Everful

Wholesale clips

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Clips

Find the perfect pieces: hair claws, hair clips, hair bands & headbands and more

All products in clips

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Vintage Earrings With Silver Earring Post French Court Style Baroque Geometric Floral Faux Artificial Pearl Copper Alloy Jewelry For Women
Vintage Earrings With Silver Earring Post French Court Style Baroque Geometric Floral Faux Artificial Pearl Copper Alloy Jewelry For Women
like
Find Similar
Vintage-style red flower stud earrings with golden metallic accents and detailed petals - 59# Silver Earring Post Red Vintage Enamel Flower Earrings
Macro view of vintage crown earrings with green oval gemstone and small pearls - Emerald Glaze Crown Pearl Studs (S925 Pin)
Vintage French baroque earrings in gold with rose red oval gemstones and crystals - Silver Pin Vintage Rhinestone Pattern Oval Earrings
Macro detail of vintage square earrings with pink resin, gold foil and green gems inlay - Resin Eternal Flower Square Rhinestone Studs (S925 Pin)
+135
Vintage Earrings With Silver Earring Post French Court Style Baroque Geometric Floral Faux Artificial Pearl Copper Alloy Jewelry For Women
$0.72-3.09
No MOQ
Free Shipping
Gold Plated Heart Hoop Earrings With Flower Shell Cubic Zirconia Vintage French Style Women Steel Earring Post
Gold Plated Heart Hoop Earrings With Flower Shell Cubic Zirconia Vintage French Style Women Steel Earring Post
like
Find Similar
Gold plated heart hoop earrings with white shell flowers and zircons in a jewelry box - Ear Clip - Gold (Real Gold Plated)
NewGold Plated Heart Hoop Earrings With Flower Shell Cubic Zirconia Vintage French Style Women Steel Earring Post
$2.09
No MOQ
Free Shipping
Artificial Bird Ornaments Glitter Foam Birds With Natural Feathers And Beads For Christmas Tree Wedding Home Decoration Elegant
Artificial Bird Ornaments Glitter Foam Birds With Natural Feathers And Beads For Christmas Tree Wedding Home Decoration Elegant
like
Find Similar
Glittery blue peacock Christmas ornament with real feathers and beads, size 32.5cm - Oversized Peacock Bird
Set of two white feathered artificial birds with silver glitter for Christmas tree decor - White Gold-leaf Bird Pair
Pair of champagne gold feather bird Christmas tree decorations with glitter, 20cm long - Gold Gold-leaf Bird Pair
Set of two pink glitter Christmas artificial feather birds with 20x9cm size markers - Pink Gold-leaf Bird Pair
+4
Artificial Bird Ornaments Glitter Foam Birds With Natural Feathers And Beads For Christmas Tree Wedding Home Decoration Elegant
$3.05-5.71
No MOQ
Free Shipping
Gingerbread Man Miniature Resin Charms For Christmas DIY Craft Phone Case Decor Dollhouse Miniature Food Play Accessories
Gingerbread Man Miniature Resin Charms For Christmas DIY Craft Phone Case Decor Dollhouse Miniature Food Play Accessories
like
Find Similar
Miniature resin gingerbread man DIY craft accessory in beige finish, 15x14mm size - Beige
Brown resin Christmas gingerbread man miniature diy accessory measuring 15mm by 14mm - Brown
Pink resin gingerbread man DIY charm for dollhouse miniatures, size 15x14mm - Pink
Miniature light green resin gingerbread man accessory for DIY crafts 15x14mm size - Green
Gingerbread Man Miniature Resin Charms For Christmas DIY Craft Phone Case Decor Dollhouse Miniature Food Play Accessories
$0.05
Mix MOQ : 10
 · 
80 sold recently
Christmas Hanging Ornaments Plush Santa Snowman Reindeer Bear Dolls Tree Decoration Holiday Party Cartoon Dancing Style
Christmas Hanging Ornaments Plush Santa Snowman Reindeer Bear Dolls Tree Decoration Holiday Party Cartoon Dancing Style
like
Find Similar
Hanging plush Santa Claus ornament with red hat and checkered details for Christmas trees - Santa Claus
Detail of plush Christmas snowman hanging ornament with red plaid hat and gold string - Snowman
Charming gingerbread plush ornament with green outfit and reindeer hat for Christmas trees - Elk
Detailed view of plush Christmas bear ornament with festive green outfit and red heart accents - Bear
Christmas Hanging Ornaments Plush Santa Snowman Reindeer Bear Dolls Tree Decoration Holiday Party Cartoon Dancing Style
$0.69
No MOQ
Christmas Resin Flatback Charms Cute Cartoon Santa Snowman Tree Cat Wreath For DIY Crafts Jewelry Making Hair Accessories
Christmas Resin Flatback Charms Cute Cartoon Santa Snowman Tree Cat Wreath For DIY Crafts Jewelry Making Hair Accessories
like
Find Similar
Cartoon Santa Claus resin accessory for DIY hair clips, 25mm by 20mm size and 2.6g weight - Santa Claus / Santa Claus
Miniature resin snowman charm in white and light blue, measuring 30mm by 18mm - Snowman / Snowman
DIY Christmas resin wreath charm with white cat and star motif for jewelry making - Cat in Wreath / Cat in Wreath
Yellow star resin charm with red Christmas hat and smiley face for DIY accessories - Star with Hat / Star with Hat
+3
Christmas Resin Flatback Charms Cute Cartoon Santa Snowman Tree Cat Wreath For DIY Crafts Jewelry Making Hair Accessories
$0.05
No MOQ
 · 
359 sold recently
Vintage Baroque Stud Earrings Alloy Floral Heart Faux Artificial Pearl Rhinestone With 925 Sterling Silver Earring Post
Vintage Baroque Stud Earrings Alloy Floral Heart Faux Artificial Pearl Rhinestone With 925 Sterling Silver Earring Post
like
Find Similar
Vintage style round earrings with colorful rhinestones and emerald green crystals - 1# Ear Clip - Multicolor
Macro view of vintage gold-trimmed oval earrings with green iridescent stones - 14# Silver Pin - Green Oval
Vintage Baroque Stud Earrings Alloy Floral Heart Faux Artificial Pearl Rhinestone With 925 Sterling Silver Earring Post
$1.18-3.54
No MOQ
 · 
43 views
Free Shipping
Vintage Enamel Earrings Heart Flower Geometric Pattern With 925 Sterling Silver Earring Post Retro French Style Women
Vintage Enamel Earrings Heart Flower Geometric Pattern With 925 Sterling Silver Earring Post Retro French Style Women
like
