Everful

Wholesale dragon decor

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Dragon Decor

Find the perfect pieces: home decor accents & accessories, artificial decorations, artificial flowers and more

Popular collections in dragon decor

All products in dragon decor

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Easter Metal Rabbit Wreath Hanging Decoration Black Iron Bunny Silhouette Wall Art For Home Garden Festival Party Decor
Easter Metal Rabbit Wreath Hanging Decoration Black Iron Bunny Silhouette Wall Art For Home Garden Festival Party Decor
like
Find Similar
Detail of Easter metal wreath hanging decor with bunny silhouette and Easter text - Standing Rabbit
Detail showing the Easter metal wreath with rabbit silhouette and hanging hemp rope - Jumping Rabbit
Easter Metal Rabbit Wreath Hanging Decoration Black Iron Bunny Silhouette Wall Art For Home Garden Festival Party Decor
$2.28
Mix MOQ : 2
Nordic Christmas Wooden Reindeer Ornament With Artificial Fur Metal Pendant Red Nose Tabletop Holiday Party Home Decoration
Nordic Christmas Wooden Reindeer Ornament With Artificial Fur Metal Pendant Red Nose Tabletop Holiday Party Home Decoration
like
Find Similar
6 options
Nordic Christmas Wooden Reindeer Ornament With Artificial Fur Metal Pendant Red Nose Tabletop Holiday Party Home Decoration
$1.44-1.67
No MOQ
Resin Miniature Landscape Ornaments Simulation Peacock Deer Mushroom Tree House Figurines For DIY Fairy Garden Decoration
Resin Miniature Landscape Ornaments Simulation Peacock Deer Mushroom Tree House Figurines For DIY Fairy Garden Decoration
like
Find Similar
Miniature resin tree house ornament with green leaves and yellow windows for fairy gardens - Tree House Style (A Style)
Resin peacock figurine with vibrant green feathers on rock base for garden decor - Open Tail Peacock (B Style)
Realistic resin deer figurine in lying pose with white spots and detailed fur texture - Laying Deer (C Style)
Miniature resin sika deer figurine with white spots for fairy garden decor - Turning Head Standing Deer (D Style)
+6
Resin Miniature Landscape Ornaments Simulation Peacock Deer Mushroom Tree House Figurines For DIY Fairy Garden Decoration
$0.16-6.20
No MOQ
 · 
17 views
Free Shipping
Natural Crystal Skull Carving Agate Gemstone Hand Polished Mini Ghost Head Halloween Decoration Gothic Desktop Ornament
Natural Crystal Skull Carving Agate Gemstone Hand Polished Mini Ghost Head Halloween Decoration Gothic Desktop Ornament
like
Find Similar
Carved green aventurine quartz crystal skull figurine for Halloween decoration - Green Aventurine
Natural dream amethyst hand-carved crystal skull figurines with purple banded texture - Amethyst
Lapis lazuli skull figurine hand-carved from natural blue stone for Halloween decor - Lapis Lazuli
Natural Unakite gemstone skull carving showing unique green and pink floral texture - Unakite
+21
Natural Crystal Skull Carving Agate Gemstone Hand Polished Mini Ghost Head Halloween Decoration Gothic Desktop Ornament
$1.96
Mix MOQ : 2
 · 
143 sold recently
Free Shipping
Resin Pink Monkey Baby First Christmas Tree Hanging Ornament Cute Cartoon Animal Figurine Holiday Home Decoration Hanging Gift
Resin Pink Monkey Baby First Christmas Tree Hanging Ornament Cute Cartoon Animal Figurine Holiday Home Decoration Hanging Gift
like
Find Similar
Pink monkey resin Christmas ornament for baby's first holiday with custom name and date - Pink Monkey Hanging Ornament
Resin Pink Monkey Baby First Christmas Tree Hanging Ornament Cute Cartoon Animal Figurine Holiday Home Decoration Hanging Gift
$2.59
No MOQ
Handmade Mini Witch Broom Pendant With Pentagram Witch Tree Of Life Charm For Halloween Home Decor Car Keychain Ornament
Handmade Mini Witch Broom Pendant With Pentagram Witch Tree Of Life Charm For Halloween Home Decor Car Keychain Ornament
like
Find Similar
Handmade mini broom charm with jute twine and silver pentagram for home or car decor - 17*8cm / Pentagram Pendant
Mini handmade witch broom keychain with silver charm for Halloween car decor - 17*8cm / Witch Pendant
Mini altar broom keychain with silver pentagram and moon charm for car decoration - 17*8cm / Tree of Life Pendant
Detail shot of miniature handmade broom with purple crystal pendant and twine wrapping - 17*8cm / Amethyst Charm
+1
Handmade Mini Witch Broom Pendant With Pentagram Witch Tree Of Life Charm For Halloween Home Decor Car Keychain Ornament
$2.25
No MOQ
Colorful Birds On Branch Desktop Ornaments Stained Glass Style Acrylic Metal Tabletop Decor Modern Art Figurines
Colorful Birds On Branch Desktop Ornaments Stained Glass Style Acrylic Metal Tabletop Decor Modern Art Figurines
like
Find Similar
Stained glass art birds on branch decor with five colorful birds on wooden base - 5 Birds Ornament / Acrylic
Three colorful stained glass birds on a metal branch stand for home decoration - 3 Birds Ornament (Double Branch) / Metal
Three colorful stained glass birds on a bronze metal branch home decor accent - 3 Birds Ornament (Single Branch) / Acrylic
Stained glass bird figurines on a bronze branch base for colorful home decor accents - 3 Birds Ornament (Single Branch) / Metal
+6
Colorful Birds On Branch Desktop Ornaments Stained Glass Style Acrylic Metal Tabletop Decor Modern Art Figurines
$1.73-5.76
No MOQ
 · 
106 sold recently
Top 10% Best Sellers
in Home Decor
White Glitter Christmas Tree Hanging Ornament Plastic Clear Feather Angel Heart Snowflake Reindeer Bell Decor For Party
White Glitter Christmas Tree Hanging Ornament Plastic Clear Feather Angel Heart Snowflake Reindeer Bell Decor For Party
like
Find Similar
White heart Christmas ornament with feather tassel, pearl, and glitter for holiday decor - Heart Style
White beaded Christmas bell ornament with soft hanging feathers for tree decoration - Bell Style
