Everful

Wholesale clips

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Clips

Find the perfect pieces: hair claws, hair clips, hair bands & headbands and more

All products in clips

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Lotus Leaf Tassel Earrings Gold Plated Copper With 925 Sterling Silver Earring Post Vintage New Chinese Style Jewelry
Lotus Leaf Tassel Earrings Gold Plated Copper With 925 Sterling Silver Earring Post Vintage New Chinese Style Jewelry
like
Find Similar
Detailed macro view of gold-plated lotus fringe ear clip on premium velvet box - Clip-on Style / Gold
Detail of gold-plated lotus leaf tassel earrings with polished metallic finish - Hook Style / Gold
Lotus Leaf Tassel Earrings Gold Plated Copper With 925 Sterling Silver Earring Post Vintage New Chinese Style Jewelry
$2.88-4.36
No MOQ
Free Shipping
Lotus Flower Leaf Tassel Dangle Earrings Gold Plated Copper With Silver Earring Post Retro Chinese Style For Women
Lotus Flower Leaf Tassel Dangle Earrings Gold Plated Copper With Silver Earring Post Retro Chinese Style For Women
like
Find Similar
Gold plated lotus flower earrings with leaf fringe tassels and silicone backings - Ear Clip - Gold
Detail of gold-plated lotus leaf tassel earrings with polished metallic finish - Ear Hook - Gold (Real Gold Plating)
Lotus Flower Leaf Tassel Dangle Earrings Gold Plated Copper With Silver Earring Post Retro Chinese Style For Women
$2.86-4.63
No MOQ
Free Shipping
Flower Tassel Earrings With 925 Sterling Silver Earring Post Fabric Petal Imitation Artificial Pearl Crystal Zircon Elegant Holiday Women Jewelry
Flower Tassel Earrings With 925 Sterling Silver Earring Post Fabric Petal Imitation Artificial Pearl Crystal Zircon Elegant Holiday Women Jewelry
like
Find Similar
Elegant white floral tassel earrings with gold metal and pearls on ceramic tray - Butterfly Waterdrop Hollow Style (1#)
Colorful floral tassel drop earrings with pink heart stone and mixed gemstone beads - Heart Crystal Tassel Style (2#)
Detailed view of white floral tassel earrings with beads on a grey jewelry tray - Petal Seed Bead Crystal Tassel Style (3#)
Elegant yellow fabric flower earrings with center pearl on a golden display tray - Mesh Petal Stud Earrings Style (4#)
+11
Flower Tassel Earrings With 925 Sterling Silver Earring Post Fabric Petal Imitation Artificial Pearl Crystal Zircon Elegant Holiday Women Jewelry
$1.57-4.47
No MOQ
 · 
20 sold recently
Free Shipping
Vintage Court Style Drop Earrings Gold Plated Copper With Yellow Square Zircon And Silver Earring Post
Vintage Court Style Drop Earrings Gold Plated Copper With Yellow Square Zircon And Silver Earring Post
like
Find Similar
Macro shot of square yellow gemstone earrings with zircon inlay on luxury black leather - Gold (Real Gold Plated Silver Pin)
Close-up of 18K gold plated square earrings with large yellow gemstone and crystals - Ear Clip - Gold (Real Gold Plated)
Vintage Court Style Drop Earrings Gold Plated Copper With Yellow Square Zircon And Silver Earring Post
$3.05-3.32
No MOQ
 · 
23 views
Free Shipping
Vintage French Style Drop Earrings For Women Resin Acrylic Geometric Floral Polka Dot Jewelry With Silver Earring Post
Vintage French Style Drop Earrings For Women Resin Acrylic Geometric Floral Polka Dot Jewelry With Silver Earring Post
like
Find Similar
Macro detail of geometric leopard print hoop earrings with matte black studs and gold links - 18# Leopard Print Geometric Circle Earrings (925 Sterling Silver Earring Post)
Vintage red resin earrings with white polka dots and gold accents on artistic background - 1# Round Red White Polka Dot Earrings (Silver Earring Post)
Detail of daisy flower earrings with red heart pendants and screw-on clips - 2# White Flower Red Heart Polka Dot Ear Clip
Detailed shot of floral resin earrings with red oval pendant and heart pattern on white tray - 3# White Flower Red Heart Polka Dot Stud Earrings (Silver Earring Post)
+10
Vintage French Style Drop Earrings For Women Resin Acrylic Geometric Floral Polka Dot Jewelry With Silver Earring Post
$1.11-2.01
No MOQ
Free Shipping
Butterfly Tassel Jewelry Set Emerald Zircon Copper Necklace Earrings With Silver Earring Post Luxury Vintage For Women
Butterfly Tassel Jewelry Set Emerald Zircon Copper Necklace Earrings With Silver Earring Post Luxury Vintage For Women
like
Find Similar
Detail of silver tassel earrings with butterfly and teardrop zircons on a black label - White-Ear Clips
Silver earrings with emerald butterfly and sparkling tassel detail in white jewelry box - Silver Needle-Green-Stud Earrings
Blue gemstone butterfly earrings with tassel drops and crystal accents on silver pins - Silver Needle-Blue-Stud Earrings
Sparkling yellow teardrop and butterfly tassel earrings with cubic zirconia inlay - Silver Needle-Yellow-Stud Earrings
+5
Butterfly Tassel Jewelry Set Emerald Zircon Copper Necklace Earrings With Silver Earring Post Luxury Vintage For Women
$2.33-3.84
No MOQ
 · 
18 sold recently
Free Shipping
Retro Palace Drop Earrings With Yellow Pear Zircon Rhinestones Copper Jewelry With Silver Earring Post For Women
Retro Palace Drop Earrings With Yellow Pear Zircon Rhinestones Copper Jewelry With Silver Earring Post For Women
like
Find Similar
Detailed macro view of golden teardrop earrings with crystals and clover design - Gold
Macro shot of gold teardrop earrings with yellow gemstones and diamond accents - Ear Clip - Gold
Retro Palace Drop Earrings With Yellow Pear Zircon Rhinestones Copper Jewelry With Silver Earring Post For Women
$3.93-4.45
No MOQ
Free Shipping
Vintage Artificial Pearl Stud Earrings With 925 Sterling Silver Earring Post French Style Gold Plated Rhinestone Jewelry Women
Vintage Artificial Pearl Stud Earrings With 925 Sterling Silver Earring Post French Style Gold Plated Rhinestone Jewelry Women
like
Find Similar
