Everful

Wholesale clips

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Clips

Find the perfect pieces: hair claws, hair clips, hair bands & headbands and more

All products in clips

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Handmade Grosgrain Ribbon Bow Hair Clips Swallowtail Alligator Clip Colorful Hair Accessories For Kids Girls
Handmade Grosgrain Ribbon Bow Hair Clips Swallowtail Alligator Clip Colorful Hair Accessories For Kids Girls
like
Find Similar
Handmade red grosgrain ribbon bow hair clip with swallowtail for girls hair accessories - Red
Handmade bright yellow grosgrain ribbon swallowtail hair clip for girls - Gold
Handmade golden grosgrain ribbon bowtie hairclip for girls in a vibrant yellow finish - Khaki
Handmade purple grosgrain ribbon hair bow with swallowtail clips for little girls - Medium Purple
+19
Handmade Grosgrain Ribbon Bow Hair Clips Swallowtail Alligator Clip Colorful Hair Accessories For Kids Girls
$0.10
Mix MOQ : 2
 · 
12 sold recently
Mini Hair Claw Clips Alloy Rhinestone Faux Artificial Pearl Resin Cat Eye Stone Small Non Slip Elegant Sweet Accessories Women Girls
Mini Hair Claw Clips Alloy Rhinestone Faux Artificial Pearl Resin Cat Eye Stone Small Non Slip Elegant Sweet Accessories Women Girls
like
Find Similar
Detailed view of a gold butterfly hair claw clip with white pearls and yellow rhinestones - 2# Pearl Butterfly Claw Clip
Detail of rabbit ear hair claw clip with faux pearls and cat eye stone on metal base - 3# Pearl Bow Claw Clip
Macro shot of a mini gold butterfly hair claw with pearls and sparkling rhinestones - 4# Rhinestone Butterfly Claw Clip
Elegant gold metal hair claw clip with yellow heart stone and white rhinestones - 9# Rhinestone Leaf Claw Clip
+11
Mini Hair Claw Clips Alloy Rhinestone Faux Artificial Pearl Resin Cat Eye Stone Small Non Slip Elegant Sweet Accessories Women Girls
$0.64
No MOQ
 · 
1 reviews
Star Hair Clips Colorful Metal BB Snap Clips Dotted Enamel Macaron Sweet Girls Kids Hairpins
Star Hair Clips Colorful Metal BB Snap Clips Dotted Enamel Macaron Sweet Girls Kids Hairpins
like
Find Similar
Set of 10 star shaped metal snap hair clips in neutral candy colors on display card - 3.2cm Beige Coffee Enamel (10pcs/Card)
Set of 10 colorful star-shaped metal hair clips in candy colors on display card - 3.2cm Candy Enamel Color (10pcs/Card)
Set of 10 colorful star-shaped metal hair clips with candy-colored polka dots pattern - Enamel Polka Dot Star (10pcs/Card)
Set of 10 candy-colored star hair clips with polka dots on display card for girls - Polka Dot Star (10pcs/Card)
+27
Star Hair Clips Colorful Metal BB Snap Clips Dotted Enamel Macaron Sweet Girls Kids Hairpins
$0.06-1.30
Mix MOQ : 2
 · 
28 views
Vintage Velvet Bow Hair Clip With Long Streamers Elegant Double Layer Butterfly Ribbon Hairpin For Women Hair Accessories
Vintage Velvet Bow Hair Clip With Long Streamers Elegant Double Layer Butterfly Ribbon Hairpin For Women Hair Accessories
like
Find Similar
Elegant black velvet bow hair clip with long streamers and a sleek duckbill grip - Black
Elegant light pink double layer velvet bow hair clip with long ribbons for women - Pink
Elegant red velvet bow hair clip with long ribbons and metal duckbill attachment - Burgundy
Elegant red velvet double-layered bow hair clip with long ribbon streamers for women - Red
+5
Vintage Velvet Bow Hair Clip With Long Streamers Elegant Double Layer Butterfly Ribbon Hairpin For Women Hair Accessories
$0.72
No MOQ
 · 
39 sold recently
Free Shipping
Plaid Cloth Wrapped Metal BB Hair Clip Star Triangle Rectangle Shapes Korean Fresh Style Side Fringe Barrette For Women
Plaid Cloth Wrapped Metal BB Hair Clip Star Triangle Rectangle Shapes Korean Fresh Style Side Fringe Barrette For Women
like
Find Similar
Detailed view of blue and white checkered fabric clip with black metal inner curve - Irregular Wavy
Detailed macro of blue and white checkered star hair clip on rustic fabric background - Star Shape
Detailed close-up of blue and white plaid fabric BB hair clip with woven texture detail - Rectangle
Detail of blue and white plaid fabric triangle hair clip on beige canvas background - Triangle
Plaid Cloth Wrapped Metal BB Hair Clip Star Triangle Rectangle Shapes Korean Fresh Style Side Fringe Barrette For Women
$0.33-0.36
No MOQ
 · 
11 sold recently
Free Shipping
Large Fabric Rose Flower Hair Claw Clip Handmade French Vintage Romantic Stereoscopic Floral Hairpins For Women
Large Fabric Rose Flower Hair Claw Clip Handmade French Vintage Romantic Stereoscopic Floral Hairpins For Women
like
Find Similar
Macro detail of fabric layers and central stamens on the artificial rose hair claw clip - Orange Rose Flower Claw Clip
Detailed macro view of 3D fabric rose hair claw clip with multi-layer pink gradient petals - Red Rose Flower Claw Clip
Detail of fabric rose hair claw clip featuring pink purple gradient petals and stamen - Light Rose Red Flower Claw Clip
Detail of pink fabric rose hair claw clip showing realistic petals and spring mechanism - Light Pink Rose Flower Claw Clip
Large Fabric Rose Flower Hair Claw Clip Handmade French Vintage Romantic Stereoscopic Floral Hairpins For Women
$1.70-2.22
No MOQ
 · 
10 views
Free Shipping
Butterfly Hair Clips Matte Alloy Snap BB Pins Candy Color Sweet Style Hairpins For Women Girls Kids Accessories
Butterfly Hair Clips Matte Alloy Snap BB Pins Candy Color Sweet Style Hairpins For Women Girls Kids Accessories
like
Find Similar
Cute pink butterfly hair clip with matte finish and metal snap closure for women - Matte Butterfly / Orange
Close-up of yellow butterfly hair clips with cute matte finish and镂空 wings detail - Matte Butterfly / Yellow
Close-up of two mint green butterfly hair clips with wavy snap metal design - Matte Butterfly / Green
Detailed macro view of two light blue matte butterfly-shaped hollow metal BB hair clips - Matte Butterfly / Blue
+2
Butterfly Hair Clips Matte Alloy Snap BB Pins Candy Color Sweet Style Hairpins For Women Girls Kids Accessories
$0.14
Mix MOQ : 2
 · 
60 sold recently
Baroque Style Colorful Floral Fabric Bow Rhinestone Headband Hair Clip Vintage Luxurious Flower Hair Accessories For Women Party