Find Similar
Detailed view of vintage enamel heart earrings showing precise 4.4cm height dimensions - Red Heart and Oval Gemstone Style (2-25683B-5800)
Vintage gold-tone heart and oval earrings with brown enamel and beaded edges - Brown Heart and Oval Gemstone Style (2-25683C-5800)
Macro detail of red enamel round earrings with gold floral motif on vintage paper - Red Enamel Round Flower Style (E4-20472C-6500)
Macro shot of vintage round enamel earrings with blue floral patterns on brown fabric - Brown Base Blue Flower Style (E4-20472D-6500)
+3
Vintage Enamel Earrings Heart Flower Geometric Pattern With 925 Sterling Silver Earring Post Retro French Style Women
-4%
$4.90-6.12
No MOQ
Free Shipping
Vintage French Style Artificial Pearl Shell Stud Earrings Alloy With Silver Earring Post Elegant Jewelry For Women
Vintage French Style Artificial Pearl Shell Stud Earrings Alloy With Silver Earring Post Elegant Jewelry For Women
like
Find Similar
Vintage gold shell pearl earrings with textured metal finish on luxury velvet box - Gold Shell Pearl (1#)
Vintage style rose shaped stud earrings with golden flower and silver leaves details - Yellow Rose Style (3#)
Abstract curved silver metal stud earrings in a water drop shape on a dark wood background - Silver Twisted Drop (5#)
Modern mixed-metal chain link earrings in polished gold and silver finish - Gold Silver Chain Hoop (10#)
+7
Vintage French Style Artificial Pearl Shell Stud Earrings Alloy With Silver Earring Post Elegant Jewelry For Women
$1.11-2.88
No MOQ
 · 
12 views
Free Shipping
Crochet Christmas Ornaments Knitted Wool Mini Hanging Pendant For DIY Craft Festive Holiday Tree Decoration Handmade Cute Accessories
Crochet Christmas Ornaments Knitted Wool Mini Hanging Pendant For DIY Craft Festive Holiday Tree Decoration Handmade Cute Accessories
like
Find Similar
Handmade red and white crochet Christmas wreath with a red bow, 9.5cm outer diameter - Red Wreath
Handmade knitted Christmas wreath ornament with red bow, 9.5cm outer diameter - Green Wreath
Handmade red crochet cherries accessory with green leaves for Christmas DIY decor - Cherry
Handmade yellow crochet bow knit ornament for DIY Christmas crafts decoration, 6.5cm size - Ginger Bow
+18
Crochet Christmas Ornaments Knitted Wool Mini Hanging Pendant For DIY Craft Festive Holiday Tree Decoration Handmade Cute Accessories
$0.23-2.59
Mix MOQ : 5
 · 
13 views
Free Shipping
Resin Christmas Cabochons DIY Accessories Iridescent Santa Snowman Reindeer Crafts For Hairclip Phone Case Decoration
Resin Christmas Cabochons DIY Accessories Iridescent Santa Snowman Reindeer Crafts For Hairclip Phone Case Decoration
like
Find Similar
Set of 3 iridescent Christmas bear resin charms with red and green scarf details - Bear with Scarf
Three pieces of pearlescent resin glove-shaped DIY charms with stars and smiley patterns - Gloves
Three-piece set of iridescent pearl resin reindeer charms for DIY Christmas hair clips - Reindeer Sign
Red resin gift box DIY charm for Christmas hair clips with 24mm size and star detail - Gift Box
+6
Resin Christmas Cabochons DIY Accessories Iridescent Santa Snowman Reindeer Crafts For Hairclip Phone Case Decoration
$0.15
No MOQ
Vintage Court Style Drop Earrings Gold Plated Alloy Emerald Green Gemstone Rhinestone With Silver Earring Post
Vintage Court Style Drop Earrings Gold Plated Alloy Emerald Green Gemstone Rhinestone With Silver Earring Post
like
Find Similar
Detail of vintage golden earrings with green gemstones and white rhinestone accents - Ear Clip - Gold Green
Detail showing vintage gold earrings with emerald green oval stone and sparkling rhinestones - Silver Needle - Gold Green
Vintage Court Style Drop Earrings Gold Plated Alloy Emerald Green Gemstone Rhinestone With Silver Earring Post
$1.83-2.36
No MOQ
Christmas Micro Landscape Mini Resin Figures DIY Craft Accessories For Holiday Decor Train Snowman Reindeer Charms
Christmas Micro Landscape Mini Resin Figures DIY Craft Accessories For Holiday Decor Train Snowman Reindeer Charms
like
Find Similar
Miniature red Christmas house resin charm with snow top for DIY crafts, 40x27x29mm size - 3D Christmas Train-Carriage
Cute resin snowman figurine with red hat for DIY crafts, size 40x35x34mm and 24.4g weight - 3D Christmas Train-Backpack Snowman
Miniature red Christmas sleigh resin accessory with gold glitter, size 40x26x21mm - 3D Christmas Train-Sleigh
Christmas cat resin charm with red suit and sled for DIY crafts and decor, 29mm size - 3D Christmas Train-Rabbit Sleigh
+5
Christmas Micro Landscape Mini Resin Figures DIY Craft Accessories For Holiday Decor Train Snowman Reindeer Charms
$0.12-0.59
No MOQ
 · 
15 views
Free Shipping
Vintage French Style Earrings For Women With Enamel Rhinestone Artificial Pearl And Silver Earring Post Elegant Palace Jewelry
Vintage French Style Earrings For Women With Enamel Rhinestone Artificial Pearl And Silver Earring Post Elegant Palace Jewelry
like
Find Similar
Vintage-style red flower stud earrings with golden metallic accents and detailed petals - Vintage Red Enamel Flower Earrings(59#)
Macro shot of vintage gold earrings with geometric blue and clear crystal drop pendants - Vintage Water Drop Earrings(29#)
Close-up of vintage pearl earrings with gold spiral base on a navy velvet box - Matte Gold Pearl Wrapped Striped Earrings(18#)
Vintage gold hoop earrings featuring black enamel sunburst and Greek key pattern - Vintage Medusa Pattern Enamel C-Shaped Ear Buckle
+121
Vintage French Style Earrings For Women With Enamel Rhinestone Artificial Pearl And Silver Earring Post Elegant Palace Jewelry
$0.72-3.09
No MOQ
Free Shipping
Grape Drop Earrings With Purple Beads Alloy Rhinestone Leaf Vintage French Style For Women Silver Earring Post
Grape Drop Earrings With Purple Beads Alloy Rhinestone Leaf Vintage French Style For Women Silver Earring Post
like
Find Similar
Close-up of vintage purple beaded grape earrings with gold rhinestone leaves - S925 Silver Needle Style (Gold/Purple)