Detail of vintage matte gold earrings with blue gemstones and white pearl accents - Irregular Baroque Vintage Gold Dangle Earrings (22#)
Elegant vintage flower stud earrings with white glaze petals and center pearl detail - White Flower Pearl Earrings (40#)
Vintage hollow flower earrings with gold finish and teardrop pearls in a velvet jewelry box - Gold Vintage Pearl Flower Earrings (24#)
Elegant vintage oval pearl stud earrings with textured gold frame and french retro style - Gold Oval Vintage Pearl Stud Earrings (20#)
+48
Vintage Artificial Pearl Stud Earrings With 925 Sterling Silver Earring Post French Style Gold Plated Rhinestone Jewelry Women
$0.78-2.86
No MOQ
 · 
263 sold recently
Top 10% Best Sellers
in Earrings
Free Shipping
Retro Artificial Pearl Necklace Copper With Zircon Pave Oval Interlocking Clasp Elegant Fashion Choker Jewelry For Women
Retro Artificial Pearl Necklace Copper With Zircon Pave Oval Interlocking Clasp Elegant Fashion Choker Jewelry For Women
like
Find Similar
Detailed macro view of white pearl necklace with golden zircon clasp on velvet - Gold with 6mm Pearls
Retro Artificial Pearl Necklace Copper With Zircon Pave Oval Interlocking Clasp Elegant Fashion Choker Jewelry For Women
$2.86
No MOQ
 · 
10 views
Free Shipping
Elegant Gourd Wulu Jewelry Copper Hollow Zircon Necklace And Earrings With Silver Earring Post Fashionable Accessory For Women Luxury Style
Elegant Gourd Wulu Jewelry Copper Hollow Zircon Necklace And Earrings With Silver Earring Post Fashionable Accessory For Women Luxury Style
like
Find Similar
Close-up of a silver gourd pendant with rose red gems in a wooden jewelry box - Necklace-Silver Purple
Detailed view of silver gourd-shaped earrings with micro-pave cubic zirconia stones - Gourd Zirconia Ear Buckle
Macro shot of green gourd-shaped stud earrings with sparkling zircon on dark green box - Silver Earring Post Gourd Zirconia Stud Earrings
Detailed macro view of golden gourd earrings with white stones in a black velvet box - Rhinestone Gourd Shaped Pearl Ear Hook
+5
Elegant Gourd Wulu Jewelry Copper Hollow Zircon Necklace And Earrings With Silver Earring Post Fashionable Accessory For Women Luxury Style
$1.31-4.17
No MOQ
Free Shipping
Butterfly Stud Earrings Elegant Artificial Pearl Zircon Inlaid Copper With Silver Earring Post Delicate Jewelry For Women
Butterfly Stud Earrings Elegant Artificial Pearl Zircon Inlaid Copper With Silver Earring Post Delicate Jewelry For Women
like
Find Similar
Elegant gold plated bow earrings with white pearls and circular studs for women - Bowknot Pearl Ear Clips / Gold
Elegant gold-plated butterfly earrings with purple pearls and white cubic zirconia accents - Pearl Butterfly Earrings / Purple
Butterfly Stud Earrings Elegant Artificial Pearl Zircon Inlaid Copper With Silver Earring Post Delicate Jewelry For Women
$1.44-1.55
No MOQ
Free Shipping
High Elastic Disposable Rubber Hair Ties Durable Hair Bands In Jar For Women Girls Kids Simple Fashionable Headwear
High Elastic Disposable Rubber Hair Ties Durable Hair Bands In Jar For Women Girls Kids Simple Fashionable Headwear
like
Find Similar
Close-up of black elastic hair bands stored in a clear plastic jar container - Thin Style (0.2cm) / Black
Close-up of a hand holding a transparent jar filled with elastic black hair bands - Thick Style (0.4cm) / Black
Close-up of black metal bobby pins with wavy texture displayed on a white plate - Metal Hair Clip / Black
High Elastic Disposable Rubber Hair Ties Durable Hair Bands In Jar For Women Girls Kids Simple Fashionable Headwear
-9%
$0.63-1.00
No MOQ
Colorful Flower Dangle Earrings With Silver Earring Post Acrylic Geometric Tulip Rose Sweet Fresh Style For Women
Colorful Flower Dangle Earrings With Silver Earring Post Acrylic Geometric Tulip Rose Sweet Fresh Style For Women
like
Find Similar
Pink and blue floral tulip earrings with artistic botanical patterns on oval pendants - Silver Pin - Flower Dangle
Elegant white floral stud earring with vintage cracked texture on a golden surface - White Flower Studs (8#)
Close-up of a white resin camellia flower earring worn on a model for a fresh look - Silver Pin - White Flower (4#)
Close-up of floral wreath earring with pink crystals and pearls worn by a model - Silver Pin - Pink Flower Pearl (5#)
+24
Colorful Flower Dangle Earrings With Silver Earring Post Acrylic Geometric Tulip Rose Sweet Fresh Style For Women
$1.02-3.11
No MOQ
 · 
33 views
Free Shipping
Vintage Irregular Blue Drip Glaze Earrings With 925 Sterling Silver Earring Post Alloy Rhinestone Flower Jewelry For Women
Vintage Irregular Blue Drip Glaze Earrings With 925 Sterling Silver Earring Post Alloy Rhinestone Flower Jewelry For Women
like
Find Similar
Detail of vintage emerald earrings with blue pavé stones on a white ceramic plate - Silver Pin Rhinestone Oval Earrings
Detail of silver drop earrings featuring dark blue crystals and cubic zirconia pave - Silver Pin Rhinestone Water Drop Earrings
Handheld close-up of blue iridescent geometric acrylic earrings with black frames - Silver Pin Geometric Irregular Earrings
Macro shot of blue enamel butterfly earrings with sparkling crystals on mirror reflection - Silver Pin Rhinestone Blue Butterfly Earrings
+20
Vintage Irregular Blue Drip Glaze Earrings With 925 Sterling Silver Earring Post Alloy Rhinestone Flower Jewelry For Women
$1.28-3.80
No MOQ
 · 
19 sold recently
Free Shipping
Rhinestone Jewelry Set Silver Plated Y Shape Tassel Necklace And Drop Earrings For Women Bride Wedding Prom Party
Rhinestone Jewelry Set Silver Plated Y Shape Tassel Necklace And Drop Earrings For Women Bride Wedding Prom Party
like
Find Similar
Elegant silver bridal jewelry set with sparkling rhinestones necklace bracelet and earrings - 446 Ear Clip 3-Piece Set (Necklace+Bracelet+Ear Clips) / Silver
Elegant rose gold bridal jewelry set with sparkling rhinestones on a black display stand - 446 Rose Gold 3-Piece Set / Rose Gold