Baroque Style Colorful Floral Fabric Bow Rhinestone Headband Hair Clip Vintage Luxurious Flower Hair Accessories For Women Party
like
Find Similar
Luxury pink baroque headband with colorful crystal rhinestones and floral fabric - Pink Vintage Floral Headband (A)
Detail of baroque headband with colorful floral fabric and sparkling rhinestone flowers - Yellow Blue Patchwork Printed Wide Headband (B)
Detailed macro view of cream satin headband with colorful rhinestone floral gemstone patterns - Off-white Jacquard Rhinestone Headband (C)
Detail of baroque wide headband with colorful floral rhinestones on metallic brocade - Grey Gold Jacquard Luxurious Rhinestone Headband (D)
+4
Baroque Style Colorful Floral Fabric Bow Rhinestone Headband Hair Clip Vintage Luxurious Flower Hair Accessories For Women Party
$7.20-12.97
No MOQ
Simulation Rose Flower Hair Clip Brooch Polyester Fabric Bohemian Beach Vacation Style Hair Accessories For Women
Simulation Rose Flower Hair Clip Brooch Polyester Fabric Bohemian Beach Vacation Style Hair Accessories For Women
like
Find Similar
Bohemian hair clip featuring a yellow and pink gradient artificial rose flower head - Colorful Yellow
Detailed close-up of an orange and red gradient artificial rose flower head on white background - Orange
Close-up of deep red artificial silk rose flower with realistic blooming petals - Burgundy
Sky blue artificial rose hair clip with green leaves in bohemian floral design - Lake Blue
+26
Simulation Rose Flower Hair Clip Brooch Polyester Fabric Bohemian Beach Vacation Style Hair Accessories For Women
-4%
$0.46
No MOQ
 · 
46 sold recently
Fashion Floral Marble Pattern Rectangular Hair Claw Clips Hollow Large Square Acetate Hairpins For Women Daily Commute
Fashion Floral Marble Pattern Rectangular Hair Claw Clips Hollow Large Square Acetate Hairpins For Women Daily Commute
like
Find Similar
Detailed view of floral hollow hair claw clip with pink and purple ink flower patterns - Beige Floral
Fashionable hollow square hair claw clip featuring classic blue and white floral ink patterns - Beige Blue Floral
Detail of square hair claw clip featuring elegant black and white marble ink texture - Grey Ink Marble
Detailed macro view of the rectangular hair claw clip with ink wash tulip flower prints - Grey Flower
+17
Fashion Floral Marble Pattern Rectangular Hair Claw Clips Hollow Large Square Acetate Hairpins For Women Daily Commute
$0.63-1.14
No MOQ
 · 
20 views
Free Shipping
Velvet Bow Hair Clip Long Streamer Ribbon Double Layer Alligator Hairpin French Style Autumn Winter Christmas For Women
Velvet Bow Hair Clip Long Streamer Ribbon Double Layer Alligator Hairpin French Style Autumn Winter Christmas For Women
like
Find Similar
French style double-layer black velvet bow hair clip with long elegant ribbons - Black
Dark green velvet ballet-style bow hair clip with long ribbons on white background - Dark Green
Detailed close-up of dark blue velvet bow hair clip with long elegant ribbons - Sapphire Blue
Double-layer velvet bow hair clip in deep wine red with long ribbon streamers - Burgundy
+6
Velvet Bow Hair Clip Long Streamer Ribbon Double Layer Alligator Hairpin French Style Autumn Winter Christmas For Women
$0.63
No MOQ
 · 
12 sold recently
ABS Bat Shaped Hair Claw Clip Glitter Gradient Color Halloween Party Hair Accessories For Women Gothic Style Hair Clip
ABS Bat Shaped Hair Claw Clip Glitter Gradient Color Halloween Party Hair Accessories For Women Gothic Style Hair Clip
like
Find Similar
Macro shot of matte black bat hair claw clip with cutout wing design for Halloween - Glitter Black (8.5cm)
Detailed close-up of a red bat hair claw clip with golden metal spring for Halloween - Glitter Red (8.5cm)
Detail of red bat hair claw with glitter finish and white gradient for Halloween - Glitter Red White (8.5cm)
Close-up of a red glittery bat claw clip with Halloween pumpkins and spider decor - Glitter Red (10cm)
+3
ABS Bat Shaped Hair Claw Clip Glitter Gradient Color Halloween Party Hair Accessories For Women Gothic Style Hair Clip
-4%
$0.36-0.41
No MOQ
Alloy Resin Imitation Artificial Pearl Rhinestone Hair Clips With Star Flower Heart Pattern For Women Korean Style
Alloy Resin Imitation Artificial Pearl Rhinestone Hair Clips With Star Flower Heart Pattern For Women Korean Style
like
Find Similar
8-piece hair clip set featuring pearls, flowers and green gems on white card - 8pcs Set-Deluxe Elaborate Style
Golden hair clip set featuring scissor and feather designs with sparkling rhinestones - 2pcs Rhinestone Set-A Style
Set of 4 blue resin and pearl hair clips with golden metal base shown in hand - 4pcs Set-Light Blue Style
2-piece set of gold rhinestone hair clips with white pearls in bow and flower designs - 2pcs Rhinestone Set-B Style
+34
Alloy Resin Imitation Artificial Pearl Rhinestone Hair Clips With Star Flower Heart Pattern For Women Korean Style
$1.10-3.03
No MOQ
 · 
42 views
Free Shipping
Elegant Large Hair Claw Clip Acetate Fiber Marble Floral Pattern Shark Clip Strong Hold Non-slip Hair Accessory Women
Elegant Large Hair Claw Clip Acetate Fiber Marble Floral Pattern Shark Clip Strong Hold Non-slip Hair Accessory Women
like
Find Similar
Pink and white marbled acetate hair claw clip with large shark clip design for women - Colorful Pink Floral
Close-up of a cream yellow marbled acetate hair claw clip on a stylish paper background - Colorful Yellow Floral
Close-up of large acetate hair claw clip with creamy marble pattern and pearlescent finish - Colorful Green Floral
Close-up of blue and white marble acetate hair claw clip with pearlescent finish - Colorful Blue & Yellow Floral
+1
Elegant Large Hair Claw Clip Acetate Fiber Marble Floral Pattern Shark Clip Strong Hold Non-slip Hair Accessory Women
$3.80
No MOQ
Free Shipping
Men Business Accessory Alloy Enamel Blue Greek Key Meander Pattern Round Cufflinks And Rectangular Tie Clip Jewelry
Men Business Accessory Alloy Enamel Blue Greek Key Meander Pattern Round Cufflinks And Rectangular Tie Clip Jewelry
like
Find Similar
