterns - Red and Grey Hat
Christmas Gnome Wine Bottle Covers Knitted Snowflake Reindeer Pattern Faux Fur Beard Holiday Party Table Decoration
-4%
$0.77
No MOQ
Christmas Placemat Knitted Polyester Fabric Santa Reindeer Pattern For Festive Holiday Dining Table Decor
Christmas Placemat Knitted Polyester Fabric Santa Reindeer Pattern For Festive Holiday Dining Table Decor
like
Find Similar
Knitted Christmas placemat with Santa Claus motif and Feliz Navidad text in red and green - Santa Claus
Christmas reindeer knitted placemat with festive bells and holly berries decor - Elk Style
Christmas Placemat Knitted Polyester Fabric Santa Reindeer Pattern For Festive Holiday Dining Table Decor
$1.15
No MOQ
Silicone Molds Christmas Santa Claus Snowman Shape For DIY Handmade Candle Soap Plaster Cake Making Festive 3D Design
Silicone Molds Christmas Santa Claus Snowman Shape For DIY Handmade Candle Soap Plaster Cake Making Festive 3D Design
like
Find Similar
Christmas Santa Claus silicone mold for candles and plaster crafts, 3.54in height - Santa with Christmas Hat
DIY Christmas snowman silicone mold for candles and soap with lucky text detail - Snowman with Christmas Hat
Silicone Molds Christmas Santa Claus Snowman Shape For DIY Handmade Candle Soap Plaster Cake Making Festive 3D Design
-4%
$2.33
Mix MOQ : 5
Christmas Nail Art Stickers 3D Embossed Santa Claus Snowflakes Reindeer Patterns Self Adhesive Holiday Manicure Decoration
Christmas Nail Art Stickers 3D Embossed Santa Claus Snowflakes Reindeer Patterns Self Adhesive Holiday Manicure Decoration
like
Find Similar
Macro shot of 3D Christmas nail stickers with Santa and snowflake motifs YT6702Gd - Jelly YT6702Gd
Detailed view of Christmas nail stickers featuring Santa, reindeer and tree motifs - Shell Light YT6703Te
Christmas Nail Art Stickers 3D Embossed Santa Claus Snowflakes Reindeer Patterns Self Adhesive Holiday Manicure Decoration
$0.72
No MOQ
Free Shipping
Merry Christmas Round Kraft Paper Stickers Roll Self-Adhesive Labels For Gift Wrapping Santa Claus Reindeer Holiday Decor
Merry Christmas Round Kraft Paper Stickers Roll Self-Adhesive Labels For Gift Wrapping Santa Claus Reindeer Holiday Decor
like
Find Similar
2 options
Merry Christmas Round Kraft Paper Stickers Roll Self-Adhesive Labels For Gift Wrapping Santa Claus Reindeer Holiday Decor
$0.35-1.01
No MOQ
Santa Claus Head Silicone Mold 3D DIY Baking Cake Chocolate Candle Soap Plaster Manual Crafting Tool Christmas Theme
Santa Claus Head Silicone Mold 3D DIY Baking Cake Chocolate Candle Soap Plaster Manual Crafting Tool Christmas Theme
like
Find Similar
Santa Claus head silicone mold for DIY cake baking and handcrafted soap making - Santa Claus Head Style (540)
Santa Claus Head Silicone Mold 3D DIY Baking Cake Chocolate Candle Soap Plaster Manual Crafting Tool Christmas Theme
$2.16
Mix MOQ : 2
Christmas Silicone Fondant Cake Mold Pink Reindeer Snowflake Candy Cane Pattern DIY Baking Chocolate Sugarcraft Decorating Tool
Christmas Silicone Fondant Cake Mold Pink Reindeer Snowflake Candy Cane Pattern DIY Baking Chocolate Sugarcraft Decorating Tool
like
Find Similar
1 option
Christmas Silicone Fondant Cake Mold Pink Reindeer Snowflake Candy Cane Pattern DIY Baking Chocolate Sugarcraft Decorating Tool
$0.78
No MOQ
Christmas Sleigh And Stocking Silicone Mold For Fondant Chocolate Baking DIY Tools Festive Cake Mold Snowflake Gift Design