Detailed close-up of French vintage grape earrings with purple beads and crystal gold leaves - Clip-on Style (Gold/Purple)
Grape Drop Earrings With Purple Beads Alloy Rhinestone Leaf Vintage French Style For Women Silver Earring Post
$2.88-3.93
No MOQ
 · 
35 views
Free Shipping
Vintage Earrings For Women French Retro Floral Enamel Jewelry Alloy With Faux Artificial Pearl Rhinestone Stainless Steel Post
Vintage Earrings For Women French Retro Floral Enamel Jewelry Alloy With Faux Artificial Pearl Rhinestone Stainless Steel Post
like
Find Similar
Vintage gold earrings with dark blue oval gemstones and pearls in fan-shaped design - 1# Silver Earring Post Blue Diamond Pearl Oval Drop Earrings
Vintage gold studs with purple center stone and colorful crystals on jewelry box liner - 2# Silver Needle Rhinestone Square Studs
Macro detail of vintage floral earrings with dark red gemstone on beige linen background - 10# Silver Earring Post Enamel Flower Oval Earrings
Vintage gold butterfly stud earrings with purple enamel inlay on white ceramic dish - 13# Silver Earring Post Round Butterfly Enamel Stud Earrings
+143
Vintage Earrings For Women French Retro Floral Enamel Jewelry Alloy With Faux Artificial Pearl Rhinestone Stainless Steel Post
$0.72-3.09
No MOQ
 · 
11 views
Free Shipping
Vintage Retro Earrings For Women Court Style Elegant Jewelry With Silver Earring Post Copper Alloy Enamel Artificial Pearl Rhinestone
Vintage Retro Earrings For Women Court Style Elegant Jewelry With Silver Earring Post Copper Alloy Enamel Artificial Pearl Rhinestone
like
Find Similar
Vintage round blue enamel earrings with pink rose pattern in a wooden jewelry box - Silver Pin Drip Oil Rose Flower Earrings
Vintage gold-plated floral earrings with white mother of pearl discs and tassel design - Silver Pin Hollow Circle Round Earrings
Vintage floral stud earrings with emerald green center stone in a luxury jewelry box - Silver Earring Post Vintage Retro Green Earrings
Vintage black and gold round earrings featuring an intricate gold butterfly design - Silver Pin Butterfly Circle Stud Earrings
+62
Vintage Retro Earrings For Women Court Style Elegant Jewelry With Silver Earring Post Copper Alloy Enamel Artificial Pearl Rhinestone
$0.78-3.25
No MOQ
 · 
88 sold recently
Free Shipping
Vintage Alloy Zirconia Artificial Pearl Jewelry Set Luxurious Necklace Earrings Bracelet For Women Anniversary Party Accessory
Vintage Alloy Zirconia Artificial Pearl Jewelry Set Luxurious Necklace Earrings Bracelet For Women Anniversary Party Accessory
like
Find Similar
Elegant multi-layer pearl necklace with a large crystal centerpiece and zircon detailing - 5-Layer Vintage Artificial Pearl Necklace (1#) / Pearl 6mm / Silver
Detailed macro shot of vintage-style silver earrings with shimmering marquise zircons. - Vintage Large Zirconia Stud Earrings (2#) / Silver Needle / Silver
Vintage-style gold necklace with turquoise and pearls on a wooden display tray - Turquoise & Artificial Pearl Alternating Necklace (3#) / Gold/Blue
Vintage gold earrings with faux pearl and turquoise gemstone in an ornate wooden frame - Vintage Artificial Pearl & Turquoise Earring Post (4#) / Silver Needle / Gold/Blue
+30
Vintage Alloy Zirconia Artificial Pearl Jewelry Set Luxurious Necklace Earrings Bracelet For Women Anniversary Party Accessory
$2.20-14.80
No MOQ
 · 
59 sold recently
Free Shipping
Christmas Gift Box Miniature Resin Ornaments DIY Crafting Accessories Desktop Decor Micro Landscape Cute Festive Decor
Christmas Gift Box Miniature Resin Ornaments DIY Crafting Accessories Desktop Decor Micro Landscape Cute Festive Decor
like
Find Similar
Miniature white Christmas resin gift box with gold ribbon bow decoration and size labels - No. 1 White Gold Gift Box
Miniature yellow Christmas resin gift box with red bow, size 18x22mm for DIY decor - No. 2 Yellow Gift Box
Red resin Christmas gift box ornament with gold bow and dots, 18mm by 23mm size - No. 3 Red Gold Gift Box
Miniature resin Christmas gift box decoration with red bow and glitter details - No. 4 Double Layer Gift Box With Glitter
+1
Christmas Gift Box Miniature Resin Ornaments DIY Crafting Accessories Desktop Decor Micro Landscape Cute Festive Decor
$0.18-0.24
Mix MOQ : 10
 · 
70 sold recently
Knitted Texture Mitten Charms Resin Macaron Colors DIY Jewelry Making Decoration Phone Case Hair Accessories Christmas
Knitted Texture Mitten Charms Resin Macaron Colors DIY Jewelry Making Decoration Phone Case Hair Accessories Christmas
like
Find Similar
Macro detail of mini resin mittens with knitted texture in pastel colors for DIY crafts - Mixed Pack
Pink resin knitted glove charm for DIY phone chain crafts, size 23mm x 26mm - Pink
Miniature bright yellow resin glove charm with knitted texture and size dimensions - Yellow
Miniature purple knitted texture resin glove charm for DIY jewelry, size 23mm x 26mm - Purple
+1
Knitted Texture Mitten Charms Resin Macaron Colors DIY Jewelry Making Decoration Phone Case Hair Accessories Christmas
$0.10
Mix MOQ : 10
Merry Christmas Banner Garland Plaid Burlap Linen Stocking Glove Tree Hanging Decoration For Fireplace Wall Home
Merry Christmas Banner Garland Plaid Burlap Linen Stocking Glove Tree Hanging Decoration For Fireplace Wall Home
like
Find Similar
Christmas bunting with red plaid and burlap gloves hanging on a cozy white fireplace - Glove Shape
Merry Christmas banner with red buffalo plaid burlap trees over a cozy fireplace - Christmas Tree Shape
Merry Christmas banner with mini red plaid socks hanging on a rustic white fireplace - Christmas Boot Shape
Merry Christmas Banner Garland Plaid Burlap Linen Stocking Glove Tree Hanging Decoration For Fireplace Wall Home
-5%
$3.78
No MOQ
Christmas Bird Animal Hanging Ornaments Glitter Plastic Feather Sparkling Tree Decoration Holiday Party Accessory
Christmas Bird Animal Hanging Ornaments Glitter Plastic Feather Sparkling Tree Decoration Holiday Party Accessory
like
Find Similar