Detailed view of silver mens cufflinks featuring blue geometric patterns and 1.8cm diameter - Geometric Radiating Style (B1544)
Detailed view of silver round cufflinks with blue enamel patterns and sunburst engraving - Blue Texture Dome Style (B1545)
Detailed view of silver cufflinks with blue enamel patterns, showing 1.7cm size and weight - Scroll Pattern Style (B1546)
Detail of silver cufflinks with blue geometric pattern, size 1.8cm and weight 14.5g - Greek Key Style (B1547)
+10
Men Business Accessory Alloy Enamel Blue Greek Key Meander Pattern Round Cufflinks And Rectangular Tie Clip Jewelry
-9%
$0.86-1.15
No MOQ
Free Shipping
Cute Plush Pom Pom Hair Claw Clip Mini Acrylic Hair Accessories For Women Girls Sweet Soft Style Autumn Winter
Cute Plush Pom Pom Hair Claw Clip Mini Acrylic Hair Accessories For Women Girls Sweet Soft Style Autumn Winter
like
Find Similar
Pair of sweet white plush pompom hair clips on a heart-shaped mirror tray display - White
Pair of light blue plush ball hair clips with transparent plastic bow design - Blue
Cute red pom-pom hair claw clip with transparent base displayed on a ceramic dish - Burgundy
Cute pink plush ball hair claw clip with faux fur design for women and girls - Peach Pink
+5
Cute Plush Pom Pom Hair Claw Clip Mini Acrylic Hair Accessories For Women Girls Sweet Soft Style Autumn Winter
$0.07
Mix MOQ : 2
 · 
54 sold recently
Acetate Duckbill Hair Clips Water Drop Shape Marble Tortoiseshell Pattern Side Fringe Styling Hairpins Korean Style For Women
Acetate Duckbill Hair Clips Water Drop Shape Marble Tortoiseshell Pattern Side Fringe Styling Hairpins Korean Style For Women
like
Find Similar
Set of two amber tortoiseshell acetate waterdrop hair clips on a display card - Coffee Tortoise Shell
Cream marble acetate water drop hair clips set with gold metal base for women - Ink Gray
Acetate Duckbill Hair Clips Water Drop Shape Marble Tortoiseshell Pattern Side Fringe Styling Hairpins Korean Style For Women
$1.07
No MOQ
 · 
10 views
Free Shipping
Sequin Star Hair Clips Red Silver Blue Patriotic Pentagram Hairpins For USA Independence Day Party Women Kids Hair Accessories
Sequin Star Hair Clips Red Silver Blue Patriotic Pentagram Hairpins For USA Independence Day Party Women Kids Hair Accessories
like
Find Similar
Three-piece star hair clips set in red, silver, and blue sequins for Independence Day - Red Silver Blue Star Hair Clips (Large)
Independence Day sequin star hair clip in red silver and blue American flag colors - Red Silver Blue Star Hair Clips (Small)
Silver sequin star hair clip for Independence Day, measuring 2.99 inches and 4.4g - Silver Star Hair Clip
Red sequin star hair clip for Independence Day, 7.6cm size for festive party decoration - Red Star Hair Clip
+4
Sequin Star Hair Clips Red Silver Blue Patriotic Pentagram Hairpins For USA Independence Day Party Women Kids Hair Accessories
$0.24-0.53
Mix MOQ : 2
 · 
10 views
Free Shipping
Strawberry Hair Claw Clip Acrylic Red Fruit Shark Clip Cute Sweet Hair Accessories For Women Girls
Strawberry Hair Claw Clip Acrylic Red Fruit Shark Clip Cute Sweet Hair Accessories For Women Girls
like
Find Similar
Sweet red strawberry acrylic hair claw clip for women's ponytail hair accessory - Red (Strawberry)
Strawberry Hair Claw Clip Acrylic Red Fruit Shark Clip Cute Sweet Hair Accessories For Women Girls
$0.86
Mix MOQ : 2
 · 
15 sold recently
Handmade Rhinestone Star Swan Hair Clip Headband For Girls Kids Fashion Sparkling Crystal Hairpin Non-slip Metal Hair Accessories Party Gift
Handmade Rhinestone Star Swan Hair Clip Headband For Girls Kids Fashion Sparkling Crystal Hairpin Non-slip Metal Hair Accessories Party Gift
like
Find Similar
Detailed view of swan-shaped hair clip with white rhinestones and opal on jewelry card - Swan Hair Clip
Detail of three handmade star hair accessories with clear rhinestones on display card - White Small Star Hair Clip
Detail of star-shaped hairpins with purple rhinestones on a handmade accessory card - Dark Pink Star Duo Hair Clip
Detail of star-shaped hair accessories with sparkling multi-colored rhinestones and black base - Light Coffee Star Duo Hair Clip
+9
Handmade Rhinestone Star Swan Hair Clip Headband For Girls Kids Fashion Sparkling Crystal Hairpin Non-slip Metal Hair Accessories Party Gift
$0.65-1.22
No MOQ
 · 
21 sold recently
Halloween Hair Clips Acrylic Metal Alligator Hair Pins Pumpkin Bat Ghost Spider Web Spooky Festival Accessory Women Girls
Halloween Hair Clips Acrylic Metal Alligator Hair Pins Pumpkin Bat Ghost Spider Web Spooky Festival Accessory Women Girls
like
Find Similar
Ghost and BOO! motif Halloween hair clip with gold metal base and silver glitter - Glitter Ghost
Halloween duckbill hair clip featuring orange bats and pumpkin patterns on black base - Pumpkin Spider Web
White Halloween hair clip with spider web, pumpkin and bat patterns on gold metal clip - Off-white Spider
Halloween pumpkin and wizard hat hair clip with black glitter finish and gold metal base - Pumpkin Magic Hat
+2
Halloween Hair Clips Acrylic Metal Alligator Hair Pins Pumpkin Bat Ghost Spider Web Spooky Festival Accessory Women Girls
$0.35
Mix MOQ : 2
 · 
24 sold recently
Free Shipping
Small Hair Claw Clips Resin Semi Transparent Jelly Color Cross Twist Hairpins Elegant Shark Clips For Girls Women Accessories
Small Hair Claw Clips Resin Semi Transparent Jelly Color Cross Twist Hairpins Elegant Shark Clips For Girls Women Accessories
like
Find Similar
Translucent beige mini resin hair claw clips with elegant twisted design - 1 Piece / Jelly White
Translucent jelly yellow mini claw clip with twist design on dark wood background - 1 Piece / Jelly Green
Translucent amber 4.5cm small hair claw clips on a wooden surface with soft shadows - 1 Piece / Jelly Coffee
Set of two light blue translucent cross hair claws in minimalist jelly resin style - 1 Piece / Jelly Grey
+1
Small Hair Claw Clips Resin Semi Transparent Jelly Color Cross Twist Hairpins Elegant Shark Clips For Girls Women Accessories
$0.05
No MOQ
 · 
155 sold recently
Elegant Acetate Monstera Leaf Hair Claw Clip With Gold Veins Marble Texture Shark Clip For Women Daily Hair Accessory