Christmas transparent glitter reindeer pendant with white feather and pearl ornament - Reindeer Style
Christmas angel ornament with white feathers and beads, size 9.5x9cm, 15g weight - Angel Style
+1
NewWhite Glitter Christmas Tree Hanging Ornament Plastic Clear Feather Angel Heart Snowflake Reindeer Bell Decor For Party
$1.10
No MOQ
Halloween LED Lantern PVC Acrylic Simulation Flame Light Desktop Ornament Silhouette Pumpkin Witch Patterns Party Prop
Halloween LED Lantern PVC Acrylic Simulation Flame Light Desktop Ornament Silhouette Pumpkin Witch Patterns Party Prop
like
Find Similar
Halloween LED lantern in black with skull and pumpkin prints showing warm light effect - Large Candle Ghost Hand Lantern
Halloween pumpkin lantern lamp with ghost patterns showing unlit and warm glowing effect - Large Candle Pumpkin Lantern
Halloween decorative lantern with spooky castle silhouettes and warm yellow LED glow - Large Candle Castle Lantern
Halloween pumpkin lantern in black finish with silhouette patterns and glowing flame effect - Small Pumpkin Lantern
+8
Halloween LED Lantern PVC Acrylic Simulation Flame Light Desktop Ornament Silhouette Pumpkin Witch Patterns Party Prop
-35%
$0.88-2.05
Mix MOQ : 2
 · 
13 sold recently
Resin Snowman Family Christmas Tree Hanging Ornament Personalized DIY Snowflake Name Xmas Decoration Home Party Holiday Gift
Resin Snowman Family Christmas Tree Hanging Ornament Personalized DIY Snowflake Name Xmas Decoration Home Party Holiday Gift
like
Find Similar
Christmas resin snowman snowflake hanging ornament with 6 colorful figures for DIY names - 5 Snowmen
Personalized Christmas resin snowflake ornament with three cute colorful snowmen figurines - 3 Snowmen
Personalized Christmas resin snowman family ornament for seven members with white ribbon - 6 Snowmen
Customizable resin snowflake ornament with four colorful snowmen and white hanging ribbon - 4 Snowmen
+1
Resin Snowman Family Christmas Tree Hanging Ornament Personalized DIY Snowflake Name Xmas Decoration Home Party Holiday Gift
$1.73-2.02
Mix MOQ : 2
Handmade Bohemian Evil Eye Dream Catcher With Feathers Beads Life Tree For Bedroom Window Wall Hanging Decor Ornament
Handmade Bohemian Evil Eye Dream Catcher With Feathers Beads Life Tree For Bedroom Window Wall Hanging Decor Ornament
like
Find Similar
Detail of colorful Evil Eye dreamcatcher with pink feathers and Tree of Life charm - Pink White Purple Style (D7941)
Detail showing Evil Eye dream catcher with tree of life and soft blue feathers - Light Blue Gray Style (D7942)
Evil Eye dream catcher with blue feathers measuring 33cm wide and 60cm long for home decor - Blue Black Style (D7943)
Handmade Bohemian Evil Eye Dream Catcher With Feathers Beads Life Tree For Bedroom Window Wall Hanging Decor Ornament
$12.36
No MOQ
Christmas Cartoon Elf Curtain Buckle Plush Doll Holiday Hanging Pendant For Christmas Tree Home Party Decor Red Green
Christmas Cartoon Elf Curtain Buckle Plush Doll Holiday Hanging Pendant For Christmas Tree Home Party Decor Red Green
like
Find Similar
Christmas plush elf doll with red and green pointed hat and fabric clothes on white background - Female Elf (J-JY78)
Christmas elf plush curtain tieback in red and green knit with long hanging arms - Male Elf (J-JY77)
NewChristmas Cartoon Elf Curtain Buckle Plush Doll Holiday Hanging Pendant For Christmas Tree Home Party Decor Red Green
-5%
$4.52
No MOQ
Mediterranean Wooden Ocean Theme Seahorse Turtle Hanging Sign Nautical Wall Decor For Living Room Beach Party Decoration
Mediterranean Wooden Ocean Theme Seahorse Turtle Hanging Sign Nautical Wall Decor For Living Room Beach Party Decoration
like
Find Similar
Creative wooden seahorse wall hanging with nautical style laser cut hollow design - Seahorse
Detail of wooden sea turtle wall hanging with green shell and rustic nautical decor - Turtle
Mediterranean Wooden Ocean Theme Seahorse Turtle Hanging Sign Nautical Wall Decor For Living Room Beach Party Decoration
$0.95-1.33
No MOQ
Free Shipping
Halloween Gnome Plush Decorations Bat Black Cat Pumpkin Frankenstein Faceless Doll Ornaments For Holiday Home Party Table Decor
Halloween Gnome Plush Decorations Bat Black Cat Pumpkin Frankenstein Faceless Doll Ornaments For Holiday Home Party Table Decor
like
Find Similar
Gothic Halloween gnome plush with purple hat, green beard and black bat wings on wood base - Purple Bat Style (W-WS62)
Handmade Halloween Frankenstein gnome with green plush hat and long grey beard ornament - Green Frankenstein Style (W-WS63)
Halloween gnome plush with orange pumpkin hat, purple beard, and antlers on wood base - Orange Pumpkin Style (W-WS64)
Halloween black cat gnome plush with orange beard and cat ears on wooden base - Black Cat Ears Style (W-WS65)
NewHalloween Gnome Plush Decorations Bat Black Cat Pumpkin Frankenstein Faceless Doll Ornaments For Holiday Home Party Table Decor
$2.36
No MOQ
Harvest Festival LED Light Up Gnome Doll Sunflower Maple Leaf Linen Autumn Gnomes Plush Ornament For Home Party Decor
Harvest Festival LED Light Up Gnome Doll Sunflower Maple Leaf Linen Autumn Gnomes Plush Ornament For Home Party Decor
like
Find Similar
Harvest gnome with orange knit hat and sunflower detail for Thanksgiving decor - Male (White Beard) / Light-up
Fall gnome plush with sunflower hat, beige braids and Harvest Blessings pumpkin - Female (Braids) / Light-up
Harvest Festival LED Light Up Gnome Doll Sunflower Maple Leaf Linen Autumn Gnomes Plush Ornament For Home Party Decor
-4%
$3.70
No MOQ
Natural Gemstone Crystal Agate Frog Monster Carved Figurine Miniature Ornament For Desk Decoration Micro Landscape Cute
Natural Gemstone Crystal Agate Frog Monster Carved Figurine Miniature Ornament For Desk Decoration Micro Landscape Cute
like
Find Similar
Handcrafted tiger eye stone animal carving with natural brown and gold cat-eye texture - Tiger's Eye
