Everful

Wholesale heart shaped boxes

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Heart Shaped Boxes

Find the perfect pieces: party gift bags, party favors, gift wrapping supplies and more

All products in heart shaped boxes

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Thanksgiving Greeting Cards Assorted Autumn Harvest Turkey Pumpkin Illustrations With Envelopes For Holiday Message Wishes
Thanksgiving Greeting Cards Assorted Autumn Harvest Turkey Pumpkin Illustrations With Envelopes For Holiday Message Wishes
like
Find Similar
Set of 6 Thanksgiving cards featuring pumpkins and turkeys on an autumn-themed background - Autumn Thanksgiving Illustration Series (s617)
Thanksgiving Greeting Cards Assorted Autumn Harvest Turkey Pumpkin Illustrations With Envelopes For Holiday Message Wishes
$0.92
No MOQ
Wedding Gift Bags Paper Foil Hot Stamping Team Bride Team Groom Party Souvenir Bridal Shower Handheld
Wedding Gift Bags Paper Foil Hot Stamping Team Bride Team Groom Party Souvenir Bridal Shower Handheld
like
Find Similar
Detail of black and white wedding gift bags with Team Bride and Groom gold foil prints - 22*19*9CM / Black / Gold Text Groomsman
European wedding gift bags featuring Team Bride and Team Groom elegant silver foil prints - 22*19*9CM / Black / Silver Text Groomsman
Elegant black and white paper gift bags for Team Bride and Team Groom wedding favors - 22*19*9CM / Black / Rose Gold Text Groomsman
+3
Wedding Gift Bags Paper Foil Hot Stamping Team Bride Team Groom Party Souvenir Bridal Shower Handheld
-10%
$0.52
No MOQ
 · 
22 views
Self Adhesive Kraft Paper Label Stickers Blank Retro Decorative Border Tags For Kitchen Jars Food Containers Gift Wrapping Office Organization
Self Adhesive Kraft Paper Label Stickers Blank Retro Decorative Border Tags For Kitchen Jars Food Containers Gift Wrapping Office Organization
like
Find Similar
Roll of self-adhesive kraft paper labels with vintage decorative borders for kitchen jars - 50*30mm / Brown
Self Adhesive Kraft Paper Label Stickers Blank Retro Decorative Border Tags For Kitchen Jars Food Containers Gift Wrapping Office Organization
$1.67
No MOQ
 · 
10 views
Christmas 3D Pop-Up Greeting Card Laser Holographic Tree Design Holiday Blessing Cardboard Gift Message Card
Christmas 3D Pop-Up Greeting Card Laser Holographic Tree Design Holiday Blessing Cardboard Gift Message Card
like
Find Similar
3D pop-up Christmas card with iridescent laser tree and silver snowflake patterns - 110mmx195mm / Blue
3D pop-up Christmas card featuring a green glittery tree and Merry Christmas text - 110mmx195mm / Green
Red 3D pop-up Christmas tree card with holographic silver background 110x195mm - 110mmx195mm / Red
Christmas 3D Pop-Up Greeting Card Laser Holographic Tree Design Holiday Blessing Cardboard Gift Message Card
$2.88
No MOQ
Christmas Tree Stickers Merry Christmas Labels Self-Adhesive Decals For Holiday Gift Packaging Envelope Seals
Christmas Tree Stickers Merry Christmas Labels Self-Adhesive Decals For Holiday Gift Packaging Envelope Seals
like
Find Similar
Green and red Christmas tree shaped stickers with Merry Christmas text for envelopes - 2.2*1.8 Inch (10 Sheets/Pack)
Christmas Tree Stickers Merry Christmas Labels Self-Adhesive Decals For Holiday Gift Packaging Envelope Seals
$1.56
No MOQ