Close-up of model wearing silver Y-shaped necklace and rhinestone earring set - 446 Ear Stud 3-Piece Set (Necklace+Bracelet+Earrings) / Silver
Elegant rhinestone necklace and drop earring set with dimensions on black background - 446 Ear Stud 2-Piece Set (Necklace+Earrings) / Silver
+6
Rhinestone Jewelry Set Silver Plated Y Shape Tassel Necklace And Drop Earrings For Women Bride Wedding Prom Party
-5%
$1.19-2.24
No MOQ
 · 
10 sold recently
Free Shipping
Elegant Flower Zircon Open Adjustable Rings Exquisite Copper Finger Jewelry For Women Korean Style INS Trendy Accessory
Elegant Flower Zircon Open Adjustable Rings Exquisite Copper Finger Jewelry For Women Korean Style INS Trendy Accessory
like
Find Similar
Rainbow zirconia gold ear cuff with colorful rectangular stones in a minimalist C-shape - Rainbow Rectangular Gemstone Ear Bone Clip (CR00397)
Minimalist gold open ring with colorful zircon sun flower pattern on white background - Gold Row Diamond Open Ring (CR00502cx)
Golden hexagonal ear cuff with multi-color cubic zirconia on white background - Hexagon Multicolor Gemstone Ear Bone Clip (CR0255CX)
Gold sunflower open ring with cream gemstone and clear cubic zirconia insets - Cream Gemstone Flower Ring (CR697CX)
+6
Elegant Flower Zircon Open Adjustable Rings Exquisite Copper Finger Jewelry For Women Korean Style INS Trendy Accessory
$1.70-3.30
No MOQ
 · 
14 views
Free Shipping
Adjustable Copper Heart Safety Pin Charm Bracelet With Zircon Micro Pave Imitation Artificial Pearl Woven Jewelry for Women
Adjustable Copper Heart Safety Pin Charm Bracelet With Zircon Micro Pave Imitation Artificial Pearl Woven Jewelry for Women
like
Find Similar
Adjustable silver beaded bracelet with cubic zirconia safety pin heart charm and black cord - Safety Pin Pendant Bracelet
Adjustable silver beaded bracelet with black enamel heart pendant and woven black cord - Heart Pendant Bracelet
Adjustable woven bracelet with white pearls and silver metal beads on a white background - Imitation Pearl Beaded Bracelet
Silver bead bracelet set with faux pearls, heart charm and zircon safety pin - 3-Piece Bracelet Set
Adjustable Copper Heart Safety Pin Charm Bracelet With Zircon Micro Pave Imitation Artificial Pearl Woven Jewelry for Women
$1.83-8.44
No MOQ
Free Shipping
Minimalist Stainless Steel Jewelry Set 18K Gold Plated Paperclip Chain Necklace Bracelet For Women Fashion Accessories
Minimalist Stainless Steel Jewelry Set 18K Gold Plated Paperclip Chain Necklace Bracelet For Women Fashion Accessories
like
Find Similar
4 options
Minimalist Stainless Steel Jewelry Set 18K Gold Plated Paperclip Chain Necklace Bracelet For Women Fashion Accessories
$0.26-0.71
No MOQ
 · 
945 sold recently
Free Shipping
I Do Heart Envelope Pendant Necklace Gold Plated Copper Romantic Jewelry Gift For Women Valentine Day
I Do Heart Envelope Pendant Necklace Gold Plated Copper Romantic Jewelry Gift For Women Valentine Day
like
Find Similar
Gold plated necklace featuring a rectangular pendant with red heart and I Do engraving - Gold
I Do Heart Envelope Pendant Necklace Gold Plated Copper Romantic Jewelry Gift For Women Valentine Day
$2.86
No MOQ
Free Shipping
Fashion Open Adjustable Ring Copper Gold Plated Safety Pin Daisy Flower Enamel Zirconia Jewelry For Women
Fashion Open Adjustable Ring Copper Gold Plated Safety Pin Daisy Flower Enamel Zirconia Jewelry For Women
like
Find Similar
Detail of paperclip ring with daisy motif and gold plating on white background - Adjustable Open / Gold - Black & White Daisy
Detail of gold-plated paperclip ring featuring colorful enamel flowers and zircon stones - Adjustable Open / Gold - Pink Green Blue White Flowers
Daisy safety pin open ring in gold copper with white and green enamel flowers - Adjustable Open / Gold - White & Green Flowers
Daisy paperclip open ring with gold plating and colorful enamel flowers for women - Adjustable Open / Gold - Red & Yellow Daisy
+4
Fashion Open Adjustable Ring Copper Gold Plated Safety Pin Daisy Flower Enamel Zirconia Jewelry For Women
$3.22
No MOQ
Free Shipping
Baroque Greek Goddess Leaf Shape Bridal Accessories Gold Metallic Headband Earrings Armband Bracelet Artificial Pearl Decor
Baroque Greek Goddess Leaf Shape Bridal Accessories Gold Metallic Headband Earrings Armband Bracelet Artificial Pearl Decor
like
Find Similar
Golden leaf bridal headband with pearls in classical Greek style for weddings - Pearl Gold Leaf Headband
Golden bridal leaf earrings with delicate faux pearls for an elegant wedding jewelry set - Pearl Gold Leaf Earrings
Bohemian gold leaf tassel drop earrings for women with detailed metal texture on white background - Multi-layer Leaf Earrings (EH008)
Elegant baroque golden laurel leaf upper arm cuff with adjustable open design - Gold Leaf Armlet
+15
Baroque Greek Goddess Leaf Shape Bridal Accessories Gold Metallic Headband Earrings Armband Bracelet Artificial Pearl Decor
-9%
$0.37-2.83
No MOQ
 · 
27 sold recently
Free Shipping
Chunky C Shape Hoop Earrings For Women Stainless Steel Gold Plated Hollow Textured Retro Geometric Minimalist Jewelry
Chunky C Shape Hoop Earrings For Women Stainless Steel Gold Plated Hollow Textured Retro Geometric Minimalist Jewelry
like
Find Similar
Chic gold twisted croissant hoop earrings on beige velvet and silk background - Spiral Croissant Style (MS-205 Gold) / Gold
Detailed view of silver hollow twisted rope pattern ear clips in polished stainless steel - Spiral Croissant Style (MS-205 Steel) / Steel
Minimalist 18K gold plated stainless steel C-shaped hoop earrings with hollow heart pattern - Heart Cutout Style (MS-221 Gold) / Gold
Minimalist silver C-shaped hoop earrings with hollow heart patterns for women - Heart Cutout Style (MS-221 Steel) / Steel
+13
Chunky C Shape Hoop Earrings For Women Stainless Steel Gold Plated Hollow Textured Retro Geometric Minimalist Jewelry