Elegant Acetate Monstera Leaf Hair Claw Clip With Gold Veins Marble Texture Shark Clip For Women Daily Hair Accessory
like
Find Similar
Elegant leaf-shaped hair claw with black and white marble texture and gold veins - Black 9.3cm
Elegant monstera leaf hair claw clip in creamy white with golden vein details - Milky White 9.3cm
Pink and green monstera leaf hair claw clip with golden veins in acetate material - Variegated 9.3cm
Leaf-shaped acetate hair claw clip with purple marble texture and golden vein details - Light Purple 9.3cm
+1
Elegant Acetate Monstera Leaf Hair Claw Clip With Gold Veins Marble Texture Shark Clip For Women Daily Hair Accessory
$2.85
Mix MOQ : 6
 · 
10 sold recently
Professional Non-Slip Alligator Hair Sectioning Clips For Salon Matte Plastic Crocodile Hair Clips For Women Hair Styling
Professional Non-Slip Alligator Hair Sectioning Clips For Salon Matte Plastic Crocodile Hair Clips For Women Hair Styling
like
Find Similar
Set of 6 lilac purple alligator hair clips with non-slip texture for salon styling - Deep purple
Close-up of six pink salon hair clips with non-slip handles for hair styling - Light Pink
Close-up of six professional black crocodile hair clips with non-slip texture for styling - Black
Set of six lavender professional hair clips with non-slip grip for salon styling - Light Purple
+4
Professional Non-Slip Alligator Hair Sectioning Clips For Salon Matte Plastic Crocodile Hair Clips For Women Hair Styling
-83%
$0.11
No MOQ
 · 
18 sold recently
Rhinestone Flower Bun Maker Hair Clip Elegant Korean Style Hair Styling Accessory For Women Nest Shape Headwear
Rhinestone Flower Bun Maker Hair Clip Elegant Korean Style Hair Styling Accessory For Women Nest Shape Headwear
like
Find Similar
Floral rhinestone hair clip with pink blue and gold crystals on a black base - Large Flower Colorful / Large
Elegant bun maker hair clip with sparkling blue rhinestones in a floral pattern - Medium Flower Deep Blue / Medium
Elegant black hair bun maker with sparkling golden rhinestones in a floral pattern - Large Flower Coffee / Large
Elegant black circular hair clip with silver and blue rhinestone flower details - Large Flower Blue Grey / Large
+5
Rhinestone Flower Bun Maker Hair Clip Elegant Korean Style Hair Styling Accessory For Women Nest Shape Headwear
$0.84-0.89
No MOQ
 · 
13 views
Cherry Hair Claw Clip Rhinestone Studded Sweet Fruit Design Acetate Shark Clip For Women Hair Accessory
Cherry Hair Claw Clip Rhinestone Studded Sweet Fruit Design Acetate Shark Clip For Women Hair Accessory
like
Find Similar
Matte light green cherry hair claw clip made of resin for elegant updos - Spring Water Green with Rhinestone
Sweet black gloss hair claw clip with red cherry and green leaf accents for women - Gem Black with Rhinestone
Pink pearl acetate hair claw clip with detailed sweet red cherry patterns for women - Begonia Red with Rhinestone
Cream-colored claw clip featuring red and green rhinestone cherry patterns for hair styling - Gardenia White with Rhinestone
Cherry Hair Claw Clip Rhinestone Studded Sweet Fruit Design Acetate Shark Clip For Women Hair Accessory
-4%
$0.82-1.23
Mix MOQ : 2
 · 
24 views
Creative Ocean Series Hair Claws Cellulose Acetate Fish Shell Shaped Clips Semi Transparent Marble Pattern For Women
Creative Ocean Series Hair Claws Cellulose Acetate Fish Shell Shaped Clips Semi Transparent Marble Pattern For Women
like
Find Similar
Tropical fish hair claw in pink and gold gradient acetate with sparkling rhinestone eye - Style 1-Pink Gold Gradient Fish
Pink shell hair clip with a pearlescent finish and creative marine style design - Style 2-Pink Shell
Creative fish-shaped acetate hair clip in yellow and white with crystal accents - Style 3-Yellow Grey Textured Fish
Blue tropical fish acetate hair clip with orange stripes and yellow fin detail - Style 4-Blue Tropical Fish
+6
Creative Ocean Series Hair Claws Cellulose Acetate Fish Shell Shaped Clips Semi Transparent Marble Pattern For Women
-4%
$0.82
No MOQ
 · 
115 sold recently
Unicorn Star Bow Hair Clips Sequin Faux Leather Mesh Colorful Barrettes For Kids Girls Hair Accessories
Unicorn Star Bow Hair Clips Sequin Faux Leather Mesh Colorful Barrettes For Kids Girls Hair Accessories
like
Find Similar
Sparkly white unicorn hair clip with colorful sequins and soft white pom-pom detail - Multi-color Unicorn
Detail of light blue glitter hair bow featuring a golden unicorn horn on a display card - Light Blue Bow with Gold Horn
Close-up of a pink glitter bow hair clip on a handmade card with gold accents - Light Yellow Bow with Gold Horn
Close-up of pink glitter bow hair clip with golden unicorn horn on a display card - Light Pink Bow with Gold Horn
+14
Unicorn Star Bow Hair Clips Sequin Faux Leather Mesh Colorful Barrettes For Kids Girls Hair Accessories
$0.61-1.73
Mix MOQ : 3
 · 
27 sold recently
Free Shipping
Creative Medical Theme Cartoon Paper Clips PVC Soft Glue Decorative Bookmarks For Doctor Nurse Office School Stationery Gifts
Creative Medical Theme Cartoon Paper Clips PVC Soft Glue Decorative Bookmarks For Doctor Nurse Office School Stationery Gifts
like
Find Similar
Blue metal paperclip with creative 3D medical syringe PVC decoration for bookmarks - Blue Syringe Style (1)
Creative police car PVC paperclip with blue metal finish for office and school supplies - Cartoon Emergency Vehicle Style (2)
Blue metal paperclip with a cute PVC cartoon first aid kit charm for office use - Heart Medical Kit Style (3)
PVC paperclip with white metal wire featuring a cartoon ECG monitor medical design - ECG Monitor Style (4)
+17
Creative Medical Theme Cartoon Paper Clips PVC Soft Glue Decorative Bookmarks For Doctor Nurse Office School Stationery Gifts
$0.12
Mix MOQ : 100
 · 
19 views
Fruit Pattern Hair Claw Clips Transparent Acrylic Shark Jaw Clip Sweet Pastoral Style Non-Slip Hair Accessories For Women Girls
Fruit Pattern Hair Claw Clips Transparent Acrylic Shark Jaw Clip Sweet Pastoral Style Non-Slip Hair Accessories For Women Girls
like
Find Similar
Floral hair claw clip with yellow lemon print on transparent acrylic rectangle design - Lemon
Sweet floral strawberry print hair claw clip in transparent pink plastic for girls - Strawberry