Halloween Sticker Roll Pumpkin Ghost Castle Pattern Self Adhesive Decorative Labels For Kids Gift Packaging Party Decal
Halloween Sticker Roll Pumpkin Ghost Castle Pattern Self Adhesive Decorative Labels For Kids Gift Packaging Party Decal
like
Find Similar
Roll of 500 Halloween stickers featuring pumpkins, ghosts, and bats for decorations - 1 Inch - 2.5cm (L219)
500-count Halloween stickers roll with 8 cartoon designs including pumpkins and ghosts - 1.5 Inch - 3.8cm (L220)
Halloween Sticker Roll Pumpkin Ghost Castle Pattern Self Adhesive Decorative Labels For Kids Gift Packaging Party Decal
-6%
$0.27-0.96
No MOQ
Luxury Laser Cut Rose Floral Wedding Invitation Cards European Pearlescent Paper Greeting Cards For Engagement Party Decor
Luxury Laser Cut Rose Floral Wedding Invitation Cards European Pearlescent Paper Greeting Cards For Engagement Party Decor
like
Find Similar
Laser cut white rose wedding invitation suite with floral inner card and greeting - White
Laser-cut rose wedding invitation in dark purple with floral inner card and pearly finish - Dark Blue
Macro view of laser-cut burgundy rose wedding invitation with elegant floral details - Dark Red
Detailed laser-cut gold rose wedding invitation cover on an elegant ceramic plate - Beige Gold
+7
Luxury Laser Cut Rose Floral Wedding Invitation Cards European Pearlescent Paper Greeting Cards For Engagement Party Decor
$0.43
Mix MOQ : 50
Christmas Gift Tags Kraft Paper Hanging Labels Merry Christmas Holiday Wrapping Decor Santa Snowman Patterns Hemp Rope
Christmas Gift Tags Kraft Paper Hanging Labels Merry Christmas Holiday Wrapping Decor Santa Snowman Patterns Hemp Rope
like
Find Similar
50pcs Kraft paper Christmas tags set with 10 festive designs and strings for gift wrapping - 50 Tags + 50 Natural Twine
50-piece Christmas kraft paper gift tag set with 10 festive designs and cotton ropes - 50 Tags + 50 Red & White Cotton Ropes
Christmas Gift Tags Kraft Paper Hanging Labels Merry Christmas Holiday Wrapping Decor Santa Snowman Patterns Hemp Rope
$1.12
No MOQ
Elegant Laser Cut Wedding Invitations Hollow Floral Couple Silhouette Pearlescent Paper Invitation Greeting Card Wedding
Elegant Laser Cut Wedding Invitations Hollow Floral Couple Silhouette Pearlescent Paper Invitation Greeting Card Wedding
like
Find Similar
Elegant laser-cut floral wedding invitation card with white pearlescent paper and inner text - White
Laser cut wedding invitation with elegant hollow silhouette of couple and floral pattern - Beige Gold
Laser cut navy blue wedding invitation with intricate floral hollow design and white insert - Magic Blue
NewElegant Laser Cut Wedding Invitations Hollow Floral Couple Silhouette Pearlescent Paper Invitation Greeting Card Wedding
$0.65
Mix MOQ : 50
Laser Cut Pearlescent Paper Wedding Place Cards Hollow Proposal Design Floral Table Name Cards For Party Banquet Banquet
Laser Cut Pearlescent Paper Wedding Place Cards Hollow Proposal Design Floral Table Name Cards For Party Banquet Banquet
like
Find Similar
Elegant white laser-cut wedding place cards with a romantic couple silhouette and floral ring - White
Pink laser cut wedding place card with romantic proposal silhouette and floral pattern - Pink
Elegant gold laser cut table place card featuring a romantic proposal wedding silhouette - Gold