Christmas Sleigh And Stocking Silicone Mold For Fondant Chocolate Baking DIY Tools Festive Cake Mold Snowflake Gift Design
like
Find Similar
1 option
Christmas Sleigh And Stocking Silicone Mold For Fondant Chocolate Baking DIY Tools Festive Cake Mold Snowflake Gift Design
-4%
$0.46
No MOQ
Christmas Table Runner Polyester Buffalo Plaid Pattern Holiday Dining Party Decoration Merry Christmas Print Rustic
Christmas Table Runner Polyester Buffalo Plaid Pattern Holiday Dining Party Decoration Merry Christmas Print Rustic
like
Find Similar
Detailed close-up of red and black plaid Christmas table runner on a wooden surface - 181x35.5cm / Black & Red Plaid
Red and green plaid Christmas table runner with Merry Christmas text on a wooden table - 181x35.5cm / Red Green Checkered
Christmas Table Runner Polyester Buffalo Plaid Pattern Holiday Dining Party Decoration Merry Christmas Print Rustic
-4%
$1.78
No MOQ
Christmas Stickers Gingerbread Man Hot Cocoa Mug Waterproof PVC Decals For Laptop Luggage Guitar DIY Cartoon Holiday Decoration
Christmas Stickers Gingerbread Man Hot Cocoa Mug Waterproof PVC Decals For Laptop Luggage Guitar DIY Cartoon Holiday Decoration
like
Find Similar
Pack of 50 waterproof Christmas coffee cup stickers for decorating laptops and guitars - Christmas Gingerbread Man Coffee Cup Style
Christmas Stickers Gingerbread Man Hot Cocoa Mug Waterproof PVC Decals For Laptop Luggage Guitar DIY Cartoon Holiday Decoration
$0.98
No MOQ
Metal Reindeer Elk Napkin Rings Hollow Out Design Festive Christmas Wedding Dinner Table Decor Holder
Metal Reindeer Elk Napkin Rings Hollow Out Design Festive Christmas Wedding Dinner Table Decor Holder
like
Find Similar
Golden reindeer napkin ring with hollow design on blue fabric and white plate - Gold
Elegant hollow reindeer metal napkin ring with silver polished finish for table setting - Silver
Metal Reindeer Elk Napkin Rings Hollow Out Design Festive Christmas Wedding Dinner Table Decor Holder
$0.75
Mix MOQ : 12
Christmas Gift Box Backpack Shape Cardboard Portable Handle Santa Snowman Cartoon Party Favor Packaging Bag
Christmas Gift Box Backpack Shape Cardboard Portable Handle Santa Snowman Cartoon Party Favor Packaging Bag
like
Find Similar
Forest green Christmas gift box with Santa illustrations and a red handle for treats - Santa Claus Elk And Snowman
Christmas backpack gift box with Santa illustration in classic red and green festive colors - Santa Claus Holding Star
Christmas Gift Box Backpack Shape Cardboard Portable Handle Santa Snowman Cartoon Party Favor Packaging Bag
$0.42
No MOQ
Christmas Wine Bottle Covers Knitted Mini Sweaters And Matching Hats Santa Reindeer Patterns Festive Holiday Table Decor
Christmas Wine Bottle Covers Knitted Mini Sweaters And Matching Hats Santa Reindeer Patterns Festive Holiday Table Decor
like
Find Similar
Close-up of knitted Santa suit wine bottle cover with belt detail and festive background - Santa Claus Belt Style
Close-up of red Christmas wine bottle cover with knitted reindeer and snowflake patterns - Double Reindeer Snowflake Style
Christmas Wine Bottle Covers Knitted Mini Sweaters And Matching Hats Santa Reindeer Patterns Festive Holiday Table Decor
-5%
$2.24
No MOQ
Buffalo Plaid Placemats Cotton Linen Table Mats Christmas Holiday Decor Double Layer Washable Rustic Farmhouse