Floral hair claw clip with orange fruit pattern on transparent acrylic material - Orange
Pink grape pattern on transparent rectangular claw clip for sweet hairstyles - Grapes
+1
Fruit Pattern Hair Claw Clips Transparent Acrylic Shark Jaw Clip Sweet Pastoral Style Non-Slip Hair Accessories For Women Girls
$0.28
No MOQ
 · 
77 sold recently
Cute Gummy Bear Hair Clips Resin Acrylic Candy Color Jelly Bobby Pins For Girls Kids Korean Style Cartoon Headwear
Cute Gummy Bear Hair Clips Resin Acrylic Candy Color Jelly Bobby Pins For Girls Kids Korean Style Cartoon Headwear
like
Find Similar
Detail view of colorful acrylic gummy bear hair clips on gold metal base and display card - Duckbill Clip No.1
Set of 7 colorful acrylic gummy bear hair clips with gold metal base for girls - 7 Pieces Set Bobby Pins
Detailed view of four colorful gradient resin bear hair clips on a white card display - 4 Pieces Set Duckbill Clips
Detailed view of a white acrylic gummy bear charm on a gold-plated metal hair clip - White
+14
Cute Gummy Bear Hair Clips Resin Acrylic Candy Color Jelly Bobby Pins For Girls Kids Korean Style Cartoon Headwear
$0.20-2.74
No MOQ
 · 
49 views
Free Shipping
Bohemian Vintage Alloy Hair Clips Ethnic Style Artificial Turquoise Faux Artificial Pearl Enamel Chinese Knot Flower Side Clips
Bohemian Vintage Alloy Hair Clips Ethnic Style Artificial Turquoise Faux Artificial Pearl Enamel Chinese Knot Flower Side Clips
like
Find Similar
Detailed set of 5 vintage alloy hair clips with ethnic patterns on display card - Chinese Pattern Gold Style (Combination One)
5-piece vintage alloy hair clip set with Chinese motifs and turquoise accents - Chinese Pattern Gold Style (Combination Two)
Detail of 5-piece silver alloy hair clips with bohemian turquoise stones and ethnic patterns - Chinese Pattern Silver Style (Combination One)
Bohemian 5-piece silver alloy hair clip set with turquoise and faux pearls - Chinese Pattern Silver Style (Combination Two)
Bohemian Vintage Alloy Hair Clips Ethnic Style Artificial Turquoise Faux Artificial Pearl Enamel Chinese Knot Flower Side Clips
$1.53-2.10
No MOQ
Free Shipping
Kids Rainbow Gradient Hair Clips With Colorful Synthetic Fiber Extensions Unicorn Butterfly Star Decorations For Girls Hair
Kids Rainbow Gradient Hair Clips With Colorful Synthetic Fiber Extensions Unicorn Butterfly Star Decorations For Girls Hair
like
Find Similar
Glittery purple butterfly hair clip with colorful rainbow hair extension for girls - Butterfly
Unicorn hair clip for girls with colorful rainbow hair extension and glitter details - 4# Unicorn Bow
Girl's unicorn bow hairclip with long colorful rainbow synthetic hair extension - 5# Unicorn Lace
Rainbow hair extension with heart sequin clip and colorful gradient synthetic hair - 7# Quicksand Heart
+7
Kids Rainbow Gradient Hair Clips With Colorful Synthetic Fiber Extensions Unicorn Butterfly Star Decorations For Girls Hair
$0.81
No MOQ
 · 
29 sold recently
Moon Star Natural Crystal Hair Clip Hollow Metal Bobby Pin Bohemian Side Clip Women Fashion Hair Accessories
Moon Star Natural Crystal Hair Clip Hollow Metal Bobby Pin Bohemian Side Clip Women Fashion Hair Accessories
like
Find Similar
Detailed view of silver moon hair clip with pink crystal pendant on tree bark background - Pink Crystal
Detail of silver moon hair clip with green crystal and star charm on bark - Dark Green Crystal
Detailed shot of hollow moon hair clip with gradient crystal pillar on rustic wood bark - Blue Purple Crystal
Detail of silver moon hair clip with gradient raw crystal and star pendant on tree bark - Yellow Green Crystal
+10
Moon Star Natural Crystal Hair Clip Hollow Metal Bobby Pin Bohemian Side Clip Women Fashion Hair Accessories
$1.30-1.44
No MOQ
 · 
20 views
Free Shipping
Hair Claw Clip Acrylic Acetate Gold Initial Letter Marble Artificial Pearl Texture French Elegant Headwear For Women Girls
Hair Claw Clip Acrylic Acetate Gold Initial Letter Marble Artificial Pearl Texture French Elegant Headwear For Women Girls
like
Find Similar
Pink acrylic hair claw clip with letter T and marble texture 8.7cm length - Marble Pink Letter T Hair Claw
Pink glitter acrylic claw clip with gold letter L design for women hair accessory - Marble Pink Letter L Hair Claw
Pink translucent glitter hair claw clip with golden letter S decoration 8.6cm length - Marble Pink Letter S Hair Claw
Pink acrylic hair claw clip with golden letter A and marble texture finish - Marble Pink Letter A Hair Claw
+26
Hair Claw Clip Acrylic Acetate Gold Initial Letter Marble Artificial Pearl Texture French Elegant Headwear For Women Girls
$0.93-1.97
Mix MOQ : 2
 · 
29 views
Acetate Hair Claw Clip French Style Marble Zebra Stripe Shark Hair Clamp Large Non-Slip Hair Accessories For Women Girls
Acetate Hair Claw Clip French Style Marble Zebra Stripe Shark Hair Clamp Large Non-Slip Hair Accessories For Women Girls
like
Find Similar
French ink acetate claw clip in cream white with vertical stripe texture for women - Ink Champagne
French style beige marble pattern acetate hair claw clip with rectangle top design - Pearly Milk Tea
Acetate Hair Claw Clip French Style Marble Zebra Stripe Shark Hair Clamp Large Non-Slip Hair Accessories For Women Girls
$1.61
Mix MOQ : 2
Elegant Satin Bow Hair Clip With Heart Artificial Pearl Decoration Sweet Vintage Hair Barrette Spring Clip For Women Styling Jewelry
Elegant Satin Bow Hair Clip With Heart Artificial Pearl Decoration Sweet Vintage Hair Barrette Spring Clip For Women Styling Jewelry
like
Find Similar
Detail of black satin bow hair clip with a gold-rimmed heart pearl center ornament - Black
Elegant pink satin ribbon hair clip with a gold-trimmed pearl heart center for women - Pink
Elegant white ribbon bow hair clip with a pearl-encrusted heart centerpiece accessory - White
Elegant Satin Bow Hair Clip With Heart Artificial Pearl Decoration Sweet Vintage Hair Barrette Spring Clip For Women Styling Jewelry
$1.10
No MOQ
 · 
1 reviews
Free Shipping
Halloween Hair Claw Clip UV Printed Plastic Pumpkin Ghost Bat Design Cartoon Festive Party Accessory For Women Jewelry