Elegant purple hollow laser cut wedding place card with romantic proposal silhouette - Dark Purple
+3
Laser Cut Pearlescent Paper Wedding Place Cards Hollow Proposal Design Floral Table Name Cards For Party Banquet Banquet
$0.07
Mix MOQ : 50
Graduation Party Decoration DIY Photo Frames Cardboard Celebration Props With Stickers And Stands For Kindergarten Graduates
Graduation Party Decoration DIY Photo Frames Cardboard Celebration Props With Stickers And Stands For Kindergarten Graduates
like
Find Similar
Graduation party DIY photo frame set with apple, bus, and cap stickers for kids - Graduation Photo Frame Set (L-00418)
DIY graduation photo frame kit with school bus, medal, and stickers for party decor - Graduation Photo Frame Set (L-00418-1)
Graduation Party Decoration DIY Photo Frames Cardboard Celebration Props With Stickers And Stands For Kindergarten Graduates
$3.89-7.41
Mix MOQ : 5
Christmas Wrapping Paper Retro White Kraft Paper Festive Santa Snowman Tree Patterns For Holiday Gift Flower Packaging Decor
Christmas Wrapping Paper Retro White Kraft Paper Festive Santa Snowman Tree Patterns For Holiday Gift Flower Packaging Decor
like
Find Similar
Christmas gift wrapping paper with pine tree and gift box illustrations 38x50cm 15pcs - Christmas Tree / 15 Sheets/Pack (38*52cm)
Christmas wrapping paper with Santa and tree pattern, size 38x50cm, set of 15 sheets - Santa Claus / 15 Sheets/Pack (38*52cm)
Christmas wrapping paper with cute snowman and tree pattern, size 38x50cm, 15 sheets per pack - Christmas Snowman Style / 15 Sheets/Pack (38*52cm)
Christmas Wrapping Paper Retro White Kraft Paper Festive Santa Snowman Tree Patterns For Holiday Gift Flower Packaging Decor
$2.25
Mix MOQ : 2
Halloween Cartoon Round Label Stickers Spooky Pumpkin Ghost Bat Cat Spider Pattern For Holiday Party Favors Decoration
Halloween Cartoon Round Label Stickers Spooky Pumpkin Ghost Bat Cat Spider Pattern For Holiday Party Favors Decoration
like
Find Similar
Set of 8 cute cartoon Halloween stickers featuring pumpkin, ghost and bat designs - 3.8CM
NewHalloween Cartoon Round Label Stickers Spooky Pumpkin Ghost Bat Cat Spider Pattern For Holiday Party Favors Decoration
$0.81-1.59
Mix MOQ : 5
Christmas Gift Tags Kraft Paper Labels And Hemp Rope Merry Christmas Happy New Year Printed Holiday Decor Hanging Cards
Christmas Gift Tags Kraft Paper Labels And Hemp Rope Merry Christmas Happy New Year Printed Holiday Decor Hanging Cards
like
Find Similar
Close-up of brown kraft Christmas gift tags with red Merry Christmas print and reindeer - Style 3/Sleigh & Gingerbread Man / 3*5cm [100Pcs]
Detail view of two kraft paper Christmas tags with red Santa Claus print on a wood tray - Style 1/Santa Claus / 3*5cm [100Pcs]
Macro shot of kraft paper Christmas tags featuring a red snowman and Merry Christmas greeting - Style 2/Snowman / 3*5cm [100Pcs]
Close-up of brown kraft Christmas gift tags with red hat and gloves pattern - Style 4/Christmas Hat & Gloves / 3*5cm [100Pcs]
+9
Christmas Gift Tags Kraft Paper Labels And Hemp Rope Merry Christmas Happy New Year Printed Holiday Decor Hanging Cards
$0.86-1.44
No MOQ
 · 
14 sold recently
Christmas Cat 3D Pop-Up Greeting Card Laser Cut Paper Holiday Blessing Message Postcard Desktop Decoration Gift
Christmas Cat 3D Pop-Up Greeting Card Laser Cut Paper Holiday Blessing Message Postcard Desktop Decoration Gift