Buffalo Plaid Placemats Cotton Linen Table Mats Christmas Holiday Decor Double Layer Washable Rustic Farmhouse
like
Find Similar
2 options
Buffalo Plaid Placemats Cotton Linen Table Mats Christmas Holiday Decor Double Layer Washable Rustic Farmhouse
$2.31
No MOQ
Christmas Wine Bottle Cover Knitted Sweater Hat Decor For Festive Dinner Party Santa Elf Pattern Novelty Gift Wrapping
Christmas Wine Bottle Cover Knitted Sweater Hat Decor For Festive Dinner Party Santa Elf Pattern Novelty Gift Wrapping
like
Find Similar
Christmas knit bottle cover set featuring red and green striped sweater and Santa hat - Red and Green Striped Elf Style
Knitted Santa-style wine bottle cover with mini hat and belt detail for Christmas decor - Red Belt Santa Claus Style
Christmas Wine Bottle Cover Knitted Sweater Hat Decor For Festive Dinner Party Santa Elf Pattern Novelty Gift Wrapping
$2.25
Mix MOQ : 2
Christmas Placemats Burlap Texture Table Decor Santa Claus Snowman Pattern Festive Dining Restaurant Home Party Style
Christmas Placemats Burlap Texture Table Decor Santa Claus Snowman Pattern Festive Dining Restaurant Home Party Style
like
Find Similar
Christmas burlap placemat with Santa embroidery and Merry Christmas text for table decor - Santa Claus
Linen Christmas placemat with embroidered snowman and red bird on marble tabletop - Christmas Snowman Style
Christmas Placemats Burlap Texture Table Decor Santa Claus Snowman Pattern Festive Dining Restaurant Home Party Style
$2.54
Mix MOQ : 2
Christmas Wine Bottle Covers Fabric Santa Snowman Reindeer Print Holiday Party Dining Table Decoration Warm Wishes
Christmas Wine Bottle Covers Fabric Santa Snowman Reindeer Print Holiday Party Dining Table Decoration Warm Wishes
like
Find Similar
3 options
Christmas Wine Bottle Covers Fabric Santa Snowman Reindeer Print Holiday Party Dining Table Decoration Warm Wishes
$0.58
No MOQ
Christmas Snow Chiffon Ribbon Organza Snowflake Pattern Decorative Ribbon For Gift Wrapping Holiday Decor DIY Crafts Red Green White
Christmas Snow Chiffon Ribbon Organza Snowflake Pattern Decorative Ribbon For Gift Wrapping Holiday Decor DIY Crafts Red Green White
like
Find Similar
Red Christmas snowflake sheer ribbon for gift wrapping and festive holiday decorations - Chiffon Style / Red
Detail of green sheer organza ribbon with white snowflake prints for gift wrapping - Chiffon Style / Green
White snowflake sheer ribbon for Christmas gift wrapping and festive cake box decoration - Chiffon Style / White
Christmas Snow Chiffon Ribbon Organza Snowflake Pattern Decorative Ribbon For Gift Wrapping Holiday Decor DIY Crafts Red Green White
-5%
$2.08
No MOQ
Alloy Enamel Christmas Charms For Jewelry Making DIY Panda Santa Snowman Reindeer Pendants For Earrings Bracelet Necklace
Alloy Enamel Christmas Charms For Jewelry Making DIY Panda Santa Snowman Reindeer Pendants For Earrings Bracelet Necklace
like
Find Similar
Detail of colorful enamel Christmas charms featuring cute pandas, reindeers and snowmen - Silver Tone Mixed
Detailed grid of Christmas enamel charms including Santa, snowman, and panda for DIY jewelry - KC Gold Tone Mixed
Christmas and panda themed alloy drip oil pendant charms collection with size details - Off-white Base Paint Mixed
Alloy Enamel Christmas Charms For Jewelry Making DIY Panda Santa Snowman Reindeer Pendants For Earrings Bracelet Necklace
$2.23-2.75
Mix MOQ : 2
Free Shipping