Halloween Hair Claw Clip UV Printed Plastic Pumpkin Ghost Bat Design Cartoon Festive Party Accessory For Women Jewelry
like
Find Similar
Detail of Halloween flower hair claw with pumpkin, ghost and bat patterns on orange surface - 8cm / Orange Flower Pumpkin Ghost Style
Close-up of flower-shaped Halloween claw clip with ghosts and pumpkin prints - 8cm / Red Flower Pumpkin Bat Style
Detail of Halloween hair claw clip with black cat and witch hat prints on orange flower base - 8cm / Bright Orange Flower Cat Wizard Hat Style
Detail view of flower-shaped Halloween hair claw with pumpkin and skull prints - 8cm / Black Pumpkin Skull Star Style
+40
Halloween Hair Claw Clip UV Printed Plastic Pumpkin Ghost Bat Design Cartoon Festive Party Accessory For Women Jewelry
$0.37-0.49
No MOQ
 · 
10 views
Flower Hair Claw Clip Metallic Alloy Large Shark Grip For Thick Hair Women Minimalist Elegant Gold Silver Hair Styling
Flower Hair Claw Clip Metallic Alloy Large Shark Grip For Thick Hair Women Minimalist Elegant Gold Silver Hair Styling
like
Find Similar
Elegant gold flower metal claw clip hair accessory resting on a vintage book page - Gold
Elegant silver metal flower hair claw clip with mirror finish for hair styling - Silver
Flower Hair Claw Clip Metallic Alloy Large Shark Grip For Thick Hair Women Minimalist Elegant Gold Silver Hair Styling
$0.52
Mix MOQ : 2
 · 
52 sold recently
Handmade Grosgrain Ribbon Hair Bows For Toddler Girls Boutique Alligator Clips Colorful Hairpins For Babies Kids
Handmade Grosgrain Ribbon Hair Bows For Toddler Girls Boutique Alligator Clips Colorful Hairpins For Babies Kids
like
Find Similar
Classic dark blue grosgrain ribbon bow hair clip with textured fabric for kids - Dark Blue
Classic rose red grosgrain ribbon bow hair clip for girls with ribbed fabric texture - Rose Red
Neon green grosgrain ribbon bow hair clip for girls with a solid color cute design - Bright Green
Solid rose red grosgrain ribbon bow hair clip for toddlers and girls accessory - Rose Red
+33
Handmade Grosgrain Ribbon Hair Bows For Toddler Girls Boutique Alligator Clips Colorful Hairpins For Babies Kids
$0.10
No MOQ
 · 
18 sold recently
Floral Fabric Wrapped Snap Hair Clips Sweet Pastoral Daisy Pattern BB Clips For Girls Kids Hair Accessories
Floral Fabric Wrapped Snap Hair Clips Sweet Pastoral Daisy Pattern BB Clips For Girls Kids Hair Accessories
like
Find Similar
Sweet floral BB hair clip with blue and purple patterns and scalloped edge - 11-Blue Purple Floral
Floral print fabric BB hair clip in vintage dark green and grey floral patterns - 13-Dark Green Vintage Floral
Sweet floral snap clip with light grey fabric, green leaves, and white wavy lace edges - 17-Light Grey Leaf
Sweet floral pattern fabric hair clip for girls featuring colorful spring bloom designs - 21-Pink Yellow Green Floral
+4
Floral Fabric Wrapped Snap Hair Clips Sweet Pastoral Daisy Pattern BB Clips For Girls Kids Hair Accessories
$0.12
Mix MOQ : 10
 · 
262 sold recently
Fashion Acetate Wave Pattern Metal Hair Claw Clip Elegant Shiny Zigzag Shark Clip For Women Daily Styling Hair Accessory
Fashion Acetate Wave Pattern Metal Hair Claw Clip Elegant Shiny Zigzag Shark Clip For Women Daily Styling Hair Accessory
like
Find Similar
Detailed view of cream acetate hair claw with golden metal wavy design and texture - White
Detail view of pink acetate hair claw clip with golden metal teeth on spiral base - Pink
Close-up of stylish wavy acetate shark clip with durable gold metal inner teeth for hair - Light Coffee
Close-up of wavy brown acetate hair claw clip with golden metal teeth and spring mechanism - Brown
+1
NewFashion Acetate Wave Pattern Metal Hair Claw Clip Elegant Shiny Zigzag Shark Clip For Women Daily Styling Hair Accessory
$1.30
No MOQ
 · 
11 views
Tie Clip Alloy Enamel Round Initial Letter Rhinestone Business Formal Suit Accessories Men
Tie Clip Alloy Enamel Round Initial Letter Rhinestone Business Formal Suit Accessories Men
like
Find Similar
Business tie clip in gold finish with a black letter A charm and crystal border - Letter A
Golden tie clip with round black 'B' initial emblem and zircon inlay detail - Letter B
Elegant gold men's tie clip with letter C inside a crystal-encrusted black circle - Letter C
Golden round tie clip with letter D design and sparkling rhinestone border - Letter D
+22
Tie Clip Alloy Enamel Round Initial Letter Rhinestone Business Formal Suit Accessories Men
-18%
$0.90
No MOQ
 · 
15 views
Elegant Luxury Rhinestone Hair Clip Teardrop Crystal Duckbill Hairpin Shiny Side Barrettes For Women Girls Accessories
Elegant Luxury Rhinestone Hair Clip Teardrop Crystal Duckbill Hairpin Shiny Side Barrettes For Women Girls Accessories
like
Find Similar
Golden hair clip with champagne teardrop crystals on a natural stone surface - Gold Base Champagne
Elegant gold hair clip with two pink teardrop crystals shown on a stone background - Gold Base Rose Red
Detail of a golden metal hair clip with two faceted black teardrop crystals on stone - Gold Base Grey
Elegant gold bow hair clip featuring two sparkling crystal water drops on a stone base - Gold Base White
+6
Elegant Luxury Rhinestone Hair Clip Teardrop Crystal Duckbill Hairpin Shiny Side Barrettes For Women Girls Accessories
-5%
$0.52
Mix MOQ : 2
 · 
10 sold recently
Cute Soda Can Hair Claw Clips PVC Juice Bottle Shark Hair Clamps Creative Fruit Pattern Daily Hair Accessories For Women Girls
Cute Soda Can Hair Claw Clips PVC Juice Bottle Shark Hair Clamps Creative Fruit Pattern Daily Hair Accessories For Women Girls
like
Find Similar
Macro shot of blue orange juice can hair claw clip with glossy plastic finish - Blue Orange Can
Cute cherry soda can shaped hair claw clip with red cartoon design for daily styling - Red Cherry Can
Cute orange pineapple soda can claw clip hair accessory for daily styling and parties - Orange Pineapple Can
Large PVC hair claw clip featuring a unique purple beer can design for secure hairstyles - Purple Beer Can
+3
Cute Soda Can Hair Claw Clips PVC Juice Bottle Shark Hair Clamps Creative Fruit Pattern Daily Hair Accessories For Women Girls
$1.44
No MOQ
 · 
19 views