$2.34-3.08
No MOQ
Free Shipping
Vintage Chunky C Shape Hoop Earrings For Women 18K Gold Plated Stainless Steel Hollow Textured Minimalist Fashion Jewelry
Vintage Chunky C Shape Hoop Earrings For Women 18K Gold Plated Stainless Steel Hollow Textured Minimalist Fashion Jewelry
like
Find Similar
Close-up of thick gold-plated hollow C-shaped hoop earrings with a polished metal finish - Gold Smooth Large C Style (MS-019)
Detailed macro view of polished chunky C-shaped silver earrings with butterfly backs - Steel Smooth Large C Style (MS-019)
Close-up of golden hammered texture hollow ear cuffs on a ceramic tray display - Gold Hammered Hollow Ear Clip (MS-198)
Macro detail of silver C-shape hammered earrings displayed on a white textured stone - Steel Hammered Hollow Ear Clip (MS-198)
+8
Vintage Chunky C Shape Hoop Earrings For Women 18K Gold Plated Stainless Steel Hollow Textured Minimalist Fashion Jewelry
$2.46-3.45
No MOQ
Free Shipping
Stainless Steel Open Ring 18K Gold Plated Double Layer Hollow Safety Pin Pendants Star Heart Flower Two Tone Trendy Women
Stainless Steel Open Ring 18K Gold Plated Double Layer Hollow Safety Pin Pendants Star Heart Flower Two Tone Trendy Women
like
Find Similar
Macro detail of two-tone stainless steel heart ring with waterproof and hypoallergenic tags - Heart Charm Style (JDR0212001-PS)
Two-tone stainless steel safety pin ring with gold star and silver bead charms - Star Charm Style (JDR0305036-PS)
Adjustable silver layered paperclip ring with golden flower charm in 18K gold plated steel - Flower Charm Style (JDR0305037-PS)
Stainless Steel Open Ring 18K Gold Plated Double Layer Hollow Safety Pin Pendants Star Heart Flower Two Tone Trendy Women
$3.93-4.06
No MOQ
 · 
10 sold recently
Free Shipping
Stainless Steel Gold Necklace For Women Waterproof Hypoallergenic Chic Chain Geometric Heart Paperclip Minimalist Jewelry
Stainless Steel Gold Necklace For Women Waterproof Hypoallergenic Chic Chain Geometric Heart Paperclip Minimalist Jewelry
like
Find Similar
Golden stainless steel key necklace with 40+5cm length specs and waterproof feature - Rectangle Link Style (JDN0305022)
Detailed size chart for 18K gold-plated stainless steel necklace with 40+5cm length - Wave Design Style (JDN0305023)
Classic 18K gold stainless steel necklace with waterdrop heart cubic zirconia pendant - Fine Snake Chain (JDN0305024)
Technical specs of 18K gold plated stainless steel waterproof paperclip link necklace - Paperclip Link Style (JDN0305025)
+1
Stainless Steel Gold Necklace For Women Waterproof Hypoallergenic Chic Chain Geometric Heart Paperclip Minimalist Jewelry
$3.27-4.19
No MOQ
 · 
20 sold recently
Free Shipping
Stainless Steel Bracelet 18K Gold Plated Paperclip Chain Star CZ Waterproof Hypoallergenic Adjustable Jewelry For Women
Stainless Steel Bracelet 18K Gold Plated Paperclip Chain Star CZ Waterproof Hypoallergenic Adjustable Jewelry For Women
like
Find Similar
Gold plated stainless steel paperclip chain bracelet with adjustable lobster clasp closure - Gold Rectangular Paperclip Style (JDB0104003)
Minimalist 18K gold stainless steel chain bracelet with round link design for women - Gold Round Ring Link Style (JDB0104004)
Detailed view of 18K gold plated stainless steel chain bracelet with white zircon stones - Gold Rectangular With Zirconia Style (JDB0104005)
18K gold-plated stainless steel paperclip chain bracelet with sparkling cubic zirconia inlay - Gold Mesh Chain With Zirconia Style (JDB0304036)
+8
Stainless Steel Bracelet 18K Gold Plated Paperclip Chain Star CZ Waterproof Hypoallergenic Adjustable Jewelry For Women
$4.06-7.07
No MOQ
Free Shipping
18K Gold Plated Stainless Steel Chain Bracelets Collection For Women Waterproof Hypoallergenic Vintage Fashion Jewelry
18K Gold Plated Stainless Steel Chain Bracelets Collection For Women Waterproof Hypoallergenic Vintage Fashion Jewelry
like
Find Similar
Detailed dimensions of gold vintage lace hollow stainless steel bracelet with weight and length - Flat Serpentine Chain Style (JDB0305014)
Detail showing 18K gold stainless steel chain with waterproof and hypoallergenic texture - Thin Twist Rope Style (JDB0305015)
Gold hollow heart link bracelet in stainless steel with adjustable chain length - Hollow Heart Link Style (JDB0305016)
Detail showing gold-plated stainless steel heart bracelet with specific size dimensions - Flat Oval Link Style (JDB0305017)
+2
18K Gold Plated Stainless Steel Chain Bracelets Collection For Women Waterproof Hypoallergenic Vintage Fashion Jewelry
$2.49-3.14
No MOQ
Free Shipping
Safety Pin Open Ring 18K Gold Plated Stainless Steel Double Layer Hollow Adjustable Minimalist Jewelry For Women
Safety Pin Open Ring 18K Gold Plated Stainless Steel Double Layer Hollow Adjustable Minimalist Jewelry For Women
like
Find Similar
18K gold plated stainless steel paperclip ring with adjustable layered hollow design - Stainless Steel / Gold Safety Pin Style (JDR0304015)
Two-tone safety pin ring in stainless steel with adjustable open design, 2.1g weight - Stainless Steel / Gold and Silver Two-Tone Safety Pin Style (JDR0304015-PS)
Waterproof stainless steel paperclip ring with gold-silver plating and zirconia stones - Stainless Steel/Zirconia / Rhinestone Two-Tone Safety Pin Style (JDR0304022-PS-7)
Safety Pin Open Ring 18K Gold Plated Stainless Steel Double Layer Hollow Adjustable Minimalist Jewelry For Women
$2.10-4.58
No MOQ
Free Shipping
18K Gold Plated Stainless Steel Double Layered Bracelet With Cubic Zirconia And Paperclip Safety Pin Charm For Women
18K Gold Plated Stainless Steel Double Layered Bracelet With Cubic Zirconia And Paperclip Safety Pin Charm For Women
like
Find Similar
Double-layered gold stainless steel bracelet with zircon stones and safety pin clasp - Safety Pin Style (JDB0204006)