Set of 6 decorative 9cm swan ornaments with gold crowns and glitter for Christmas tree - 9cm / Set 01 (6Pcs Swan Pendants)
Set of two white polar bear Christmas ornaments with yellow fur detail and rustic jute rope - 10cm / Set 02 (2Pcs Polar Bear Pendants)
Champagne gold fish Christmas ornament with sequins and beads, 10cm tree hanging decor - 10cm / Set 03 (2Pcs Fish Pendants)
Christmas owl ornaments set in champagne gold and bronze with glitter and feathers - 8-12cm / Set 04 (4Pcs Owl Pendants)
+31
Christmas Bird Animal Hanging Ornaments Glitter Plastic Feather Sparkling Tree Decoration Holiday Party Accessory
$5.97-55.68
Mix MOQ : 5
 · 
17 views
Free Shipping
Vintage Stud Earrings Copper Jewelry With Silver Earring Post Artificial Baroque Pearl Enamel Rhinestone Geometric For Women
Vintage Stud Earrings Copper Jewelry With Silver Earring Post Artificial Baroque Pearl Enamel Rhinestone Geometric For Women
like
Find Similar
Detail of vintage gold earrings with green marquise stones and drop pearls on silk - 6# S925 Silver Pin Crisscross Water Drop Rhinestone Studs
Vintage geometric gold earrings with black square inlays on red velvet fabric - 9# S925 Silver Pin Square Enamel Studs
Detail of gold earrings featuring elegant white pearls and red oval gemstones on beige lining - 12# S925 Silver Pin Pearl Resin Oval Studs
Detail of vintage gold round stud earrings with red agate center and faux diamond halo - 36# S925 Silver Pin Rhinestone Agate Round Studs
+15
Vintage Stud Earrings Copper Jewelry With Silver Earring Post Artificial Baroque Pearl Enamel Rhinestone Geometric For Women
$0.76-1.41
No MOQ
 · 
18 sold recently
Free Shipping
Vintage Alloy Stud Earrings With Silver Earring Post Faux Artificial Pearl Rhinestone Geometric For Women Elegant Gift
Vintage Alloy Stud Earrings With Silver Earring Post Faux Artificial Pearl Rhinestone Geometric For Women Elegant Gift
like
Find Similar
Detail of vintage gold round stud earrings with red agate center and faux diamond halo - 36# S925 Silver Pin Rhinestone Agate Round Studs
Detail of vintage gold earrings with green marquise stones and drop pearls on silk - 6# S925 Silver Pin Crisscross Water Drop Rhinestone Studs
Vintage geometric gold earrings with black square inlays on red velvet fabric - 9# S925 Silver Pin Square Enamel Studs
Detail of gold earrings featuring elegant white pearls and red oval gemstones on beige lining - 12# S925 Silver Pin Pearl Resin Oval Studs
+15
Vintage Alloy Stud Earrings With Silver Earring Post Faux Artificial Pearl Rhinestone Geometric For Women Elegant Gift
$0.76-1.41
No MOQ
 · 
13 sold recently
Free Shipping
Vintage Geometric Enamel Stud Earrings With 925 Sterling Silver Earring Post Hollow Alloy Jewelry Gift For Women
Vintage Geometric Enamel Stud Earrings With 925 Sterling Silver Earring Post Hollow Alloy Jewelry Gift For Women
like
Find Similar
Detailed shot of French pearl heart flower earrings on white ceramic tray - No.4 Ear Clip - White
Chic green heart earrings with marble texture and gold trim for women's fashion - No.6 Silver Pin - Green Heart
Detail of cream white heart earrings with pearl marble texture held in hand for size - No.7 Silver Pin - Cream White Heart
Exaggerated green heart earrings with irregular texture and gold metallic borders - No.8 Silver Pin - Mustard Green Heart
Vintage Geometric Enamel Stud Earrings With 925 Sterling Silver Earring Post Hollow Alloy Jewelry Gift For Women
$1.44
No MOQ
 · 
13 views
Free Shipping
Vintage Copper Earrings With Silver Earring Post Faux Artificial Pearl Floral Geometric Palace Style For Women
Vintage Copper Earrings With Silver Earring Post Faux Artificial Pearl Floral Geometric Palace Style For Women
like
Find Similar
French vintage style gold plated pearl stud earrings with textured spiral design - Gold Alloy Spiral Radial Pearl / 15# Silver Pin - Wrap Pearl Earrings
Elegant gold triangle stud earrings with white opal inlay and polished metal finish - Modern Minimalist Cross Triangle Insert / 20# Silver Pin - Gold Cross Triangle
Macro shot of vintage style pearl earring with gold frame on brown velvet texture - Pearl Circle with Gold Base / 21# Silver Pin - Pearl Circle Stud Earrings
Elegant 12mm white high-luster pearl stud earrings shown on a female model's ear - Large White Round Pearl Studs / 8mm / 23# Silver - 8mm
+8
Vintage Copper Earrings With Silver Earring Post Faux Artificial Pearl Floral Geometric Palace Style For Women
$0.89-1.31
No MOQ
 · 
85 sold recently
Free Shipping
Vintage Baroque Earrings With Silver Earring Post Crystal Rhinestone Palace Style Water Drop Geometric Jewelry For Women
Vintage Baroque Earrings With Silver Earring Post Crystal Rhinestone Palace Style Water Drop Geometric Jewelry For Women
like
Find Similar
Close-up of vintage gold earrings with blue crystals in a luxury wooden jewelry box - Vintage Blue Clip-on Style (Clip-on - Blue)
Detailed close-up of vintage gold earrings with blue crystals in a velvet jewelry box - Vintage Blue Silver Pin Style (Silver Pin - Blue)
Detail of vintage sun and moon asymmetric earrings with blue enamel and gold finish - Asymmetric Sun Moon Drip Oil Style (Silver Pin Drip Oil Heart Earrings)
Macro shot of vintage gold earrings with geometric blue and clear crystal drop pendants - Geometric Splicing Rhinestone Style (Silver Pin Rhinestone Circle Square Drop Earrings)
Vintage Baroque Earrings With Silver Earring Post Crystal Rhinestone Palace Style Water Drop Geometric Jewelry For Women
$1.44-2.46
No MOQ
 · 
123 sold recently
Free Shipping
Vintage Palace Style Hollow Flower Drop Earrings With Resin Beads Blue Crystals And Silver Earring Posts For Women
Vintage Palace Style Hollow Flower Drop Earrings With Resin Beads Blue Crystals And Silver Earring Posts For Women
like
Find Similar
Detail of vintage flower-shaped hollow gold earrings with blue beads in a gift box - 1# Cyan Vintage Tassel Ear Clips (HE12368)
Vintage green crystal earrings with floral silver metalwork and beaded dangles - 3# Round Inlaid Triangle Tassel Ear Clips (HE12368)