Matte Candy Color Metal Bobby Pins Korean Style Minimalist Hair Clips For Women Girls Side Bangs Barrettes
Matte Candy Color Metal Bobby Pins Korean Style Minimalist Hair Clips For Women Girls Side Bangs Barrettes
like
Find Similar
Macro shot of gradient green disposable micro brushes in clear zip lock packaging - Green
Close-up of matte pink gradient metal hair pins organized in a transparent PVC bag - Pink
Detail of matte orange hairpins neatly arranged in a clear pouch on a metal tray - Orange
Close-up of set of twelve yellow metal bobby pins in a clear plastic retail bag - Yellow
+3
Matte Candy Color Metal Bobby Pins Korean Style Minimalist Hair Clips For Women Girls Side Bangs Barrettes
-5%
$0.49
No MOQ
 · 
23 views
Sparkly Sequin Bow Hair Clip Large Butterfly Hairpin For Kids Girls Glitter Handmade Grosgrain Ribbon Headwear Accessory
Sparkly Sequin Bow Hair Clip Large Butterfly Hairpin For Kids Girls Glitter Handmade Grosgrain Ribbon Headwear Accessory
like
Find Similar
5-inch large bright red sequined hair bow clip for girls with shimmering fabric finish - Red
5-inch champagne gold sequin hair bow clip for girls with shimmering finish - Light Coffee
5-inch large rainbow gradient sequin hair bow clip for girls in pink base fabric - Rainbow
5-inch large bow hair clip featuring multicolor iridescent sequins and black ribbon lining - Black Multi-color
+11
Sparkly Sequin Bow Hair Clip Large Butterfly Hairpin For Kids Girls Glitter Handmade Grosgrain Ribbon Headwear Accessory
$0.75
No MOQ
 · 
49 views
Acetate Hair Claw Clips Small Marble Tortoiseshell Celluloid Hair Catch Strong Hold Non Slip Clamps Headwear Accessories Women
Acetate Hair Claw Clips Small Marble Tortoiseshell Celluloid Hair Catch Strong Hold Non Slip Clamps Headwear Accessories Women
like
Find Similar
Detailed view of acetate hair claw with black and white marble pattern on a magazine - Ink Pattern / 5.5cm / Gray
Detail of colorful marble pattern acetate hair claw clip with smooth polished finish - Colorful Marble / 5.5cm / Colorful
Acetate Hair Claw Clips Small Marble Tortoiseshell Celluloid Hair Catch Strong Hold Non Slip Clamps Headwear Accessories Women
-5%
$1.23
No MOQ
 · 
14 sold recently
Free Shipping
Mini Metal Hair Claws For Women Girls Alloy Geometric Flower Heart Bow Hollow Shark Hair Clips Accessories
Mini Metal Hair Claws For Women Girls Alloy Geometric Flower Heart Bow Hollow Shark Hair Clips Accessories
like
Find Similar
Exquisite small golden metal hair claw clip with a refined crown-shaped cutout design - Crown Gold
Polished silver metal hair claw clips set with butterfly and heart shapes for women - Silver 16Pcs Set
Set of 16 mini gold metal hair claws in 8 styles like hearts, flowers and crowns - Gold 16Pcs Set
Set of various minimalist gold metal hair claws in heart and floral shapes - Gold 14Pcs Set
+31
Mini Metal Hair Claws For Women Girls Alloy Geometric Flower Heart Bow Hollow Shark Hair Clips Accessories
-4%
$0.36-5.72
Mix MOQ : 2
 · 
13 views
Free Shipping
Handmade Kids Hair Bow Clip Grosgrain Ribbon Double Layer Streamer Solid Color Hair Accessories For Girls Babies
Handmade Kids Hair Bow Clip Grosgrain Ribbon Double Layer Streamer Solid Color Hair Accessories For Girls Babies
like
Find Similar
White grosgrain ribbon hair bow for children with double-layer polyester ribbon clip - White
Mint green handmade grosgrain ribbon hair bow with long streamers for girls - Light Green
Dark red double-layered grosgrain ribbon bow hair clip for children and babies - Burgundy
Handmade navy blue grosgrain ribbon hair bow clip with double layer streamers for girls - Dark Blue
+21
Handmade Kids Hair Bow Clip Grosgrain Ribbon Double Layer Streamer Solid Color Hair Accessories For Girls Babies
-5%
$0.18
Mix MOQ : 2
 · 
16 sold recently
Mini Wizard Hat Hair Clip Halloween Sequin Glitter Star Moon Pattern Witch Cosplay Costume Hair Accessory For Girls
Mini Wizard Hat Hair Clip Halloween Sequin Glitter Star Moon Pattern Witch Cosplay Costume Hair Accessory For Girls
like
Find Similar
Detail of a red glitter mini wizard hat hair clip with gold star and moon decorations - Red
Blue glitter wizard hat hair clip with gold moon and star patterns for kids - Blue
Detail view of a black glitter mini wizard hat hair clip with gold stars and moon - Black
Detail of glittery gold wizard hat hair clip with metallic star and moon ornaments - Gold
Mini Wizard Hat Hair Clip Halloween Sequin Glitter Star Moon Pattern Witch Cosplay Costume Hair Accessory For Girls
-4%
$0.60
No MOQ
 · 
16 sold recently
Watermelon Bow Hair Clips Grosgrain Ribbon Fruit Print Alligator Clips Cute Summer Hair Accessories For Girls Kids
Watermelon Bow Hair Clips Grosgrain Ribbon Fruit Print Alligator Clips Cute Summer Hair Accessories For Girls Kids
like
Find Similar
Detail of light green bow hair clip with watermelon fruit print and glitter knot center - Light Green Watermelon Slice Style
Detailed view of handmade bow hair clip with vibrant red and green watermelon print - Red Watermelon Slice Style
Close-up of a green watermelon striped bow hair clip with ribbed fabric texture - Watermelon Skin Green Stripe Style (4)
Close-up of grosgrain ribbon hair bow with vibrant red and green watermelon print - White Base Red Center Watermelon Print (5)
+2
Watermelon Bow Hair Clips Grosgrain Ribbon Fruit Print Alligator Clips Cute Summer Hair Accessories For Girls Kids
$0.26-2.59
Mix MOQ : 2
 · 
38 sold recently
Girls Sweet Bow Hair Clips And Hair Ties With Faux Artificial Pearl Star Striped Ribbon Handmade Princess Hair Accessories For Kids
Girls Sweet Bow Hair Clips And Hair Ties With Faux Artificial Pearl Star Striped Ribbon Handmade Princess Hair Accessories For Kids
like
Find Similar
Handmade rainbow striped bow hair clips set with faux pearls for kids and girls - Lavender Purple Hair Clip
Handmade striped bow hair clips with white faux pearls and star charms for girls - Anna Pink Hair Clip
Rainbow striped bow hair clips with pearl stars on handmade card, two-piece set for kids - Sky Blue Hair Clip
Detail of sweet purple bow hair clip with rainbow stripes and imitation pearl accents - Lavender Purple Hair Tie