Detail of gold multi-layer stainless steel bracelet showing size and weight specs - Double Layer Zircon Style (JDB2407008)
18K Gold Plated Stainless Steel Double Layered Bracelet With Cubic Zirconia And Paperclip Safety Pin Charm For Women
$2.88-6.29
No MOQ
Free Shipping
18K Gold Plated Stainless Steel Heart Pendant Necklace With Freshwater Pearl Safety Pin Paperclip Chain Jewelry For Women
18K Gold Plated Stainless Steel Heart Pendant Necklace With Freshwater Pearl Safety Pin Paperclip Chain Jewelry For Women
like
Find Similar
18K gold plated stainless steel paperclip chain necklace with heart and pearl pendant - Heart Safety Pin Pearl Style (JDN0204002)
18K Gold Plated Stainless Steel Heart Pendant Necklace With Freshwater Pearl Safety Pin Paperclip Chain Jewelry For Women
$6.55
No MOQ
 · 
43 sold recently
Free Shipping
Paperclip Safety Pin Earrings Stainless Steel Industrial Retro Style For Women Lightweight Hypoallergenic Luxury Jewelry
Paperclip Safety Pin Earrings Stainless Steel Industrial Retro Style For Women Lightweight Hypoallergenic Luxury Jewelry
like
Find Similar
Minimalist silver stainless steel paperclip hoop earrings with size measurements - Silver Paperclip Style (JDE0204003-S)
Paperclip Safety Pin Earrings Stainless Steel Industrial Retro Style For Women Lightweight Hypoallergenic Luxury Jewelry
$3.27
No MOQ
Free Shipping
Heart Safety Pin Drop Earrings Stainless Steel Cubic Zirconia Inlaid Paperclip Punk Aesthetic Jewelry For Women
Heart Safety Pin Drop Earrings Stainless Steel Cubic Zirconia Inlaid Paperclip Punk Aesthetic Jewelry For Women
like
Find Similar
Polished silver stainless steel safety pin earrings with cubic zirconia heart stud - Silver Heart Safety Pin Style (JDE0204004-S)
Heart Safety Pin Drop Earrings Stainless Steel Cubic Zirconia Inlaid Paperclip Punk Aesthetic Jewelry For Women
$3.93
No MOQ
Free Shipping
Paperclip Link Bracelet Stainless Steel Gold Silver Two Tone Cross Charm Zircon Inlay Waterproof Hypoallergenic Women
Paperclip Link Bracelet Stainless Steel Gold Silver Two Tone Cross Charm Zircon Inlay Waterproof Hypoallergenic Women
like
Find Similar
Silver stainless steel chain bracelet with gold safety pin and cross pendant charm - Mixed Color (JDB0204005-PS)
Paperclip Link Bracelet Stainless Steel Gold Silver Two Tone Cross Charm Zircon Inlay Waterproof Hypoallergenic Women
$4.45
No MOQ
Free Shipping
Stainless Steel Safety Pin Earrings For Women 18K Gold Plated Beads Mixed Metal Paperclip Punk Style Jewelry
Stainless Steel Safety Pin Earrings For Women 18K Gold Plated Beads Mixed Metal Paperclip Punk Style Jewelry
like
Find Similar
Silver safety pin earrings with gold bead accents made of durable stainless steel - Safety Pin Two-tone Style (JDE0204002-PS)
Stainless Steel Safety Pin Earrings For Women 18K Gold Plated Beads Mixed Metal Paperclip Punk Style Jewelry
$4.58
No MOQ
Free Shipping
Paperclip Open Ring 18K Gold Plated Stainless Steel Zircon Horseshoe U-Shaped Adjustable Finger Jewelry For Women
Paperclip Open Ring 18K Gold Plated Stainless Steel Zircon Horseshoe U-Shaped Adjustable Finger Jewelry For Women
like
Find Similar
Detailed view of gold-tone spiral pearl ring with size specifications and waterproof features - Gold Paperclip Horseshoe Style (JDR0302016)
Adjustable silver stainless steel horseshoe ring with sparkling cubic zirconia pavé - Silver Paperclip Horseshoe Style (JDR0302016-S)
Adjustable golden stainless steel ring with paperclip design and white crystal inlay - Gold Full Zircon Intertwined U-Shape Style (JDR0304021)
Paperclip Open Ring 18K Gold Plated Stainless Steel Zircon Horseshoe U-Shaped Adjustable Finger Jewelry For Women
$4.58-4.98
No MOQ
 · 
11 views
Free Shipping
Paperclip Link Chain Necklace Gold Plated Stainless Steel Waterproof Hypoallergenic Minimalist Geometric Jewelry For Women
Paperclip Link Chain Necklace Gold Plated Stainless Steel Waterproof Hypoallergenic Minimalist Geometric Jewelry For Women
like
Find Similar
Detail of 18K gold stainless steel paperclip chain with 40+5cm length and clasp specs - Gold (JDN0302006)
Paperclip Link Chain Necklace Gold Plated Stainless Steel Waterproof Hypoallergenic Minimalist Geometric Jewelry For Women
$2.62
No MOQ
Free Shipping
Minimalist 18K Gold Plated Stainless Steel Ear Cuffs Non Piercing Geometric Round Cartilage Jewelry For Women
Minimalist 18K Gold Plated Stainless Steel Ear Cuffs Non Piercing Geometric Round Cartilage Jewelry For Women
like
Find Similar
Minimalist stainless steel ear cuffs in gold and silver finish with polished surface - Gold and Silver Set (JDEW2305003-PS)
Golden C-shaped stainless steel hoop earrings with precise size and weight measurements - Gold Simple Style (JDEW2305003)
Polished silver stainless steel ear cuffs set with detailed size and weight specs - Silver Simple Style (JDEW2305003-S)
Polished gold-plated C-shaped stainless steel ear cuff with smooth mirror finish - Gold Large Style (JDEW2311010)
Minimalist 18K Gold Plated Stainless Steel Ear Cuffs Non Piercing Geometric Round Cartilage Jewelry For Women
$3.14-3.27
No MOQ
 · 
23 sold recently
Free Shipping
Stainless Steel Tassel Dangle Earrings For Women 18K Gold Plated Waterproof Hypoallergenic Long Geometric Drop Ear Jewelry
Stainless Steel Tassel Dangle Earrings For Women 18K Gold Plated Waterproof Hypoallergenic Long Geometric Drop Ear Jewelry
like
Find Similar
Golden stainless steel bow tassel earrings measuring 7.8cm in length on white background - Butterfly Tassel (JDEW2405012) / Gold
Detailed view of long multi-layer tassel earrings with dimensions and features - Long Chain Hoop (JDEW2409025) / Gold
Elegant gold stainless steel tassel drop earrings with long fringe for women - Beaded Tassel (JDEW2410010) / Gold
Detail of two-tone chain fringe earrings with size specs and waterproof steel features - Tassel Ear Clip (JDEW2410008-PS) / Gold and Silver Two-tone
+2