Hand-carved natural amethyst phallic crystal figurine with polished purple stone finish - Amethyst
Handcrafted red jasper phallic small carving with black bead eyes on black background - Red Jasper
Cute green natural agate crystal monster figurine carving held in hand with black background - Green Aventurine
+11
Natural Gemstone Crystal Agate Frog Monster Carved Figurine Miniature Ornament For Desk Decoration Micro Landscape Cute
$2.59
No MOQ
 · 
47 sold recently
Streetwear Skeleton Alien Resin Figurine Wearing Hoodie Cool Skull Statue Home Desk Decor Halloween Gift
Streetwear Skeleton Alien Resin Figurine Wearing Hoodie Cool Skull Statue Home Desk Decor Halloween Gift
like
Find Similar
Detail of skeleton alien figurine in green hoodie and sneakers for garden decor - Emerald Green
Detail of skeleton alien figurine in blue hoodie and jeans for home garden decor - Navy Blue
Detailed view of skull alien figurine in orange hoodie and shoes with blue eyes - Orange
Close-up of green hoodie skeleton figurine on a decorative book with flowers - Dark Green
Streetwear Skeleton Alien Resin Figurine Wearing Hoodie Cool Skull Statue Home Desk Decor Halloween Gift
-5%
$4.32
No MOQ
 · 
12 sold recently
Handmade Crochet Mini Potted Flower Ornament Sunflower Tulip Rose Daisy Artificial Plant For Desktop Car Decor Gift
Handmade Crochet Mini Potted Flower Ornament Sunflower Tulip Rose Daisy Artificial Plant For Desktop Car Decor Gift
like
Find Similar
Handmade crochet sunflower potted plant on an orange background for desk decoration - Mini Pot / Little Sunflower Potted
Handmade crochet sunflower potted plant with yellow petals in a woven pot for desk decor - Mini Pot / Pointed Sunflower
Handmade crochet sunflower potted plant with a cute smiling face for desk decoration - Four-ringed Pointed Smiley Face (small Mini Yarn Bowl)
Handmade crochet sunflower potted plant with a cute smiling face for desk decor - Four Rounded Smiley Faces (small Mini Yarn Bowl)
+38
Handmade Crochet Mini Potted Flower Ornament Sunflower Tulip Rose Daisy Artificial Plant For Desktop Car Decor Gift
$1.15-1.96
Mix MOQ : 5
 · 
12 sold recently
Hand-Woven Cotton Macrame Wall Hanging Large Bohemian Tapestry With Tassels Nordic Decorative Wall Art For Home Living Room
Hand-Woven Cotton Macrame Wall Hanging Large Bohemian Tapestry With Tassels Nordic Decorative Wall Art For Home Living Room
like
Find Similar
Handmade bohemian mosaic tapestry with olive green and cream cotton fringe tassels - 120*85cm / Green
Bohemian handmade woven wall hanging tapestry with gradient fringe and wooden bar - 120*85cm / Gray
Handmade bohemian woven tapestry wall hanging with blue cotton tassels and wooden rod - 120*85cm / Sky Blue
Hand-Woven Cotton Macrame Wall Hanging Large Bohemian Tapestry With Tassels Nordic Decorative Wall Art For Home Living Room
$18.73
No MOQ
Soft Velvet Pumpkin Artificial Ornament Decorative Realistic For Halloween Thanksgiving Autumn Home Decor Multi Color
Soft Velvet Pumpkin Artificial Ornament Decorative Realistic For Halloween Thanksgiving Autumn Home Decor Multi Color
like
Find Similar
Deep purple velvet pumpkin decoration with a golden spiral stem for home holiday decor - 7cm / Purple
Elegant white velvet decorative pumpkin with a long twisted golden stem ornament - 7cm / White
Handcrafted purple velvet pumpkin decor with an elegant gold spiral stem for holidays - 7cm / Light Gray
Orange velvet pumpkin home decoration with realistic stem for Halloween and autumn table decor - 7cm / Orange
+40
Soft Velvet Pumpkin Artificial Ornament Decorative Realistic For Halloween Thanksgiving Autumn Home Decor Multi Color
-5%
$2.60-6.30
No MOQ
 · 
74 sold recently
Free Shipping
Easter Wooden Desktop Ornaments Colorful Wood Laser Cut Letter Signs Rabbit Egg Patterns Happy Easter Rejoice Spring Table Ornaments Festive Home Decor
Easter Wooden Desktop Ornaments Colorful Wood Laser Cut Letter Signs Rabbit Egg Patterns Happy Easter Rejoice Spring Table Ornaments Festive Home Decor
like
Find Similar
Easter SPRING wooden table ornament with purple base and cute bunny ear decorations - Purple Wood Ornament-SPRING
Easter wooden desk decor featuring a pink rabbit cart with REJOICE text and yellow chick - Purple Wood Ornament-REJOICE
Easter Wooden Desktop Ornaments Colorful Wood Laser Cut Letter Signs Rabbit Egg Patterns Happy Easter Rejoice Spring Table Ornaments Festive Home Decor
$1.41
Mix MOQ : 2
Halloween Gnomes Plush Decoration Boo Y'ALL LET'S GET Spooky Embroidered Faceless Doll Orange White Pumpkin Star Decor
Halloween Gnomes Plush Decoration Boo Y'ALL LET'S GET Spooky Embroidered Faceless Doll Orange White Pumpkin Star Decor
like
Find Similar
Halloween gnome with orange star-patterned body and white hat saying Let's Get Spooky - White
Halloween orange gnome doll with Boo Y'ALL embroidery and pumpkin pattern base - Orange
Halloween Gnomes Plush Decoration Boo Y'ALL LET'S GET Spooky Embroidered Faceless Doll Orange White Pumpkin Star Decor
$4.61
No MOQ
Happy Diwali Wooden Welcome Door Sign Peacock Mandala Marigold Hanging Plaque For Festival Celebration Indian Party Home Decor
Happy Diwali Wooden Welcome Door Sign Peacock Mandala Marigold Hanging Plaque For Festival Celebration Indian Party Home Decor
like
Find Similar
Deep purple and blue Diwali mandala wooden hanging plaque with Happy Diwali greeting - Mandala Style
28cm Happy Diwali round wooden sign with peacock and diya patterns for home decoration - Peacock Candle Style
Happy Diwali round wooden door sign with marigold flowers and diya lamp, 42cm total height - Marigold Style
NewHappy Diwali Wooden Welcome Door Sign Peacock Mandala Marigold Hanging Plaque For Festival Celebration Indian Party Home Decor
-4%
$1.78
Mix MOQ : 50