Cable Knit Acrylic Fabric Thick Chunky Yarn Material For Christmas Stocking Scarf Apparel Sewing Craft DIY Home Decor
Cable Knit Acrylic Fabric Thick Chunky Yarn Material For Christmas Stocking Scarf Apparel Sewing Craft DIY Home Decor
like
Find Similar
2 options
Cable Knit Acrylic Fabric Thick Chunky Yarn Material For Christmas Stocking Scarf Apparel Sewing Craft DIY Home Decor
$6.63
Mix MOQ : 10
Christmas Chair Back Covers Buffalo Plaid Hat Shape Fabric Red Black White Checkered Dining Room Kitchen Festive Decorations
Christmas Chair Back Covers Buffalo Plaid Hat Shape Fabric Red Black White Checkered Dining Room Kitchen Festive Decorations
like
Find Similar
Christmas chair cover in black and white buffalo plaid with white pompom decoration - Black White Grid
Christmas chair cover featuring red and black buffalo plaid with a white pompom top - Red and Black Grid
Christmas Chair Back Covers Buffalo Plaid Hat Shape Fabric Red Black White Checkered Dining Room Kitchen Festive Decorations
-4%
$1.97
No MOQ
Christmas Wine Bottle Cover Faux Fur Collar Plaid Herringbone Decor With Wooden Buttons For Holiday Dinner Party Decoration
Christmas Wine Bottle Cover Faux Fur Collar Plaid Herringbone Decor With Wooden Buttons For Holiday Dinner Party Decoration
like
Find Similar
Christmas wine bottle cover featuring red and green plaid fabric with brown faux fur collar - Big Pom Pom Red Plaid Style (G-JT101)
Brown herringbone wine bottle cover with faux fur collar and decorative wood buttons - Coarse Hemp Rope Gray Style (G-JT102)
NewChristmas Wine Bottle Cover Faux Fur Collar Plaid Herringbone Decor With Wooden Buttons For Holiday Dinner Party Decoration
$1.33
Mix MOQ : 10
Christmas Table Runner Cloth Gnome Snowflake Print Holiday Dining Room Decoration Nordic Style Forest Man Pattern
Christmas Table Runner Cloth Gnome Snowflake Print Holiday Dining Room Decoration Nordic Style Forest Man Pattern
like
Find Similar
Christmas table runner with cartoon gnomes and snowflakes on a purple festive background - Gray
Christmas table runner with gnome and snowflake patterns for festive holiday home decor - Red
Christmas Table Runner Cloth Gnome Snowflake Print Holiday Dining Room Decoration Nordic Style Forest Man Pattern
-5%
$3.78
No MOQ
Christmas Snowflake Napkin Rings Zinc Alloy Copper Inlaid Rhinestone Gold Silver Table Decoration For Wedding Banquet Party
Christmas Snowflake Napkin Rings Zinc Alloy Copper Inlaid Rhinestone Gold Silver Table Decoration For Wedding Banquet Party
like
Find Similar
2 options
Christmas Snowflake Napkin Rings Zinc Alloy Copper Inlaid Rhinestone Gold Silver Table Decoration For Wedding Banquet Party
$0.52
Mix MOQ : 6
Elegant Snowflake Napkin Ring Zinc Alloy Rhinestone Table Decor Buckle Christmas Wedding Party Holiday Home Kitchen Accessory
Elegant Snowflake Napkin Ring Zinc Alloy Rhinestone Table Decor Buckle Christmas Wedding Party Holiday Home Kitchen Accessory
like
Find Similar
2 options
Elegant Snowflake Napkin Ring Zinc Alloy Rhinestone Table Decor Buckle Christmas Wedding Party Holiday Home Kitchen Accessory
$0.92
Mix MOQ : 12
Christmas Wine Bottle Covers Knitted Fabric Santa Elf Design With Bells And Belt Buckle For Holiday Table Decoration
Christmas Wine Bottle Covers Knitted Fabric Santa Elf Design With Bells And Belt Buckle For Holiday Table Decoration
like
Find Similar