Stainless Steel Tassel Dangle Earrings For Women 18K Gold Plated Waterproof Hypoallergenic Long Geometric Drop Ear Jewelry
$3.93-8.51
No MOQ
 · 
15 sold recently
Free Shipping
Double Layer Necklace Stainless Steel With Glass Artificial Pearl And Heart Pendant Paperclip Chain Link Fashion Jewelry For Women
Double Layer Necklace Stainless Steel With Glass Artificial Pearl And Heart Pendant Paperclip Chain Link Fashion Jewelry For Women
like
Find Similar
Golden 18K gold-plated stainless steel paperclip chain necklace size specifications - Double Layer Gold Paperclip Chain With Pearl Heart Pendant (JDN20127-1)
Double Layer Necklace Stainless Steel With Glass Artificial Pearl And Heart Pendant Paperclip Chain Link Fashion Jewelry For Women
$4.45
No MOQ
Free Shipping
Stainless Steel Hoop Earrings Bicolor Gold Silver Geometric C-Shaped Waterproof Hypoallergenic Non Tarnish For Women
Stainless Steel Hoop Earrings Bicolor Gold Silver Geometric C-Shaped Waterproof Hypoallergenic Non Tarnish For Women
like
Find Similar
Two-tone twisted C-shape earrings dimensions 19.5mm by 5.25mm in 18k gold and silver steel - Twisted Rope C-Shape Style (JDE201268-2)
Two-tone gold and silver C-shaped hoop earrings with 2.0cm height and 1.0cm width dimensions - Mixed Color C-Shape Style (JDE202191-2)
Three-line geometric titanium steel earrings in gold and silver finish with size specs - Two-Tone Hoop Style (JDE202258-PS)
Minimalist 18k gold and silver two-tone stainless steel C-shaped earrings for women - Two-Tone Large Hoop Style (JDE2405016)
+2
Stainless Steel Hoop Earrings Bicolor Gold Silver Geometric C-Shaped Waterproof Hypoallergenic Non Tarnish For Women
$2.49-5.50
No MOQ
 · 
13 sold recently
Free Shipping
Luxury Stainless Steel Rhinestone Ponytail Holder Hair Tie U-Shaped Full Crystal Elastic Band Fashion Accessory For Women
Luxury Stainless Steel Rhinestone Ponytail Holder Hair Tie U-Shaped Full Crystal Elastic Band Fashion Accessory For Women
like
Find Similar
Gold stainless steel ponytail hair cuff with rhinestones, 7.6cm length, waterproof hair accessory - Full Rhinestone Gold Style (JDH2407004)
Golden stainless steel hammered hair cuff with black elastic tie for ponytails - Hammered Metal Gold Style (JDH2407002)
Luxury Stainless Steel Rhinestone Ponytail Holder Hair Tie U-Shaped Full Crystal Elastic Band Fashion Accessory For Women
-9%
$5.50-11.13
No MOQ
Free Shipping
Minimalist Stainless Steel Ear Cuffs 18K Gold Plated Non Piercing U Shape Glossy Retro Jewelry For Women
Minimalist Stainless Steel Ear Cuffs 18K Gold Plated Non Piercing U Shape Glossy Retro Jewelry For Women
like
Find Similar
Minimalist thick gold polished stainless steel hoop earrings pair in 1.56cm variant - Gold Smooth Ear Cuff (JDE2309044)
Minimalist silver stainless steel hoop earrings with polished finish and dimensions - Silver Smooth Ear Cuff (JDE2309044-S)
Minimalist Stainless Steel Ear Cuffs 18K Gold Plated Non Piercing U Shape Glossy Retro Jewelry For Women
$3.80-4.19
No MOQ
Free Shipping
Stainless Steel Bracelet Hand Chain For Women Gold Plated Cubic Zirconia Paperclip Tennis Initial Stackable Waterproof
Stainless Steel Bracelet Hand Chain For Women Gold Plated Cubic Zirconia Paperclip Tennis Initial Stackable Waterproof
like
Find Similar
Waterproof silver stainless steel paperclip link bracelet with cubic zirconia inlay - Silver Industrial Style Thick Chain Bracelet (JDB201276-S)
Detail of 18K gold paperclip chain bracelet with white cubic zirconia and size dimensions - Gold Zircon Paperclip Chain Bracelet (JDB0305038)
Gold stainless steel paperclip chain bracelet featuring a cubic zirconia inlaid letter M - Gold Letter M Pendant Zircon Bracelet (JDB0204014)
Gold plated stainless steel paperclip tennis bracelet with cubic zirconia and lobster clasp - Gold Round Zircon Tennis Bracelet (JDB0112060-2)
+1
Stainless Steel Bracelet Hand Chain For Women Gold Plated Cubic Zirconia Paperclip Tennis Initial Stackable Waterproof
$2.88-4.19
No MOQ
 · 
46 sold recently
Free Shipping
Artificial Pearl Stud Earrings And Ear Cuff For Women Rhinestone Geometric Gold Plated Stainless Steel Earring Post Jewelry
Artificial Pearl Stud Earrings And Ear Cuff For Women Rhinestone Geometric Gold Plated Stainless Steel Earring Post Jewelry
like
Find Similar
Technical view of gold-plated stainless steel pearl stud earrings with size and weight specs - Single Pearl Stud Earring (JDE0212023-6) / Gold
Golden C-shaped stainless steel hoop earrings with precise size and weight measurements - Gold Circle Ear Clip (JDEW2305003) / Gold
Artificial Pearl Stud Earrings And Ear Cuff For Women Rhinestone Geometric Gold Plated Stainless Steel Earring Post Jewelry
$2.36-3.27
No MOQ
Free Shipping
Artificial Baroque Pearl Hoop Earrings Stainless Steel Colorful Rhinestone Studs Waterproof Hypoallergenic Fashion Jewelry For Women
Artificial Baroque Pearl Hoop Earrings Stainless Steel Colorful Rhinestone Studs Waterproof Hypoallergenic Fashion Jewelry For Women
like
Find Similar
Gold stainless steel hoop earrings with white baroque pearl and colored crystals - Baroque Pearl Color Diamond Earrings (JDE0305018)
Detailed view of gold stainless steel hoop earrings with size measurements and specs - Double Layer Stainless Steel Ear Clip (JDE0312012)
Technical view of gold-plated stainless steel pearl stud earrings with size and weight specs - Mini Pearl Stainless Steel Studs (JDE0212023-6)
Artificial Baroque Pearl Hoop Earrings Stainless Steel Colorful Rhinestone Studs Waterproof Hypoallergenic Fashion Jewelry For Women
$2.36-4.72
No MOQ
Free Shipping
Paperclip Chain Necklace Stainless Steel 18K Gold Plated Spliced Colorful Enamel Geometric Splicing Women Jewelry
Paperclip Chain Necklace Stainless Steel 18K Gold Plated Spliced Colorful Enamel Geometric Splicing Women Jewelry
like
Find Similar