Vintage gold leaf earrings with green marquise crystals displayed on a golden tray - 5# Silver Pin Inlaid Branch Tassel Studs (HE12368)
Detailed shot of vintage gold earrings with green carving and red teardrop gems - 6# Silver Pin Square Glass Oval Inlaid Studs (HE12368)
+3
Vintage Palace Style Hollow Flower Drop Earrings With Resin Beads Blue Crystals And Silver Earring Posts For Women
$1.55-7.99
No MOQ
 · 
59 views
Free Shipping
Christmas Artificial Berry Napkin Ring Silver White Berries Fabric Leaves Decorative Candle Ring Desktop Ornament
Christmas Artificial Berry Napkin Ring Silver White Berries Fabric Leaves Decorative Candle Ring Desktop Ornament
like
Find Similar
Silver and white berry napkin ring decoration for Christmas tables, 12cm outer diameter - Silver
Christmas Artificial Berry Napkin Ring Silver White Berries Fabric Leaves Decorative Candle Ring Desktop Ornament
$0.52
Mix MOQ : 10
Vintage Earrings Retro Baroque Jewelry Copper With Silver Earring Post Enamel Artificial Pearl Flower French Luxury Design Elegant Gift
Vintage Earrings Retro Baroque Jewelry Copper With Silver Earring Post Enamel Artificial Pearl Flower French Luxury Design Elegant Gift
like
Find Similar
Detail of vintage gold earrings with oval red gems and white pearls on velvet - Oval Ruby Pearl Gold Relief Style
Vintage green enamel and gold finish oval stud earrings with textured scale pattern - Green Gold Scale Pattern Oval Style
Vintage gold earrings featuring blue enamel flowers and elegant large yellow pearls - Blue Enamel Flower Yellow Pearl Style
Close-up of vintage golden twisted hoop earrings with white enamel detail on velvet - Gold Twisted Ring White Glazed Style
+134
Vintage Earrings Retro Baroque Jewelry Copper With Silver Earring Post Enamel Artificial Pearl Flower French Luxury Design Elegant Gift
$0.72-3.09
No MOQ
 · 
30 sold recently
Free Shipping
Artificial Christmas Poinsettia Flower Glitter Sparkling Fabric Festive Tree Ornament Party Decor Holiday Arrangement
Artificial Christmas Poinsettia Flower Glitter Sparkling Fabric Festive Tree Ornament Party Decor Holiday Arrangement
like
Find Similar
Golden 13cm sparkling sequin poinsettia flower for Christmas tree and wreath decoration - Gold
13CM sequined silver artificial poinsettia flower for Christmas wreath decoration - Silver
Artificial Christmas Poinsettia Flower Glitter Sparkling Fabric Festive Tree Ornament Party Decor Holiday Arrangement
$0.52
No MOQ
Christmas Slap Bracelets LED Glowing Luminous Sequin Fabric Plush Cartoon Santa Snowman Reindeer Holiday Party Props
Christmas Slap Bracelets LED Glowing Luminous Sequin Fabric Plush Cartoon Santa Snowman Reindeer Holiday Party Props
like
Find Similar
Luminous Santa Claus Christmas snap bracelet in red velvet with LED light effects - Light-up / Red Santa Claus
Pink glowing Christmas slap bracelet with sequined snowman and size measurements - Light-up / Pink Snowman
Christmas reindeer snap bracelet with green glitter band and glowing LED nose detail - Light-up / Green Reindeer
LED Christmas slap bracelet with blue sequins and plush polar bear, 21cm size - Light-up / Blue Bear Style
Christmas Slap Bracelets LED Glowing Luminous Sequin Fabric Plush Cartoon Santa Snowman Reindeer Holiday Party Props
$0.89
No MOQ
Christmas LED Light Up Slap Bracelet Velvet Santa Snowman Reindeer Cartoon Pattern Holiday Party Favors For Kids Adults
Christmas LED Light Up Slap Bracelet Velvet Santa Snowman Reindeer Cartoon Pattern Holiday Party Favors For Kids Adults
like
Find Similar
Luminous Santa Claus slap bracelet in red velvet with LED lights for Christmas decor - Deer
Luminous red Santa slap bracelet with LED light and soft plush fabric for Christmas decor - Snowman
LED Santa Claus Christmas snap bracelet in red plush fabric on festive wooden desk - Santa Claus
LED Christmas slap bracelet featuring plush Santa Claus on a festive wooden background - Bear Style
Christmas LED Light Up Slap Bracelet Velvet Santa Snowman Reindeer Cartoon Pattern Holiday Party Favors For Kids Adults
$0.61
Mix MOQ : 2
LED Christmas Slap Bracelets Glowing Sequin Wristbands Plush Santa Snowman Reindeer Party Favors Kids Holiday Gifts
LED Christmas Slap Bracelets Glowing Sequin Wristbands Plush Santa Snowman Reindeer Party Favors Kids Holiday Gifts
like
Find Similar
Detail of Christmas reindeer slap bracelet with green sequins and plush antlers - Deer / Green
Detail of pink sequin Christmas slap bracelet with plush snowman on vintage books - Snowman / Pink
Detailed close-up of a Christmas slap bracelet with red sequins and Santa Claus on a book - Santa Claus / Red
Close-up of blue sequin Christmas slap bracelet with a plush white bear ornament - Bear Style / Blue
LED Christmas Slap Bracelets Glowing Sequin Wristbands Plush Santa Snowman Reindeer Party Favors Kids Holiday Gifts
-4%
$0.60
Mix MOQ : 2
Wooden Snowman Christmas Hanging Pendants Hand Painted Rustic Holiday Tree Decorations Vintage Style With Jute Rope
Wooden Snowman Christmas Hanging Pendants Hand Painted Rustic Holiday Tree Decorations Vintage Style With Jute Rope
like
Find Similar
4 options
Wooden Snowman Christmas Hanging Pendants Hand Painted Rustic Holiday Tree Decorations Vintage Style With Jute Rope
$1.04
No MOQ
Christmas Wooden Hanging Ornaments Natural Birch Slices Snowflake Angel Tree Patterns Holiday Xmas Tree Decorations
Christmas Wooden Hanging Ornaments Natural Birch Slices Snowflake Angel Tree Patterns Holiday Xmas Tree Decorations
like
Find Similar
Rustic round wooden ornament with angel carving and natural jute twine hanging string - Angel
Round wooden Christmas ornament with white snowflake applique and natural jute twine - Snowflake
Round wooden Christmas ornament with white tree relief and natural hemp rope hanger - Christmas Tree
Christmas Wooden Hanging Ornaments Natural Birch Slices Snowflake Angel Tree Patterns Holiday Xmas Tree Decorations
$0.29
Mix MOQ : 300