Plaid Plush Christmas Tree Hanging Decorations With Bells Santa Snowman Reindeer Bear Festive Holiday Home Party Decor
Plaid Plush Christmas Tree Hanging Decorations With Bells Santa Snowman Reindeer Bear Festive Holiday Home Party Decor
like
Find Similar
Classic Santa Claus Christmas tree hanging ornament with red plaid hat and golden bells - Santa Claus
Christmas snowman hanging ornament with red plaid fabric, faux fur and metal bells - Snowman
Christmas reindeer plush ornament with red scarf, grey skirt and golden bells on white background - Elk Style
Christmas plush bear ornament with red plaid hat, scarf and festive golden bells - Bear Style
Plaid Plush Christmas Tree Hanging Decorations With Bells Santa Snowman Reindeer Bear Festive Holiday Home Party Decor
-4%
$0.77
No MOQ
Nordic Christmas Gnome Faceless Doll Plush Santa Tomte Ornament Fabric Handmade Holiday Desktop Decoration Desktop Figurine
Nordic Christmas Gnome Faceless Doll Plush Santa Tomte Ornament Fabric Handmade Holiday Desktop Decoration Desktop Figurine
like
Find Similar
Forest green Christmas gnome plush doll with long white beard on a wooden surface - Green
Christmas gnome plush doll in red felt hat and white woolly trim for holiday decor - Red
Gray felt Christmas gnome with white faux fur trim and long beard in home setting - Grey
Nordic Christmas Gnome Faceless Doll Plush Santa Tomte Ornament Fabric Handmade Holiday Desktop Decoration Desktop Figurine
$2.54
No MOQ
Halloween Wooden DIY Puzzle Castle Ghost Pumpkin Decoration Desktop Ornament For Kids Party Home Holiday Festive Gift
Halloween Wooden DIY Puzzle Castle Ghost Pumpkin Decoration Desktop Ornament For Kids Party Home Holiday Festive Gift
like
Find Similar
Halloween DIY wooden ghost castle ornament set with laser-cut pumpkin and skull puzzle pieces - Halloween DIY Puzzle Ornament Style A
DIY Halloween wooden puzzle kit with ghost, pumpkin, and castle decor accessories - Halloween DIY Puzzle Ornament Style B
DIY Halloween wooden puzzle kit with Boo pumpkin and ghost castle 3D table ornament - Halloween DIY Puzzle Ornament Style C
DIY Halloween wooden puzzle kit with castle, ghost, and pumpkin, 23.3g compact size - Halloween DIY Puzzle Ornament Style D
Halloween Wooden DIY Puzzle Castle Ghost Pumpkin Decoration Desktop Ornament For Kids Party Home Holiday Festive Gift
-5%
$1.23
Mix MOQ : 2
Mini Cat Figurine Natural Crystal Gemstone Hand Carved Animal Statue Home Office Decor Healing Pocket Stone Cute
Mini Cat Figurine Natural Crystal Gemstone Hand Carved Animal Statue Home Office Decor Healing Pocket Stone Cute
like
Find Similar
Close-up of 1.2 inch hand-carved natural stone cat figurine on a green lawn - Larvikite
Macro detail of a 1.2 inch hand-carved natural stone cat figurine on green grass - Tianshan Blue
Detail of a 1.2-inch black natural stone cat figurine on green grass with a wooden backdrop - Obsidian
Close-up of a 1.2-inch natural stone cat figurine on grass with a polished finish - Aouyan Stone
+21
Mini Cat Figurine Natural Crystal Gemstone Hand Carved Animal Statue Home Office Decor Healing Pocket Stone Cute
$3.46
Mix MOQ : 2
 · 
72 sold recently
Free Shipping
Hand-Woven Macrame Wall Hanging Rainbow Cotton Rope Tassel Tapestry Nordic Bohemian Home Decor Art For Bedroom Living Room
Hand-Woven Macrame Wall Hanging Rainbow Cotton Rope Tassel Tapestry Nordic Bohemian Home Decor Art For Bedroom Living Room
like
Find Similar
Bohemian woven tapestry wall hanging with colorful rainbow patterns and tassels - 40*60cm / Dark Blue A
Bohemian woven macrame wall hanging with colorful geometric patterns and wood beads decor - 40*60cm / Brick Red B
Handmade Macrame rainbow wall hanging with colorful tassels and wooden beads for home decor - 40*60cm / Light Blue C
Hand-Woven Macrame Wall Hanging Rainbow Cotton Rope Tassel Tapestry Nordic Bohemian Home Decor Art For Bedroom Living Room
-3%
$7.20
No MOQ
 · 
24 sold recently
Tree Of Life Dreamcatcher With Purple Gravel Crystal Handmade Feather Wall Hanging Boho Home Bedroom Room Decor Ornament Gift
Tree Of Life Dreamcatcher With Purple Gravel Crystal Handmade Feather Wall Hanging Boho Home Bedroom Room Decor Ornament Gift
like
Find Similar
Tree of Life dreamcatcher with purple crystal stones and layered white feathers - Standard Style
Tree Of Life Dreamcatcher With Purple Gravel Crystal Handmade Feather Wall Hanging Boho Home Bedroom Room Decor Ornament Gift
$8.79
No MOQ
3D Realistic Dinosaur Wall Sticker Broken Wall Effect Waterproof PVC Removable Decal For Kids Room Bedroom Living Room Home Decor
3D Realistic Dinosaur Wall Sticker Broken Wall Effect Waterproof PVC Removable Decal For Kids Room Bedroom Living Room Home Decor
like
Find Similar
Detailed dimensions of 3D dinosaur wall stickers set with 90cm x 30cm size specifications - Style AL (KS6797AL)
Macro view of 3D dinosaur wall sticker measuring 60x40cm with realistic cracked wall effect - Style AS (KS6797AS)
Detail view of 3D dinosaur wall sticker featuring T-Rex and raptors measuring 40x60cm - Style BS (KS6797BS)
Detailed view of 3D dinosaur wall sticker with dimensions 60x40cm showing a T-Rex effect - Style CS (KS6797CS)
+4
3D Realistic Dinosaur Wall Sticker Broken Wall Effect Waterproof PVC Removable Decal For Kids Room Bedroom Living Room Home Decor
$1.21-1.87
No MOQ
Abstract Human Figurine Resin Natural Crystal Stone Filled Desktop Ornament Modern Minimalist Office Home Decor Statue
Abstract Human Figurine Resin Natural Crystal Stone Filled Desktop Ornament Modern Minimalist Office Home Decor Statue
like
Find Similar
Abstract resin figurine with yellow natural crystal stones for modern desktop decor - White Crystal
Minimalist pink rose quartz resin figurine in a meditative praying posture - Rose Quartz
Meditating resin figurine with purple amethyst crystal stones on a white background - Amethyst