Close-up of a Santa-themed knitted wine bottle cover with a black belt and gold buckle - Santa Claus Belt Style (G-JT37)
Detail of knitted Christmas wine bottle cover with belt and bells in a festive setting - Red and Green Striped Elf Style (G-JT38)
Christmas Wine Bottle Covers Knitted Fabric Santa Elf Design With Bells And Belt Buckle For Holiday Table Decoration
-5%
$1.86
No MOQ
Free Shipping
Christmas Relief Santa Claus Knitted Texture Flower Pot Silicone Mold DIY Candle Holder Plaster Resin Craft Making
Christmas Relief Santa Claus Knitted Texture Flower Pot Silicone Mold DIY Candle Holder Plaster Resin Craft Making
like
Find Similar
Knitted sweater pattern silicone candle mold for DIY plaster pots and 3D resin art crafts - Knitted Sweater Style
Christmas Santa relief silicone mold for DIY planters and candle cups with 8.8cm diameter - Relief Santa Claus Style
Christmas Relief Santa Claus Knitted Texture Flower Pot Silicone Mold DIY Candle Holder Plaster Resin Craft Making
$4.32
Mix MOQ : 5
Cylindrical Storage Jar Silicone Mold Snowflake Relief DIY Resin Plaster Candle Holder Crafting Christmas Decoration
Cylindrical Storage Jar Silicone Mold Snowflake Relief DIY Resin Plaster Candle Holder Crafting Christmas Decoration
like
Find Similar
Cylindrical silicone mold for snowflake embossed candle cup and gypsum storage pot - Ribbon Lace Storage Cup
Silicone cylinder mold for 3D embossed snowflake candle jar or succulent flower pot - Snowflake Storage Cup
Cylindrical Storage Jar Silicone Mold Snowflake Relief DIY Resin Plaster Candle Holder Crafting Christmas Decoration
$3.46-4.03
No MOQ
Cartoon Animal Silicone Mold With Christmas Hat For DIY Handmade Candle Soap Cake Fondant Decor Crafting Tool
Cartoon Animal Silicone Mold With Christmas Hat For DIY Handmade Candle Soap Cake Fondant Decor Crafting Tool
like
Find Similar
4-cavity silicone mold for animal candles featuring tiger panda pig and bear figures - Tiger/Panda/Pig/Bear Style (NO.1)
Cartoon animal silicone mold featuring giraffe and hippo shapes with precise dimensions - Giraffe/Hippo/Zebra/Frog Style (NO.2)
Cartoon Animal Silicone Mold With Christmas Hat For DIY Handmade Candle Soap Cake Fondant Decor Crafting Tool
-4%
$1.37
Mix MOQ : 2
Christmas Wine Bottle Covers Linen Gnome Faceless Plaid Table Decor Gift Bags Drawstring Xmas Party
Christmas Wine Bottle Covers Linen Gnome Faceless Plaid Table Decor Gift Bags Drawstring Xmas Party
like
Find Similar
Detail of Christmas gnome wine bottle cover with red plaid and Merry Christmas text - Red & Black Plaid Gnome Bottle Bag
Detail of Christmas gnome wine gift bag with drawstring and Home For The Holidays print - Black & White Plaid Gnome Bottle Bag
Christmas Wine Bottle Covers Linen Gnome Faceless Plaid Table Decor Gift Bags Drawstring Xmas Party
$0.81
No MOQ
Christmas Wine Bottle Covers Plaid Fabric Drawstring Merry Embroidery Holiday Dining Table Party Decor Novelty Bags
Christmas Wine Bottle Covers Plaid Fabric Drawstring Merry Embroidery Holiday Dining Table Party Decor Novelty Bags
like
Find Similar
Plaid Christmas wine bottle cover with Merry embroidery for festive table decoration - Red and White Plaid Wine Bottle Cover
Plaid Christmas wine bottle cover with Merry embroidery in cozy holiday festive setting - Black and White Plaid Wine Bottle Cover
Christmas Wine Bottle Covers Plaid Fabric Drawstring Merry Embroidery Holiday Dining Table Party Decor Novelty Bags