Led Light Up Christmas Slap Bracelets Plush Cartoon Santa Snowman Reindeer Bear Party Favors Gifts For Kids
Led Light Up Christmas Slap Bracelets Plush Cartoon Santa Snowman Reindeer Bear Party Favors Gifts For Kids
like
Find Similar
Detail of LED glowing Christmas elk slap bracelet on a festive background - Deer
Glow-in-the-dark red snowman Christmas bracelet with LED light standing on a white book - Snowman
Glow-in-the-dark Christmas slap bracelet with cute LED polar bear and plush snowflake detail - Bear Style
Led Light Up Christmas Slap Bracelets Plush Cartoon Santa Snowman Reindeer Bear Party Favors Gifts For Kids
-4%
$0.60
Mix MOQ : 2
Simulation Biscuit Resin Accessories DIY Cream Glue Material Miniature Food Play Gingerbread Man Heart Bear Star Tree Shape
Simulation Biscuit Resin Accessories DIY Cream Glue Material Miniature Food Play Gingerbread Man Heart Bear Star Tree Shape
like
Find Similar
DIY 20mm heart shaped resin cookie accessory in orange-pink with LOVE engraving - LOVE Lettering / Heart Cookie
Mini resin gingerbread man charm for DIY crafts, light brown finish, size 28x23mm - Gingerbread Man
Orange bear resin DIY miniature charm 22x18mm for handmade crafts and deco - Bear Food
Star-shaped resin cookie miniature with 'Best Wishes' text, orange DIY craft accessory - Best Wishes Engraved / Pentagram
+3
Simulation Biscuit Resin Accessories DIY Cream Glue Material Miniature Food Play Gingerbread Man Heart Bear Star Tree Shape
$0.13
Mix MOQ : 10
 · 
180 sold recently
Wooden Christmas Hanging Ornaments Reindeer Snowflake Bell Tree Glove Pendant For Xmas Party Home Decoration
Wooden Christmas Hanging Ornaments Reindeer Snowflake Bell Tree Glove Pendant For Xmas Party Home Decoration
like
Find Similar
Wooden Christmas tree pendant featuring a reindeer design with beads and metal jingle bell - Style with Bells
Wooden reindeer Christmas tree ornament with beads and clips for holiday decor - Christmas Tree
Wooden glove Christmas ornament with reindeer pattern and wooden beads on a string - Glove Style
Wooden Christmas Hanging Ornaments Reindeer Snowflake Bell Tree Glove Pendant For Xmas Party Home Decoration
-4%
$1.37
No MOQ
Miniature Christmas Charms Resin Flatback DIY Crafting Decoration Santa Snowman Gingerbread Man For Phone Case Jewelry Accessories
Miniature Christmas Charms Resin Flatback DIY Crafting Decoration Santa Snowman Gingerbread Man For Phone Case Jewelry Accessories
like
Find Similar
Gingerbread style resin Christmas tree charm measuring 16x21mm for DIY jewelry making - Gingerbread Christmas Tree
Cartoon Santa Claus resin flatback accessory for DIY crafts, size 19mm x 23mm, 1.6g - Santa Claus
Star-shaped gingerbread resin charm with snowflakes and dots, 21mm Christmas DIY accessory - Gingerbread Snowflake
DIY Christmas snowman resin charm with red scarf and black hat, 18mm by 21mm size - Gingerbread Snowman
+15
Miniature Christmas Charms Resin Flatback DIY Crafting Decoration Santa Snowman Gingerbread Man For Phone Case Jewelry Accessories
$0.04-0.12
Mix MOQ : 10
 · 
210 sold recently
Free Shipping
DIY Christmas Hair Accessory Materials Reindeer Antlers Ears Glitter Felt Plush Craft Decorations For Girls Holiday Party
DIY Christmas Hair Accessory Materials Reindeer Antlers Ears Glitter Felt Plush Craft Decorations For Girls Holiday Party
like
Find Similar
Pair of camel-colored plush reindeer antlers for DIY girls hair accessories and headbands - Plush Antlers Accessories / Brown
Pair of cute pink plush heart hair accessories for DIY Christmas reindeer headbands - Plush Heart Accessories / Watermelon red
Pink plush reindeer ear DIY accessories for children's Christmas hair clips and headbands - Pink Plush Horn Accessories / Pink
Red plush reindeer antler accessories for DIY Christmas headbands and girls hair clips - Red Plush Heart Accessories / Red
+19
DIY Christmas Hair Accessory Materials Reindeer Antlers Ears Glitter Felt Plush Craft Decorations For Girls Holiday Party
-6%
$0.15-0.92
No MOQ
Free Shipping
Christmas Napkin Rings Santa Claus Felt Fabric Festive Dining Table Decoration Red White Holiday Party Supplies Buckle
Christmas Napkin Rings Santa Claus Felt Fabric Festive Dining Table Decoration Red White Holiday Party Supplies Buckle
like
Find Similar
1 option
Christmas Napkin Rings Santa Claus Felt Fabric Festive Dining Table Decoration Red White Holiday Party Supplies Buckle
$0.43
No MOQ
Double Heart Stainless Steel Earrings With Heart Shaped Clear Zircon PVD Plated Jewelry For Women
Double Heart Stainless Steel Earrings With Heart Shaped Clear Zircon PVD Plated Jewelry For Women
like
Find Similar
Golden heart ear cuffs with shimmering heart-shaped zircon stones and polished finish - Gold (KD3522)
Silver stainless steel double heart ear cuffs with sparkling zircon stone accents - Silver (PD3522)
Double Heart Stainless Steel Earrings With Heart Shaped Clear Zircon PVD Plated Jewelry For Women
$4.09
No MOQ
Free Shipping
Vintage Zircon Tassel Dangle Earrings Retro Ethnic Style Copper Chic Jewelry For Women With Silver Earring Post
Vintage Zircon Tassel Dangle Earrings Retro Ethnic Style Copper Chic Jewelry For Women With Silver Earring Post
like
Find Similar
Vintage silver multi-layer tassel earrings with zircon accents and metallic fringe drops - Sequin Tassel Ear Clip (1#)
Vintage gold earrings with colorful crystal tassel fringe in a velvet jewelry box - Silver Needle Inlaid Diamond Flower Tassel Stud Earrings (2#)
Vintage zircon tassel earrings with heart pendants in gold and silver finish - Silver Needle Sequin Chain Tassel Dangle Earrings (3#)
Macro shot of silver teardrop tassel earrings with grey beads and crystals in a box - Silver Needle Inlaid Diamond Waterdrop Hollow Tassel Stud Earrings (4#)
+17
Vintage Zircon Tassel Dangle Earrings Retro Ethnic Style Copper Chic Jewelry For Women With Silver Earring Post
$1.63-7.42
No MOQ
Free Shipping
Gold Plated Copper Hoop Earrings With Champagne Rhinestone Sphere Pendant And Silver Earring Post Vintage Chic Women