Abstract figure statue crafted from transparent resin filled with natural purple amethyst - Dreamy Purple
+30
Abstract Human Figurine Resin Natural Crystal Stone Filled Desktop Ornament Modern Minimalist Office Home Decor Statue
$1.73
Mix MOQ : 2
 · 
24 sold recently
Cartoon Flying Dragon Clouds Stars Luminous Wall Stickers Glow In The Dark PVC Self Adhesive Decals For Kids Bedroom Decoration
Cartoon Flying Dragon Clouds Stars Luminous Wall Stickers Glow In The Dark PVC Self Adhesive Decals For Kids Bedroom Decoration
like
Find Similar
Close-up of luminous cartoon dragon and star wall stickers glowing green in the dark - Green Glow (MG-YP035)
Luminous wall stickers featuring cartoon dragons stars and clouds in a dark room setting - Blue Glow (MG-YP035)
Cartoon Flying Dragon Clouds Stars Luminous Wall Stickers Glow In The Dark PVC Self Adhesive Decals For Kids Bedroom Decoration
$3.17
No MOQ
Angel Rabbit Ear Girl Doll Pendant Mesh Sequin Fabric Angel Wings Star Wand Christmas Tree Hanging Festive Ornament
Angel Rabbit Ear Girl Doll Pendant Mesh Sequin Fabric Angel Wings Star Wand Christmas Tree Hanging Festive Ornament
like
Find Similar
Pink rabbit ear angel pendant with golden wings and sequin skirt for Christmas decor - Pink
White angel Christmas ornament with bunny ears gold wings and sparkly star wand - White
NewAngel Rabbit Ear Girl Doll Pendant Mesh Sequin Fabric Angel Wings Star Wand Christmas Tree Hanging Festive Ornament
$1.70
No MOQ
Free Shipping
Easter Wood Egg Rooster Chick Hanging Pendant Festive Hollow Design Ribbon Bead Ornament Pink Green Red Holiday Decor
Easter Wood Egg Rooster Chick Hanging Pendant Festive Hollow Design Ribbon Bead Ornament Pink Green Red Holiday Decor
like
Find Similar
Easter wooden egg ornament with pink waves and hen motif featuring checkered ribbons - Pink Style
Easter egg-shaped wooden pendant featuring a chicken design in green and natural tones - Green Style
Easter wooden hanging ornament featuring a hen and chick design with red floral lace - Red Style
Easter Wood Egg Rooster Chick Hanging Pendant Festive Hollow Design Ribbon Bead Ornament Pink Green Red Holiday Decor
$1.38
Mix MOQ : 2
Handmade Amethyst Witch Besom Altar Decor With Peacock Feather Natural Straw Crystal Healing Ornament For Halloween Ritual
Handmade Amethyst Witch Besom Altar Decor With Peacock Feather Natural Straw Crystal Healing Ornament For Halloween Ritual
like
Find Similar
Detailed handcrafted altar broom featuring natural amethyst crystal and peacock feathers - Sun Face
Altar decorative broom featuring natural amethyst tree of life and peacock feathers - Small Moon
Handmade amethyst witch besom broom with peacock feathers and silver bee charm - Bee
Handmade amethyst witch besom with peacock feathers and triple moon on gray wall - Triple Moon
+5
Handmade Amethyst Witch Besom Altar Decor With Peacock Feather Natural Straw Crystal Healing Ornament For Halloween Ritual
-4%
$6.99
No MOQ
Metal Butterfly Wall Decor Colorful Hand Painted 3D Hanging Ornament For Garden Fence Patio Indoor Outdoor
Metal Butterfly Wall Decor Colorful Hand Painted 3D Hanging Ornament For Garden Fence Patio Indoor Outdoor
like
Find Similar
Colorful metal butterfly wall decor in purple and pink gradient, 16x12 cm size guide - Purple
Blue metal butterfly wall art decor with black spots and 16x12cm size markings - Blue
Green butterfly iron wall art for garden decor with 16cm width and 12cm height - Green
Orange butterfly metal wall decor measuring 16x12cm for indoor and outdoor garden use - Yellow
Metal Butterfly Wall Decor Colorful Hand Painted 3D Hanging Ornament For Garden Fence Patio Indoor Outdoor
$2.07
Mix MOQ : 3
 · 
16 sold recently
Halloween Party Hanging Swirl Decorations PVC Spiral Pendants Pumpkin Witch Skeleton Vampire Cartoon Cardboard Ceiling Ornaments
Halloween Party Hanging Swirl Decorations PVC Spiral Pendants Pumpkin Witch Skeleton Vampire Cartoon Cardboard Ceiling Ornaments
like
Find Similar
Halloween spiral swirls with cartoon skull musicians playing colorful instruments - Black Swirl + Skeleton
Set of Halloween spiral hanging decorations featuring cute cartoon pumpkin characters - Black Swirl + Dagger Pumpkin
Halloween party decorations featuring eight pumpkin jack-o-lantern hanging swirl pendants - Black Swirl + Pumpkin
Halloween spiral ceiling hanging set with pumpkin witch ghost and skull card pendants - Black Swirl + Witch
+4
Halloween Party Hanging Swirl Decorations PVC Spiral Pendants Pumpkin Witch Skeleton Vampire Cartoon Cardboard Ceiling Ornaments
$0.88-1.34
Mix MOQ : 2
Handmade Mini Witch Broom Pendant Natural Twig Broomstick With Halloween Charms Pumpkin Skeleton Bat Ghost Home Party Decor
Handmade Mini Witch Broom Pendant Natural Twig Broomstick With Halloween Charms Pumpkin Skeleton Bat Ghost Home Party Decor
like
Find Similar
Mini Halloween witch broom with pumpkin pendant and wooden handle over a black background - Little Pumpkin Green
Mini witch broom decor with a golden skull pendant and natural straw textures - Golden Witch
Detailed close-up of a mini witch broom with skull charm for Halloween home decoration - Black Witch
Miniature witch broom with vampire pendant and Halloween festive decorative props - Ghost
+14
Handmade Mini Witch Broom Pendant Natural Twig Broomstick With Halloween Charms Pumpkin Skeleton Bat Ghost Home Party Decor
$0.83
No MOQ
 · 
12 views
Heart Shaped Dreamcatcher Handmade Feather Lace Wall Hanging Decor With LED Lights For Bedroom Wedding Romantic Boho
Heart Shaped Dreamcatcher Handmade Feather Lace Wall Hanging Decor With LED Lights For Bedroom Wedding Romantic Boho
like
Find Similar
Black heart dream catcher with white web and red feathers, 10cm width and 9g weight - Black with Red Feathers
Handcrafted brown and blue dream catcher with feathers, beads and a center crystal - Brown without Lights