$1.73
Mix MOQ : 2
Free Shipping
Christmas Table Runner Fabric Snowflakes Gnomes Reindeer Pattern Xmas Holiday Dinner Party Decoration Festive Home Decor
Christmas Table Runner Fabric Snowflakes Gnomes Reindeer Pattern Xmas Holiday Dinner Party Decoration Festive Home Decor
like
Find Similar
Christmas table runner with grey background, red Gnomes, and snowflake patterns - Gray
Red Christmas table runner with white snowflakes and cartoon deer on a white table - Red
Christmas Table Runner Fabric Snowflakes Gnomes Reindeer Pattern Xmas Holiday Dinner Party Decoration Festive Home Decor
$4.61
Mix MOQ : 2
Christmas Toilet Lid Cover And U-Shaped Rug Non-woven Fabric Gnome Reindeer Print Festive Bathroom Holiday Decoration
Christmas Toilet Lid Cover And U-Shaped Rug Non-woven Fabric Gnome Reindeer Print Festive Bathroom Holiday Decoration
like
Find Similar
Christmas toilet seat cover and rug set with festive red dog and snowflake patterns - Red
Christmas toilet cover set with gnome and reindeer patterns on a grey fabric base - Gray
Christmas Toilet Lid Cover And U-Shaped Rug Non-woven Fabric Gnome Reindeer Print Festive Bathroom Holiday Decoration
$4.03
Mix MOQ : 2
Christmas Table Placemats Linen Style Fabric Santa Claus Snowman Motif Heat Resistant Holiday Party Dining Decor
Christmas Table Placemats Linen Style Fabric Santa Claus Snowman Motif Heat Resistant Holiday Party Dining Decor
like
Find Similar
2 options
Christmas Table Placemats Linen Style Fabric Santa Claus Snowman Motif Heat Resistant Holiday Party Dining Decor
$2.88
Mix MOQ : 2
Christmas Chair Covers Linen Fabric Gnome Snowflake Print Dining Room Festive Party Decoration Red Grey
Christmas Chair Covers Linen Fabric Gnome Snowflake Print Dining Room Festive Party Decoration Red Grey
like
Find Similar
2 options
Christmas Chair Covers Linen Fabric Gnome Snowflake Print Dining Room Festive Party Decoration Red Grey
-4%
$2.74
Mix MOQ : 2
Christmas Chair Back Covers Burlap Linen Santa Claus Snowman Embroidery Festive Dining Decor Ruffled Edge Party Ornament
Christmas Chair Back Covers Burlap Linen Santa Claus Snowman Embroidery Festive Dining Decor Ruffled Edge Party Ornament
like
Find Similar
Christmas chair back cover with Santa Claus embroidery and red striped frills - Santa Claus
Linen Christmas chair cover with snowman and red bird embroidery and MERRY CHRISTMAS text - Snowman
Christmas Chair Back Covers Burlap Linen Santa Claus Snowman Embroidery Festive Dining Decor Ruffled Edge Party Ornament
-5%
$3.56
No MOQ
Christmas Wine Bottle Cover Knitted Santa Snowman Pattern Festive Dinner Party Table Decor Holiday Gift Sleeve
Christmas Wine Bottle Cover Knitted Santa Snowman Pattern Festive Dinner Party Table Decor Holiday Gift Sleeve
like
Find Similar
Christmas snowman knitted wine bottle cover with red berry and white stripe neck detail - Snowman / White
Knitted Santa Claus wine bottle cover with red wool and white faux fur trim decor - Santa Claus / Red
Christmas Wine Bottle Cover Knitted Santa Snowman Pattern Festive Dinner Party Table Decor Holiday Gift Sleeve
$1.96
Mix MOQ : 2
Go to

More in party supplies

Explore more in christmas tree toppers

treeplasticgoldsilverartificialshapemetalwarmtree hangingdesktop ornament
starhanginghollowdesktoptoptree decorationsdecorativewhitelonggift wrapping

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access