Dual-tone stainless steel chain necklace with green links and golden finish details - Light Green and Gold Patchwork Style (JDN0212004-GN-2)
Green and gold stainless steel heart necklace with detailed dimensions and specs - Dark Green and Gold Patchwork Style (JDN0212004-GN-1)
Paperclip Chain Necklace Stainless Steel 18K Gold Plated Spliced Colorful Enamel Geometric Splicing Women Jewelry
$2.75
No MOQ
 · 
11 views
Free Shipping
Hollow Heart Pendant Necklace And Bracelet Stainless Steel 18K Gold Plated Paperclip Chain Minimalist Jewelry For Women
Hollow Heart Pendant Necklace And Bracelet Stainless Steel 18K Gold Plated Paperclip Chain Minimalist Jewelry For Women
like
Find Similar
Detailed view of golden heart pendant bracelet with dimensions 19cm length and 5.67g weight - 18K Gold Plated 3D Heart Paperclip Chain Bracelet (JDB2308023)
Golden heart pendant necklace with dimensions 2.44cm by 2.5cm and 46cm chain length - 18K Gold Plated 3D Heart Paperclip Chain Necklace (JDN2308057)
Hollow Heart Pendant Necklace And Bracelet Stainless Steel 18K Gold Plated Paperclip Chain Minimalist Jewelry For Women
$2.57-3.67
No MOQ
Free Shipping
Stainless Steel Ear Cuffs C-Shaped Non-Piercing Geometric Earrings Minimalist Retro Fashion Polished For Women
Stainless Steel Ear Cuffs C-Shaped Non-Piercing Geometric Earrings Minimalist Retro Fashion Polished For Women
like
Find Similar
Golden C-shaped stainless steel hoop earrings with precise size and weight measurements - Gold Style (JDEW2305003)
Polished silver stainless steel ear cuffs set with detailed size and weight specs - Silver Style (JDEW2305003-S)
Stainless Steel Ear Cuffs C-Shaped Non-Piercing Geometric Earrings Minimalist Retro Fashion Polished For Women
$3.41
No MOQ
 · 
11 sold recently
Free Shipping
Fashion Stainless Steel Rings For Women 18K Gold Plated Artificial Pearl Rhinestone Waterproof Jewelry Elegant
Fashion Stainless Steel Rings For Women 18K Gold Plated Artificial Pearl Rhinestone Waterproof Jewelry Elegant
like
Find Similar
Two-tone mixed gold and silver stainless steel chain link ring for women jewelry - Gold Silver Two-Tone Chain Ring (JDR0106004-PS-7)
18K gold plated stainless steel open ring with a white pearl and waterproof finish - Pearl Open Ring (JDR0306005)
Detailed view of gold-tone spiral pearl ring with size specifications and waterproof features - Horseshoe Rhinestone Open Ring (JDR0302016)
Macro shot of gold olive leaf ring with detailed measurements and product dimensions - Leaf Open Ring (JDR202403)
Fashion Stainless Steel Rings For Women 18K Gold Plated Artificial Pearl Rhinestone Waterproof Jewelry Elegant
$1.96-5.11
No MOQ
Free Shipping
Stainless Steel Rings Zircon Inlaid Geometric Safety Pin V-Shape Waterproof Hypoallergenic Trendy Jewelry For Women
Stainless Steel Rings Zircon Inlaid Geometric Safety Pin V-Shape Waterproof Hypoallergenic Trendy Jewelry For Women
like
Find Similar
Macro detail of paperclip design ring in stainless steel with gold bead accents - US 6 / Silver with Gold Pin
Waterproof gold wave-shaped V-ring in stainless steel with a polished finish - US 7 / Gold Wave V-Shape
Detailed view of multi-layer spiral 18K gold-plated stainless steel ring with dimensions - US 7 / Gold Spiral
Detailed size specifications for 18K gold plated stainless steel pear-cut zircon ring - US 7 / Gold Pear Zirconia
+3
Stainless Steel Rings Zircon Inlaid Geometric Safety Pin V-Shape Waterproof Hypoallergenic Trendy Jewelry For Women
$2.49-4.06
No MOQ
 · 
10 sold recently
Free Shipping
Fashion Multi Layer Necklace For Women Stainless Steel Paperclip Chain Heart Bow Star Safety Pin Artificial Pearl Initial Letter A
Fashion Multi Layer Necklace For Women Stainless Steel Paperclip Chain Heart Bow Star Safety Pin Artificial Pearl Initial Letter A
like
Find Similar
Detail showing two-tone 18K gold and silver stainless steel mixed link chain with dimensions - Gold and Silver Mixed Paperclip Style (JDN0103030-PS)
18K gold plated stainless steel paperclip chain necklace with heart and pearl pendant - Gold Heart Pearl Pin Style (JDN0204002)
Detail shot of bicolor stainless steel bow necklace with size dimensions and star pendant - Gold and Silver Mixed Bow Star Style (JDNW2407001-PS)
Golden stainless steel letter A pendant necklace with waterproof and hypoallergenic finish - Gold Letter A Pendant Style (JDNW2403047-A)
Fashion Multi Layer Necklace For Women Stainless Steel Paperclip Chain Heart Bow Star Safety Pin Artificial Pearl Initial Letter A
$2.88-6.68
No MOQ
Free Shipping
Stainless Steel Stud Earrings Waterproof Hypoallergenic Gold Plated Round Geometric Spiral Texture Niche Design For Women
Stainless Steel Stud Earrings Waterproof Hypoallergenic Gold Plated Round Geometric Spiral Texture Niche Design For Women
like
Find Similar
Waterproof gold threaded spiral stud earrings in stainless steel for a luxury style - JDE0112049 Spiral Texture
Detailed view of twisted rope stainless steel earrings with precise size measurements - JDEW2408032 Twisted Ring
Gold stainless steel clip-on ear cuff with beaded texture and sizing specifications - JDEW2411020 Ball Clip-on
Stainless Steel Stud Earrings Waterproof Hypoallergenic Gold Plated Round Geometric Spiral Texture Niche Design For Women
$2.49-5.11
No MOQ
 · 
1 reviews
Free Shipping
Star Stud Earrings And Ear Cuff Gold Silver Dual Tone Stainless Steel Zircon Rhinestone Hypoallergenic Jewelry For Women
Star Stud Earrings And Ear Cuff Gold Silver Dual Tone Stainless Steel Zircon Rhinestone Hypoallergenic Jewelry For Women
like
Find Similar
Star-shaped stainless steel earrings in gold and silver finish with dimension details - Stainless Steel / Two Tone Star Stud Earrings
Gold double-layered stainless steel ear cuff clip with 1.40cm diameter, no piercing needed - Metal Alloy / Gold Double Layer Ear Clip
Star Stud Earrings And Ear Cuff Gold Silver Dual Tone Stainless Steel Zircon Rhinestone Hypoallergenic Jewelry For Women