White heart-shaped dream catcher with LED lights and soft feathers on pink background - Linen with Lights
White heart-shaped dream catcher with feathers and beads on window background - White Double Heart
+15
Heart Shaped Dreamcatcher Handmade Feather Lace Wall Hanging Decor With LED Lights For Bedroom Wedding Romantic Boho
-5%
$1.34-3.70
No MOQ
 · 
82 views
Creative Infant First Christmas Ornament Resin Baby Bear Christmas Ball Hanging Decor For Xmas Tree Home Party Decoration
Creative Infant First Christmas Ornament Resin Baby Bear Christmas Ball Hanging Decor For Xmas Tree Home Party Decoration
like
Find Similar
Baby on red Christmas ornament with white snowflake details and custom name space - Red
Pink baby holding Christmas ornament with snowflakes and customizable white banner - Pink
Creative Christmas ornament featuring a baby in blue pajamas hugging a snowflake balloon - Blue
Creative Infant First Christmas Ornament Resin Baby Bear Christmas Ball Hanging Decor For Xmas Tree Home Party Decoration
$2.31
Mix MOQ : 2
 · 
12 views
St Patricks Day Gnomes Plush Decorations Green Shamrock Irish Tomte Ornaments Glitter Top Hat Long Leg Handmade Home Decor
St Patricks Day Gnomes Plush Decorations Green Shamrock Irish Tomte Ornaments Glitter Top Hat Long Leg Handmade Home Decor
like
Find Similar
St. Patrick's Day gnome figurine with orange beard and sequin clover hat on decor books - Square Hat
St. Patrick's Day gnome figurine with green sequin hat, orange braids and shamrock detail - Pointed Hat
NewSt Patricks Day Gnomes Plush Decorations Green Shamrock Irish Tomte Ornaments Glitter Top Hat Long Leg Handmade Home Decor
$2.74
No MOQ
 · 
30 sold recently
Patriotic Independence Day Gnome Plush Decorations Stars And Stripes Faceless Doll Ornament For Home Holiday Party Decor
Patriotic Independence Day Gnome Plush Decorations Stars And Stripes Faceless Doll Ornament For Home Holiday Party Decor
like
Find Similar
Patriotic 4th of July faceless gnome plush decoration with dimensions 25x10x5 cm - Horizontal Stripes
Patriotic USA Independence Day gnome plush doll with stars and stripes design, 25cm height - Blue Star
Patriotic USA Independence Day gnome plush with red stripes and blue star hat decoration - Vertical Striped
Patriotic Independence Day Gnome Plush Decorations Stars And Stripes Faceless Doll Ornament For Home Holiday Party Decor
$2.59
No MOQ
Realistic Unicorn Pegasus Animal Model Figures Rainbow Mane Glitter Wings Plastic Mythical Creature Decoration Toy For Kids
Realistic Unicorn Pegasus Animal Model Figures Rainbow Mane Glitter Wings Plastic Mythical Creature Decoration Toy For Kids
like
Find Similar
Rainbow unicorn toy figure with colorful mane and glitter details 8.5x3x8.3cm - White Unicorn - Rainbow Dots / White
Rainbow Unicorn figurine in white with glittery purple and blue gradient mane - White Unicorn - Purple Blue Gradient / White
Pink rainbow unicorn toy figure with glitter mane and gemstone details 10x8.7cm - Pink Rainbow Unicorn - Gemstone Style / Pink
Rainbow Pegasus toy model featuring colorful gradient wings and golden glitter finish - White Pegasus - Rainbow Wings / White
+2
Realistic Unicorn Pegasus Animal Model Figures Rainbow Mane Glitter Wings Plastic Mythical Creature Decoration Toy For Kids
-5%
$1.97-9.86
No MOQ
 · 
50 sold recently
Miniature Plate Resin Chinese Blue And White Porcelain Pattern Mini Bowl Dollhouse Accessories Tabletop Micro Landscape
Miniature Plate Resin Chinese Blue And White Porcelain Pattern Mini Bowl Dollhouse Accessories Tabletop Micro Landscape
like
Find Similar
Set of 10 miniature blue and white porcelain plates with koi and floral patterns - Mixed Color Style
Set of 2 miniature blue and white ceramic plates for dollhouse DIY decor, 0.7x2.6cm - Square Plate - Blue Leaves Red Berries
Detailed top view of miniature rectangular ceramic trays with lotus and koi fish patterns - Square Plate - Fish Playing in Lotus Leaves
Miniature white ceramic trays with koi carp prints for dollhouse or jewelry display - Square Plate - Koi Pattern
+7
Miniature Plate Resin Chinese Blue And White Porcelain Pattern Mini Bowl Dollhouse Accessories Tabletop Micro Landscape
$0.08
Mix MOQ : 5
 · 
101 sold recently
St Patrick's Day Gnome Ornament Plush Faceless Doll Shamrock Green Sequin Hat Long Leg Irish Figurine Home Party Decor
St Patrick's Day Gnome Ornament Plush Faceless Doll Shamrock Green Sequin Hat Long Leg Irish Figurine Home Party Decor
like
Find Similar
St. Patrick's Day gnome with clover hat, white braids, and long legs on books - Long Legged Female Style
St. Patrick's Day gnome with long legs and clover hat sitting on white books - Long Legged Male Style
Green St. Patrick's Day gnome plush with knitted glitter hat and clover detail - Male Without Legs
Green St. Patrick's Day gnome plush with shamrock sequins and long braided beard - Female Without Legs
St Patrick's Day Gnome Ornament Plush Faceless Doll Shamrock Green Sequin Hat Long Leg Irish Figurine Home Party Decor
$2.02-2.07
No MOQ
 · 
20 sold recently
3D Gnome Christmas Stocking Knit Plush Large Candy Gift Bag For Fireplace Christmas Tree Party Home Decoration
3D Gnome Christmas Stocking Knit Plush Large Candy Gift Bag For Fireplace Christmas Tree Party Home Decoration
like
Find Similar
Green knit Christmas stocking with a 3D forest gnome and white plush faux fur cuff decoration - Style B Green Knit Stocking (F-W208) / Green
Red knit Christmas gnome stocking with white faux fur trim and gray striped hat gnome - Style A Red Knit Stocking (F-W207) / Red
Grey knitted Christmas stocking with forest gnome and white faux fur trim decor - Style C Gray Knit Stocking (F-W206) / Gray
3D Gnome Christmas Stocking Knit Plush Large Candy Gift Bag For Fireplace Christmas Tree Party Home Decoration
-5%
$4.52
No MOQ