Gold Plated Copper Hoop Earrings With Champagne Rhinestone Sphere Pendant And Silver Earring Post Vintage Chic Women
like
Find Similar
Detail of gold plated sphere earrings with champagne rhinestones on a velvet stand - Ear Clip - Gold (Real Gold Plated)
Gold Plated Copper Hoop Earrings With Champagne Rhinestone Sphere Pendant And Silver Earring Post Vintage Chic Women
$2.62
No MOQ
Free Shipping
Stainless Steel 304 Pig Nose Mariner Link Bracelet Fashion Heavy Coffee Bean Chain Jewelry For Men And Women
Stainless Steel 304 Pig Nose Mariner Link Bracelet Fashion Heavy Coffee Bean Chain Jewelry For Men And Women
like
Find Similar
Silver stainless steel mariner link bracelet for couples measuring 215mm x 10mm - Silver Narrow Style (KB206643-ZCG)
Detailed close-up of golden stainless steel pig nose chain bracelet with 215x10mm sizing - Gold Narrow Style (KB206644-ZCG)
Silver stainless steel coffee bean link bracelet with 11mm width and 220mm length - Silver Wide Style (KB206645-ZCG)
Golden titanium steel anchor link bracelet with 220mm length and 11mm width dimensions - Gold Wide Style (KB206646-ZCG)
Stainless Steel 304 Pig Nose Mariner Link Bracelet Fashion Heavy Coffee Bean Chain Jewelry For Men And Women
$2.03-3.04
No MOQ
Free Shipping
Cross Snake Earrings Titanium Steel Zircon Inlaid Screw Back Stud Personalized Punk Gothic Style Jewelry For Couples
Cross Snake Earrings Titanium Steel Zircon Inlaid Screw Back Stud Personalized Punk Gothic Style Jewelry For Couples
like
Find Similar
Cool snake wrap cross earrings with clear zircon in silver stainless steel, 16x12mm size - Snake Cross (Pair)
Cross Snake Earrings Titanium Steel Zircon Inlaid Screw Back Stud Personalized Punk Gothic Style Jewelry For Couples
$2.09
No MOQ
Free Shipping
Cuban Link Bracelet Stainless Steel Rhinestone Pave 18K Gold Plated Heavy Chain Hip Hop Streetwear For Men Women
Cuban Link Bracelet Stainless Steel Rhinestone Pave 18K Gold Plated Heavy Chain Hip Hop Streetwear For Men Women
like
Find Similar
Iced out gold Cuban link bracelet with sparkling rhinestones in 18k gold plated finish - Gold
Silver cuban link bracelet with sparkling rhinestones in 12mm width and 210mm length - Silver
Cuban Link Bracelet Stainless Steel Rhinestone Pave 18K Gold Plated Heavy Chain Hip Hop Streetwear For Men Women
$13.50-15.18
No MOQ
Free Shipping
Hip Hop Stainless Steel Paperclip Link Chain Twisted Rope Necklace And Bracelet Jewelry For Men Geometric Minimalist Style
Hip Hop Stainless Steel Paperclip Link Chain Twisted Rope Necklace And Bracelet Jewelry For Men Geometric Minimalist Style
like
Find Similar
Silver mixed-link paperclip and twisted chain set with technical size specifications - Silver Set (KS226884-ZCG)
Gold twist and clip link necklace and bracelet set with 400x7.5mm and 180x7.5mm specs - Gold Set (KS226883-ZCG)
Two-tone stainless steel paperclip chain necklace and bracelet set in gold and silver - Two-tone Gold and Silver Set (KS226882-ZCG)
Hip Hop Stainless Steel Paperclip Link Chain Twisted Rope Necklace And Bracelet Jewelry For Men Geometric Minimalist Style
$3.54-6.34
No MOQ
Free Shipping
Cubic Zirconia Ear Cartilage Stud Titanium Steel Screw Flat Back Piercing Jewelry Sweet Tiny Sparkly Helix Earrings
Cubic Zirconia Ear Cartilage Stud Titanium Steel Screw Flat Back Piercing Jewelry Sweet Tiny Sparkly Helix Earrings
like
Find Similar
Delicate rose-cut gradient zircon stud earring with polished silver metal setting - 4mm Zircon/0.8x6mm Bar / Pink Mint (Single Piece)
Rose-cut 4mm gradient blue-purple cubic zirconia stud earring in stainless steel - 4mm Zircon/0.8x6mm Bar / Pink Blue (Single Piece)
Single 4mm orange zircon stud earring with polished silver setting and flat back - 4mm Zircon/0.8x6mm Bar / Yellow Rose Red (Single Piece)
Delicate silver stud earring with turquoise round-cut zircon and screw back closure - 4mm Zircon/0.8x6mm Bar / Pailan (Single Piece)
+1
Cubic Zirconia Ear Cartilage Stud Titanium Steel Screw Flat Back Piercing Jewelry Sweet Tiny Sparkly Helix Earrings
$1.04
No MOQ
Free Shipping
Retro Round Drop Earrings With Silver Earring Post Copper Gold Plated Woven Thread Mesh Pattern Fashion Jewelry For Women
Retro Round Drop Earrings With Silver Earring Post Copper Gold Plated Woven Thread Mesh Pattern Fashion Jewelry For Women
like
Find Similar
Macro detail of gold mesh round earrings with brown accents on green velvet background - Silver Earring Post Style / Silver Earring Post - Coffee
Detail of white oval studs and gold frame thread-wrapped round drop earrings - Silver Earring Post Style / Silver Earring Post-White
Golden round earrings with black mesh pattern and oval top piece on a fabric stand - Silver Earring Post Style / Gold-Black
Red silk-wrapped round dangle earrings with gold frames and enamel stud detail - Silver Earring Post Style / Gold-Red
+1
Retro Round Drop Earrings With Silver Earring Post Copper Gold Plated Woven Thread Mesh Pattern Fashion Jewelry For Women
$1.74-2.49
No MOQ
 · 
12 views
Free Shipping
Retro U-Shaped Resin Hoop Earrings For Women Geometric Marble Texture Copper Jewelry Elegant Maillard Style Accessory
Retro U-Shaped Resin Hoop Earrings For Women Geometric Marble Texture Copper Jewelry Elegant Maillard Style Accessory
like
Find Similar
Macro shot of amber resin U-shaped earrings on textured box with golden metallic clasp - Ear Clip Gold Brown
Detail of U-shaped gold earrings with white marble resin on white plush fabric - Ear Clip-Gold-White
Detail of vintage U-shaped resin earrings with marble texture on white plush background - Golden Black
Retro U-Shaped Resin Hoop Earrings For Women Geometric Marble Texture Copper Jewelry Elegant Maillard Style Accessory
$2.09
No MOQ
Free Shipping
Vintage Floral Polka Dot Dangle Earrings Red Ball Acrylic Resin With 925 Sterling Silver Earring Post Chic For Women
Vintage Floral Polka Dot Dangle Earrings Red Ball Acrylic Resin With 925 Sterling Silver Earring Post Chic For Women
like
Find Similar