$4.06-4.85
No MOQ
Free Shipping
Double Layer Bracelet Stainless Steel Cubic Zirconia Safety Pin Charm Gold Plated Fashion Jewelry Women
Double Layer Bracelet Stainless Steel Cubic Zirconia Safety Pin Charm Gold Plated Fashion Jewelry Women
like
Find Similar
Double-layered gold stainless steel bracelet with zircon stones and safety pin clasp - Safety Pin Zirconia Bracelet / Gold
Double Layer Bracelet Stainless Steel Cubic Zirconia Safety Pin Charm Gold Plated Fashion Jewelry Women
$6.29
No MOQ
 · 
12 views
Free Shipping
Stainless Steel Artificial Pearl Hoop Earrings Gold Plated Waterproof Hypoallergenic Luxury French Style Jewelry For Women
Stainless Steel Artificial Pearl Hoop Earrings Gold Plated Waterproof Hypoallergenic Luxury French Style Jewelry For Women
like
Find Similar
Detail of 4.6g waterproof stainless steel earrings with gold rings and baroque pearls - Gold Pearl Drop Earrings JDE0103024
Detail view of gold wave hoop earrings with dimensions 1.1cm and waterproof feature - Gold Smooth Hoop Earrings JDE2407021
Elegant gold stainless steel ear clips with multiple pearls including size and weight specs - Gold Pearl Ear Clips JDE0304010
Stainless Steel Artificial Pearl Hoop Earrings Gold Plated Waterproof Hypoallergenic Luxury French Style Jewelry For Women
$4.19-5.76
No MOQ
Free Shipping
Ocean Starfish Shell Fishbone Stainless Steel Jewelry Women Waterproof Hypoallergenic Summer Beach Vacation Bohemian Charms
Ocean Starfish Shell Fishbone Stainless Steel Jewelry Women Waterproof Hypoallergenic Summer Beach Vacation Bohemian Charms
like
Find Similar
Detail view of gold stainless steel bracelet with seashell charms and size measurements - Bracelet - Fishbone Shell Charm (JDB0212009)
Macro detail of 6.4cm stainless steel earring with gold finish and shell pendant - Earrings/Bikini Clip - Gold Shell (JDBKN008)
Waterproof gold stainless steel starfish and seahorse earrings for women - Earrings - Starfish Seahorse Shape (JDE0212018)
Detailed size specifications for gold stainless steel fishbone pendant earrings - Hoop Earrings - Fishbone Charm (JDE0212017)
+3
Ocean Starfish Shell Fishbone Stainless Steel Jewelry Women Waterproof Hypoallergenic Summer Beach Vacation Bohemian Charms
$2.75-9.69
No MOQ
 · 
49 sold recently
Free Shipping
Stainless Steel Hair Tie Ponytail Holder Marine Starfish Turtle Shell Artificial Pearl Rhinestone Fashion Elastic Metal Headwear
Stainless Steel Hair Tie Ponytail Holder Marine Starfish Turtle Shell Artificial Pearl Rhinestone Fashion Elastic Metal Headwear
like
Find Similar
Black elastic hair tie with gold starfish turtle and pearl charms in stainless steel - Ocean Theme Set-Gold (JDH2406013)
Polished silver stainless steel star hair tie with high-elasticity black band for women - Star Shape-Silver (JDH2406002-S)
Polished gold stainless steel four-leaf clover hair tie with black high-elastic band - Clover Shape-Gold (JDH2406001)
Polished stainless steel hair ring with dimensions 7.11cm and hypoallergenic finish - Polished Ring-Silver (JDH2403002-S)
+12
Stainless Steel Hair Tie Ponytail Holder Marine Starfish Turtle Shell Artificial Pearl Rhinestone Fashion Elastic Metal Headwear
-9%
$4.32-12.97
No MOQ
 · 
21 views
Free Shipping
Men Braided Leather Bracelet With Stainless Steel Beads Multi Layer Cord Magnetic Clasp Fashion Hand Jewelry Gift
Men Braided Leather Bracelet With Stainless Steel Beads Multi Layer Cord Magnetic Clasp Fashion Hand Jewelry Gift
like
Find Similar
Detailed view of black multi-layer braided leather bracelet with silver magnetic steel clasp - 19cm / 1 Name / Steel Color Buckle
Detailed macro of a triple-layer black braided leather bracelet with customizable steel beads - 19cm / 2 Names / Steel Color Buckle
Macro shot of triple-layer braided black leather bracelet with custom name engravings - 19cm / 3 Names / Steel Color Buckle
Men's triple-layer braided black leather bracelet with custom stainless steel beads - 19cm / 4 Names / Steel Color Buckle
+44
Men Braided Leather Bracelet With Stainless Steel Beads Multi Layer Cord Magnetic Clasp Fashion Hand Jewelry Gift
$4.27-10.61
No MOQ
Free Shipping
Paperclip Link Chain Necklace And Bracelet Brass Gold Plated Retro Punk Minimalist Hip Hop Jewelry For Men Women
Paperclip Link Chain Necklace And Bracelet Brass Gold Plated Retro Punk Minimalist Hip Hop Jewelry For Men Women
like
Find Similar
Minimalist gold paperclip chain necklace for women worn by a model in a professional style - Necklace
Close-up of golden paperclip link bracelet with polished metallic finish for women - Bracelet
Paperclip Link Chain Necklace And Bracelet Brass Gold Plated Retro Punk Minimalist Hip Hop Jewelry For Men Women
$1.85-2.59
No MOQ
 · 
10 sold recently
Free Shipping
18K Gold Plated Stainless Steel Chain Bracelet Minimalist Adjustable Figaro Cuban Snake Rope Jewelry For Women Men
18K Gold Plated Stainless Steel Chain Bracelet Minimalist Adjustable Figaro Cuban Snake Rope Jewelry For Women Men
like
Find Similar
2mm golden stainless steel box chain bracelet with 18k gold plating and lobster clasp - Box Chain (TB5001) / Gold
Minimalist 18k gold plated 3mm cuban chain bracelet with adjustable length extension - Cuban Chain (TB5002) / Gold
2mm golden twisted rope bracelet in stainless steel with lobster clasp and adjustable chain - Rope Chain (TB5003) / Gold
Gold plated 3mm stainless steel Figaro chain bracelet with adjustable extension - Figaro Chain (TB5004) / Gold
+15
18K Gold Plated Stainless Steel Chain Bracelet Minimalist Adjustable Figaro Cuban Snake Rope Jewelry For Women Men
$0.81-1.71
No MOQ
 · 
31 sold recently
Free Shipping
Go to

More in accessories

Explore more in clips

clawsharkartificialshapehandmadedesigncolorswirepearl hairshark clips
stylealloyhairpinheartsolidlongtasselbangspartyplastic hair claw

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access