Miniature Dollhouse Wood Plant Stand Rack With Potted Plants Simulation Greenery Mini Furniture Model DIY Decoration Ornaments
Miniature Dollhouse Wood Plant Stand Rack With Potted Plants Simulation Greenery Mini Furniture Model DIY Decoration Ornaments
like
Find Similar
Miniature wooden 2-tier plant stand with four tiny potted green plants for dollhouse - Rack and Type 1 Plants
Miniature double-layer wooden dollhouse plant stand with four tiny red and green potted plants - Rack and Type 2 Plants
Miniature double-layer dark brown wood plant stand with four tiny green potted plants - Rack and Type 3 Plants
Miniature brown wood plant stand with four tiny potted green plants for dollhouses - Rack and Type 4 Plants
Miniature Dollhouse Wood Plant Stand Rack With Potted Plants Simulation Greenery Mini Furniture Model DIY Decoration Ornaments
-4%
$2.34
Mix MOQ : 2
 · 
14 sold recently
Cartoon Animal Paper Garland Banner For Kids Birthday Party Decoration Bunting Background Wall Props Festive Supplies
Cartoon Animal Paper Garland Banner For Kids Birthday Party Decoration Bunting Background Wall Props Festive Supplies
like
Find Similar
Close-up of pastel unicorn and castle paper bunting flags for birthday party decoration - Unicorn Castle (KT-1)
Close-up of paper princess banners with size 13x22cm and total length of 3 meters - Princess Flowers (KT-2)
Detail view of flamingo party banner with tropical leaves and flowers on a 3M paper string - Tropical Flamingo (KT-3)
Detail of princess theme party bunting with castle and carriage icons, 3m paper banner - Castle Carriage (KT-4)
+5
Cartoon Animal Paper Garland Banner For Kids Birthday Party Decoration Bunting Background Wall Props Festive Supplies
-5%
$0.44-0.52
Mix MOQ : 2
3D Printed Surprise Egg Satin PLA Gradient Color Easter Dragon Egg Container Decorative Desk Ornament Novelty Toy Gift
3D Printed Surprise Egg Satin PLA Gradient Color Easter Dragon Egg Container Decorative Desk Ornament Novelty Toy Gift
like
Find Similar
3D printed rainbow metallic Easter surprise egg with two-piece nesting design - Multicolor Three-color Gradient / 5.2*5.2*6.8cm
3D printed dragon egg storage box with purple-blue gradient and textured surface - Purple Blue Gradient / 5.2*5.2*6.8cm
3D printed rainbow gradient Easter egg container made of PLA plastic with zigzag opening - Blue Green Gradient / 5.2*5.2*6.8cm
Green 3D printed Easter surprise egg with textured surface and zigzag opening line - Yellow Green Gradient / 5.2*5.2*6.8cm
+2
3D Printed Surprise Egg Satin PLA Gradient Color Easter Dragon Egg Container Decorative Desk Ornament Novelty Toy Gift
$1.73
Mix MOQ : 3
 · 
87 views
Christmas Angel Plush Doll Hanging Pendant For Christmas Tree Decoration Cute Fairy Girl With Sequin Wings Star Mesh Skirt Holiday Party Home Decor
Christmas Angel Plush Doll Hanging Pendant For Christmas Tree Decoration Cute Fairy Girl With Sequin Wings Star Mesh Skirt Holiday Party Home Decor
like
Find Similar
Pink plush angel doll Christmas tree ornament with gold sequin stars and reindeer antlers - Pink
Plush Christmas angel doll in grey dress with gold heart and sparkly wings tree decor - Gray
White and gold plush Christmas angel doll with sequin skirt and golden wings pendant - White
Christmas Angel Plush Doll Hanging Pendant For Christmas Tree Decoration Cute Fairy Girl With Sequin Wings Star Mesh Skirt Holiday Party Home Decor
$1.82
No MOQ
Mardi Gras Wood Sign Carnival Hanging Decoration Purple Green Gold Fleur-de-lis Mask Design Wooden Plaque For Home Party Door Decor
Mardi Gras Wood Sign Carnival Hanging Decoration Purple Green Gold Fleur-de-lis Mask Design Wooden Plaque For Home Party Door Decor
like
Find Similar
Mardi Gras fleur-de-lis wooden sign with mask design and size dimensions in inches - Purple Green Gold Fleur-de-lis Wooden Sign
Mardi Gras jester hat wooden door sign in green, purple, and gold with size specs - Mardi Gras Lettering Rectangular Wooden Sign
Mardi Gras wooden round sign with masks and size dimensions for party decoration - Mask Lettering Round Sign
Mardi Gras Wood Sign Carnival Hanging Decoration Purple Green Gold Fleur-de-lis Mask Design Wooden Plaque For Home Party Door Decor
$1.15-2.49
Mix MOQ : 50
Mushroom Shaped Wooden Crystal Display Shelf Wall Hanging Storage Rack Multi-grid Boho Home Decor For Living Room Bedroom
Mushroom Shaped Wooden Crystal Display Shelf Wall Hanging Storage Rack Multi-grid Boho Home Decor For Living Room Bedroom
like
Find Similar
Detailed dimension guide for mushroom wooden shelf showing height and thickness measurements - Mushroom Shaped Multi Grid (ms9541)
Mushroom Shaped Wooden Crystal Display Shelf Wall Hanging Storage Rack Multi-grid Boho Home Decor For Living Room Bedroom
$10.35
No MOQ
Watercolor Easter Bunny Wall Hanging Tapestry With Wooden Rod Tassel Cartoon Rabbit Chick Egg Decorative Home Art Painting
Watercolor Easter Bunny Wall Hanging Tapestry With Wooden Rod Tassel Cartoon Rabbit Chick Egg Decorative Home Art Painting
like
Find Similar
Detail of Happy Easter tapestry with cartoon rabbit, chick, and black tassels - Medium Wall Hanging / Chick Bunny Heart Egg Style (Style 1)
Detail of Easter wall tapestry featuring white rabbits and tassels on a green background - Medium Wall Hanging / Three White Bunnies Egg Style (Style 2)
Easter bunny tapestry with watercolor floral basket and black tassels for wall decor - Medium Wall Hanging / Brown Bunny in Basket Lavender Style (Style 3)
Detail of Easter wall tapestry featuring watercolor bunnies and Happy Easter text with tassels - Medium Wall Hanging / Retro White Bunnies Playing Trombone Style (Style 4)
+6
Watercolor Easter Bunny Wall Hanging Tapestry With Wooden Rod Tassel Cartoon Rabbit Chick Egg Decorative Home Art Painting
$2.85
Mix MOQ : 2
Dreamcatcher Wall Hanging Decor With Natural Feathers Iron Ring Animal Pattern Bohemian Tribal Style Home Ornament