Close-up of retro floral earrings with red studs and black white polka dot petals - 925 Sterling Silver Pin Style - Red - Black
Vintage red and black polka dot flower earrings with gold clips in jewelry box - Ear Clip Style - Red - Black
Vintage Floral Polka Dot Dangle Earrings Red Ball Acrylic Resin With 925 Sterling Silver Earring Post Chic For Women
$1.05-1.31
No MOQ
Free Shipping
Cute Bear Pendant Cartilage Piercing Earring With Heart Zircon Bow Paperclip Titanium Steel Jewelry For Women
Cute Bear Pendant Cartilage Piercing Earring With Heart Zircon Bow Paperclip Titanium Steel Jewelry For Women
like
Find Similar
Silver bow and bear cartilage stud featuring a sparkling heart-shaped clear zircon stone - White Zircon Bear (A809-1#)
Silver bow stud earring with a hanging bear pendant holding a pink heart zircon stone - Pink Zircon Bear (A809-2#)
Silver bear cartilage stud with light blue heart zircon and bow paperclip detail - Light Blue Zircon Bear (A809-3#)
Cute Bear Pendant Cartilage Piercing Earring With Heart Zircon Bow Paperclip Titanium Steel Jewelry For Women
$1.30-1.46
No MOQ
Free Shipping
Heart Ear Cartilage Stud Piercing Jewelry Copper With Teardrop Cubic Zirconia Hollow Star Moon Design For Women Daily
Heart Ear Cartilage Stud Piercing Jewelry Copper With Teardrop Cubic Zirconia Hollow Star Moon Design For Women Daily
like
Find Similar
Silver thorn hollow heart cartilage stud with star detail and drop zircon stones - Silver Frame With White Zirconia (Single Piece)
Silver hollow heart cartilage stud with pink teardrop zircon and star detail - Silver Frame With Pink Zirconia (Single Piece)
Thorn hollow heart stud earring in silver finish with pear-shaped purple zircon - Silver Frame With Chameleon Blue Purple Zirconia (Single Piece)
Hollow heart stud earring with light blue teardrop zircon and silver star details - Silver Frame With Light Sea Blue Zirconia (Single Piece)
Heart Ear Cartilage Stud Piercing Jewelry Copper With Teardrop Cubic Zirconia Hollow Star Moon Design For Women Daily
$1.04-1.18
No MOQ
Free Shipping
Vintage Palace Style Flower Earrings With Multi Color Rhinestones Enamel Faux Artificial Pearls 925 Sterling Silver Earring Post
Vintage Palace Style Flower Earrings With Multi Color Rhinestones Enamel Faux Artificial Pearls 925 Sterling Silver Earring Post
like
Find Similar
Vintage floral earrings with colorful rhinestones and white pearls on green velvet - Ear Clip-Colorful Flower
Vintage gold earrings with pearl and colorful enamel in a luxury velvet jewelry box - Silver Needle-Golden Oil-Drop Square
Vintage Palace Style Flower Earrings With Multi Color Rhinestones Enamel Faux Artificial Pearls 925 Sterling Silver Earring Post
$1.28-2.33
No MOQ
Free Shipping
Vintage Multi Layer Artificial Pearl Tassel Earrings For Women Gold Plated Copper With Zirconia And Silver Earring Post Elegant
Vintage Multi Layer Artificial Pearl Tassel Earrings For Women Gold Plated Copper With Zirconia And Silver Earring Post Elegant
like
Find Similar
Macro shot of multi-layer pearl earrings with zircon inlay on a green gift box - Ear Clip-Gold-White
Vintage Multi Layer Artificial Pearl Tassel Earrings For Women Gold Plated Copper With Zirconia And Silver Earring Post Elegant
$5.15
No MOQ
 · 
1 reviews
Free Shipping
Leopard Enamel Hoop Earrings Gold Plated Copper With Steel Earring Post Round Ear Buckle Vintage Style Women Jewelry
Leopard Enamel Hoop Earrings Gold Plated Copper With Steel Earring Post Round Ear Buckle Vintage Style Women Jewelry
like
Find Similar
Close-up of golden leopard print hoop earrings presented in a blue velvet jewelry box - Ear Clip (Real Gold Plated) / Gold & Coffee Leopard Print
Leopard Enamel Hoop Earrings Gold Plated Copper With Steel Earring Post Round Ear Buckle Vintage Style Women Jewelry
$2.09
No MOQ
Free Shipping
Stud Earrings Rhinestone Faux Artificial Pearl Flower Geometric Heart Vintage Jewelry For Women With Silver Earring Post
Stud Earrings Rhinestone Faux Artificial Pearl Flower Geometric Heart Vintage Jewelry For Women With Silver Earring Post
like
Find Similar
Close-up of gold stud earrings with pink triangular stones and white accent gems - Style 2 Silver Pin Irregular Triangle Rhinestone Stud Earrings
Macro shot of triangle-cut purple crystal earrings with gold trim on jewelry box - Style 3 Silver Pin Rhinestone Triangle Stud Earrings
Elegant gold geometric earrings with green and blue gemstones in a white leather box - 14# Steel Pin Geometric Rhinestone Trapezoid Stud Earrings
Elegant red bow stud earrings with glossy finish on a white jewelry display box - 15# Steel Pin Bow Knot Stud Earrings
+29
Stud Earrings Rhinestone Faux Artificial Pearl Flower Geometric Heart Vintage Jewelry For Women With Silver Earring Post
$0.92-2.54
No MOQ
Free Shipping
Vintage Metal Gold Plated Earrings Alloy Geometric Flower Design Fashion Jewelry With Silver Earring Post For Women Trendy
Vintage Metal Gold Plated Earrings Alloy Geometric Flower Design Fashion Jewelry With Silver Earring Post For Women Trendy
like
Find Similar
Retro golden spherical earrings with brushed metal texture displayed on a beige plate - Style 1 S925 Silver Needle - Gold - Round
Elegant gold flower metal earrings featuring a stylish vintage textured floral design - 2# Silver Needle-Gold-Flower
Detail view of gold matte round wavy earrings on a white textured ceramic plate - Style 4 S925 Silver Needle - Gold - Pleated Pattern
Detailed view of long gold tassel earrings with round sequins and U-shaped studs - Style 5 S925 Silver Needle - Gold - U-Shaped Sequin
+44
Vintage Metal Gold Plated Earrings Alloy Geometric Flower Design Fashion Jewelry With Silver Earring Post For Women Trendy
$0.83-5.57
No MOQ
 · 
27 sold recently
Free Shipping
Go to

More in accessories

Explore more in clips

clawsharkartificialshapehandmadedesigncolorswirepearl hairshark clips
stylealloyhairpinheartsolidlongtasselbangspartyplastic hair claw

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access