+2
Girls Sweet Bow Hair Clips And Hair Ties With Faux Artificial Pearl Star Striped Ribbon Handmade Princess Hair Accessories For Kids
$1.05
No MOQ
Free Shipping
Butterfly Tassel Hair Clips Alloy Mesh Satin Ribbon Long Fringe Vintage Chinese Style Hair Accessories For Women
Butterfly Tassel Hair Clips Alloy Mesh Satin Ribbon Long Fringe Vintage Chinese Style Hair Accessories For Women
like
Find Similar
Handheld butterfly hair clip with colorful wings, pearl tassels, and golden metal finish - 12# Iridescent Purple Butterfly Hair Claw
Elegant butterfly hair clip with gold fringe, green gradient wings and pearl beads - 11# Iridescent Green Butterfly Hair Claw
Light green butterfly hair clip with long tassels and pearl accents for Hanfu styling - 15# Green Butterfly Tassel Hair Clip
Elegant gold butterfly tassel hairpins with sheer wings worn in a traditional hairstyle - 3# Butterfly Gauze Tassel Hair Clip - Right
+6
Butterfly Tassel Hair Clips Alloy Mesh Satin Ribbon Long Fringe Vintage Chinese Style Hair Accessories For Women
-5%
$0.60-4.52
No MOQ
 · 
35 views
Free Shipping
Mini Ghost Rabbit Hair Claw Clips Acrylic Halloween Cute Cartoon Hairpins Headwear For Women Girls
Mini Ghost Rabbit Hair Claw Clips Acrylic Halloween Cute Cartoon Hairpins Headwear For Women Girls
like
Find Similar
Cute white ghost hair clip with pink blush and smiling face for spooky hairstyles - Ghost Claw Clip / White Ghost
Mini black ghost hair clip in glossy finish, cute spooky accessory, 2.3cm by 2.3cm - Ghost Claw Clip / Black Ghost
Mini Ghost Rabbit Hair Claw Clips Acrylic Halloween Cute Cartoon Hairpins Headwear For Women Girls
-3%
$0.26
Mix MOQ : 2
 · 
192 sold recently
Christmas Hair Clips And Hair Ties Fabric Red Green Plaid Bow With Resin Santa Claus Bear Festive Hair Accessories For Girls
Christmas Hair Clips And Hair Ties Fabric Red Green Plaid Bow With Resin Santa Claus Bear Festive Hair Accessories For Girls
like
Find Similar
Christmas hair clip with red plaid bow and 3D Santa Claus figure for children - Santa Claus Bow Hair Clip (1pc)
Christmas bow hair clip featuring red and green plaid with cute Santa sock detail - Christmas Sock Bow Hair Clip (1pc)
Christmas hair clip with red plaid bow and cute 3D Santa bear ornament for girls - Bear Bow Hair Clip (1pc)
Detail of a Christmas hair clip featuring a red plaid bow and Santa Claus ornament - Santa Claus Bow Hair Tie (1pc)
+11
Christmas Hair Clips And Hair Ties Fabric Red Green Plaid Bow With Resin Santa Claus Bear Festive Hair Accessories For Girls
-5%
$0.44-0.99
Mix MOQ : 2
 · 
117 sold recently
Free Shipping
Cute Cloud Hair Claw Clips Acetate Artificial Pearl Texture Cartoon Weather Rainbow Sun Raindrop Smile Face Daily Accessories For Women
Cute Cloud Hair Claw Clips Acetate Artificial Pearl Texture Cartoon Weather Rainbow Sun Raindrop Smile Face Daily Accessories For Women
like
Find Similar
Cloud hair claw clip in pearlescent white with rainbow and smiley face accents - Rainbow Cloud
8cm pearl white cloud hair claw clip with smiling face and yellow sun decoration - Sun Cloud
Cartoon white cloud hair claw clip with blue raindrops and a smiling face pattern - Raindrop Cloud
Cute Cloud Hair Claw Clips Acetate Artificial Pearl Texture Cartoon Weather Rainbow Sun Raindrop Smile Face Daily Accessories For Women
$0.92
Mix MOQ : 2
 · 
48 sold recently
Velvet Bow Hair Clip Hair Tie Faux Artificial Pearl Elegant Cream White Vintage Style Hair Accessories For Women Girls
Velvet Bow Hair Clip Hair Tie Faux Artificial Pearl Elegant Cream White Vintage Style Hair Accessories For Women Girls
like
Find Similar
Detail of cream velvet bow hair clip with large white pearl on minimalist elastic band - Hair Tie
Detail of a creamy white velvet bow hair clip with a gold-rimmed pearl accent - Pearl Bowknot Style
Detailed view of cream velvet bow hair clip with pearl and golden metal accents - Hair Bow
Beige velvet hair clip with pearl flower and rose relief in elegant cream gold finish - Pearl Flower Hair Clip
Velvet Bow Hair Clip Hair Tie Faux Artificial Pearl Elegant Cream White Vintage Style Hair Accessories For Women Girls
$0.63-1.67
No MOQ
 · 
10 sold recently
Free Shipping
Kids Chiffon Fabric Flower Hair Clips Rose Camellia Shape Duckbill Iron Clip Girls Boutique Headwear Pretty
Kids Chiffon Fabric Flower Hair Clips Rose Camellia Shape Duckbill Iron Clip Girls Boutique Headwear Pretty
like
Find Similar
Detailed macro view of vibrant light green chiffon rose hair clip with layered petals - Bright Green (A+Metal Clip)
Close-up showing the fiber texture and layered petals of a dark purple chiffon flower clip - Purple (C+Metal Clip)
Close-up of a light purple multilayered chiffon flower hair clip with realistic petals - Light Purple (I+Metal Clip)
Detailed top view of a multilayered navy blue chiffon fabric flower hair clip accessory - Navy Blue (N+Metal Clip)
+16
Kids Chiffon Fabric Flower Hair Clips Rose Camellia Shape Duckbill Iron Clip Girls Boutique Headwear Pretty
-5%
$0.37
Mix MOQ : 2
 · 
23 views
Butterfly Hair Clips Fairy Mesh Gauze Wings With Faux Artificial Pearl Alloy Duckbill Clips Gradient Wedding Accessories For Women
Butterfly Hair Clips Fairy Mesh Gauze Wings With Faux Artificial Pearl Alloy Duckbill Clips Gradient Wedding Accessories For Women
like
Find Similar
Pink gradient tulle butterfly hair clip with faux pearls and silver metal clip - 3# Large Korean Pink 1PC
Elegant gradient pink to purple butterfly hair clip with faux pearl on a card - 5# Large Pink Purple 1PC
Elegant butterfly hair clip with green yellow purple gradient tulle and pearls - 7# Large Yellow Green 1PC
Fairy-style purple and blue gradient tulle butterfly hair clip with white pearls - 8# Large Purple Blue 1PC
+5
Butterfly Hair Clips Fairy Mesh Gauze Wings With Faux Artificial Pearl Alloy Duckbill Clips Gradient Wedding Accessories For Women
$0.21-0.67
No MOQ
 · 
34 views
Go to

More in accessories

Explore more in clips

clawsharkartificialshapehandmadedesigncolorswirepearl hairshark clips
stylealloyhairpinheartsolidlongtasselbangspartyplastic hair claw

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access