Dreamcatcher Wall Hanging Decor With Natural Feathers Iron Ring Animal Pattern Bohemian Tribal Style Home Ornament
like
Find Similar
Three-tier dreamcatcher featuring a wolf canvas, brown feathers, and black beads - Wolf Head Multi-Ring (MS8040B)
Wolf howling oil painting dreamcatcher wall hanging with natural brown feathers and beads - Wolf Cubs Multi-Ring (MS8040A)
Native American dreamcatcher with eagle painting, yellow mesh, and brown white feathers - Eagle Multi-Ring (MS8040C)
Native American dreamcatcher with black bear painting and natural brown feathers - Black Bear Multi-Ring (MS8040D)
+1
Dreamcatcher Wall Hanging Decor With Natural Feathers Iron Ring Animal Pattern Bohemian Tribal Style Home Ornament
-5%
$2.60
No MOQ
 · 
25 sold recently
Bat Owl Bird Suncatcher Acrylic Stained Glass Style Window Hanging Gothic Halloween Decor Indoor Home Wall Ornament
Bat Owl Bird Suncatcher Acrylic Stained Glass Style Window Hanging Gothic Halloween Decor Indoor Home Wall Ornament
like
Find Similar
Detailed size specifications and waterproof features for acrylic bat window decor - Bat 01 / Thickness 0.3cm
8x8 inch red cardinal suncatcher bird ornament with stained glass acrylic texture - Red Bird / Thickness 0.2cm
Acrylic bat suncatcher with galaxy pattern and branch detail, 8x7 inch Halloween decor - Hanging Bat / Thickness 0.2cm
Colorful hummingbird suncatcher ornament in acrylic stained glass style with gold cord - Diamond Bird / Thickness 0.3cm
+10
Bat Owl Bird Suncatcher Acrylic Stained Glass Style Window Hanging Gothic Halloween Decor Indoor Home Wall Ornament
$1.22-2.45
No MOQ
 · 
124 sold recently
3D Christmas Paper Wreath Glitter Santa Claus Snowman Reindeer Pattern Hanging Ornaments For Xmas Party Home Wall Window Decoration
3D Christmas Paper Wreath Glitter Santa Claus Snowman Reindeer Pattern Hanging Ornaments For Xmas Party Home Wall Window Decoration
like
Find Similar
3D glitter paper Christmas wreath with red bow and Merry Christmas sign hanging decor - Christmas Bell and Bow Style (ZHY-002)
3D paper Christmas wreath with Santa Claus, reindeer, snowman and red glitter bow - Santa Claus and Reindeer Style (ZHY-004)
3D paper Christmas wreath with Santa Claus snowman bell and red ribbon hanger - Santa Claus and Snowman Style (ZHY-008)
3D Christmas wreath with Santa Claus, snowman, and Merry Christmas text decor - Triple Santa Claus Style (ZHY-009)
+1
3D Christmas Paper Wreath Glitter Santa Claus Snowman Reindeer Pattern Hanging Ornaments For Xmas Party Home Wall Window Decoration
$1.10
Mix MOQ : 2
Gothic Black Cat Resin Figurine Halloween Dark Fantasy Monk Assassin Wizard Statue Home Decor Desktop Ornament Gift
Gothic Black Cat Resin Figurine Halloween Dark Fantasy Monk Assassin Wizard Statue Home Decor Desktop Ornament Gift
like
Find Similar
Gothic black cat nun figurine resin Halloween decor with rose hood and yellow eyes - Monk Cat with Beads
Halloween black cat assassin resin figurine with hooded cloak and dagger - Assassin Cat with Sword
Gothic black cat wizard resin figurine with hooded robe for Halloween home decor - Wizard Cat with Talisman
Gothic black cat resin figurine with gold filigree cloak for Halloween home decor - Priest Cat in Golden Robe
Gothic Black Cat Resin Figurine Halloween Dark Fantasy Monk Assassin Wizard Statue Home Decor Desktop Ornament Gift
$10.09
Mix MOQ : 2
Halloween Cat Shaped Wreath Decoration Foldable PET Tinsel Wreath Door Wall Hanging With Satin Bow For Party Home Decor
Halloween Cat Shaped Wreath Decoration Foldable PET Tinsel Wreath Door Wall Hanging With Satin Bow For Party Home Decor
like
Find Similar
Halloween cat-shaped tinsel wreath with purple bow and foldable design 47cm x 45cm - Large Black Cat Style
Foldable Halloween black tinsel cat wreath with purple bow, dimensions 42cm by 36cm - Small Black Cat Style
Halloween Cat Shaped Wreath Decoration Foldable PET Tinsel Wreath Door Wall Hanging With Satin Bow For Party Home Decor
-4%
$8.08-8.63
Mix MOQ : 2
Halloween Gnome Plush Doll Decoration With Broom Pumpkin Sign Rudolf Faceless Dwarf Doll For Home Party Holiday Ornament
Halloween Gnome Plush Doll Decoration With Broom Pumpkin Sign Rudolf Faceless Dwarf Doll For Home Party Holiday Ornament
like
Find Similar
Halloween gnome with orange pumpkin hat, white beard, holding a broom and a spider charm - Forest Gnome with Broom (X-Y25)
Halloween gnome plush with purple spider web hat and Happy Halloween sign - Forest Gnome with Happy Halloween Sign (X-Y26)
Halloween Gnome Plush Doll Decoration With Broom Pumpkin Sign Rudolf Faceless Dwarf Doll For Home Party Holiday Ornament
$2.55
No MOQ
Halloween Party Decoration Set Orange Black Foil Fringe Curtain With Pumpkin Spider Skeleton Banner For Home Bar Decor
Halloween Party Decoration Set Orange Black Foil Fringe Curtain With Pumpkin Spider Skeleton Banner For Home Bar Decor
like
Find Similar
Orange and black Halloween tinsel curtain with bat and spider web fringe decorations - Orange Black Fringe Curtain + Skull Banner
Halloween fringe curtain in orange and black with bat and pumpkin decorative motifs - Orange Fringe Curtain + Cat Pumpkin Banner
Halloween black tinsel curtain with Happy Halloween cutout letters and spider web decor - Black Fringe Curtain + Spider Banner
Orange tinsel curtain with black Halloween laser-cut felt banner, weight 117g - Orange Fringe Curtain + Pumpkin Spider Web Banner
+4
Halloween Party Decoration Set Orange Black Foil Fringe Curtain With Pumpkin Spider Skeleton Banner For Home Bar Decor
-5%
$2.68-3.78
Mix MOQ : 2
Go to

More in home & kitchen

Explore more in dragon decor

homewallroomkidshandmadepartyshapestarsholderhollow
alloystyledesktopmetaldiydailyeyemakingsilvertassels

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access