like
Find Similar
Creative 3D popup Christmas card featuring a cute cat and festive tree with gift size 11x11cm - Christmas Cat / Christmas Green/Multicolor
Christmas Cat 3D Pop-Up Greeting Card Laser Cut Paper Holiday Blessing Message Postcard Desktop Decoration Gift
-4%
$0.88
Mix MOQ : 2
Laser Cut Wedding Invitation Covers Pearlescent Paper Rose Flower Bride Silhouette Hollow Greeting Cards For Marriage Party
Laser Cut Wedding Invitation Covers Pearlescent Paper Rose Flower Bride Silhouette Hollow Greeting Cards For Marriage Party
like
Find Similar
Detailed laser-cut rose patterns and elegant bride silhouette on light pink pearl paper card - Nude Pink
Elegant white laser-cut wedding invitation featuring rose patterns and a bride silhouette - White
Laser cut kraft paper wedding invitation featuring rose patterns and a female silhouette - Beige Gold
Detail of laser-cut purple floral invitation with elegant rose pattern and girl silhouette - Lilac Purple
+5
Laser Cut Wedding Invitation Covers Pearlescent Paper Rose Flower Bride Silhouette Hollow Greeting Cards For Marriage Party
$0.55
Mix MOQ : 50
Thank You Stickers Roll Cartoon Animal Dinosaur Cat Round Coated Paper For Gift Sealing Teacher Rewards Packaging Decor
Thank You Stickers Roll Cartoon Animal Dinosaur Cat Round Coated Paper For Gift Sealing Teacher Rewards Packaging Decor
like
Find Similar
Roll of cute 30mm cartoon dinosaur Thank You stickers with 8 colorful designs - 30x30mm / Dinosaur Pattern (syf-30)
Cartoon cat thank you stickers for teacher rewards and handmade gift sealing, 30mm round - 30x30mm / Pocket Cat (syf-31)
500pcs gift heart stickers roll for sealing packages, orange and pink 1 inch round labels - 30x30mm / Gift Heart (syf-38)
+3
Thank You Stickers Roll Cartoon Animal Dinosaur Cat Round Coated Paper For Gift Sealing Teacher Rewards Packaging Decor
$0.81-1.10
No MOQ
Christmas Stickers Round Adhesive Labels Cartoon Santa Reindeer Snowman For Gift Wrapping Envelope Sealing Festive Decor
Christmas Stickers Round Adhesive Labels Cartoon Santa Reindeer Snowman For Gift Wrapping Envelope Sealing Festive Decor
like
Find Similar
Christmas labels roll with 8 festive designs including Reindeer and Snowman for packaging - 1 inch (25mm)
Christmas Stickers Round Adhesive Labels Cartoon Santa Reindeer Snowman For Gift Wrapping Envelope Sealing Festive Decor
$1.67-2.48
No MOQ
Waterproof Laminated Non-Woven Gift Bag For Father's Day Blue Pattern Tote Bag For Party Gift Wrapping Best Dad Ever Bag
Waterproof Laminated Non-Woven Gift Bag For Father's Day Blue Pattern Tote Bag For Party Gift Wrapping Best Dad Ever Bag
like
Find Similar
Father's Day gift bag with blue argyle pattern and Happy Father's Day print - Blue Rhombus Pattern Style (2014-3) / 23x22x11
Blue Happy Father's Day non-woven gift bag with festive tie and mustache illustrations - Mustache Tie Pipe Design (2014-1) / 23x22x11
Blue Father's Day non-woven gift bag with Happy Father's Day text and tie pattern - Glasses Mustache Tie Heart (2014-2) / 23x22x11
Father's Day laminated non-woven gift bag with shirt and tie design and blue heart - Suit and Tie Motif Design (2014-4) / 23x22x11
Waterproof Laminated Non-Woven Gift Bag For Father's Day Blue Pattern Tote Bag For Party Gift Wrapping Best Dad Ever Bag
$0.23
Mix MOQ : 12
Laser Cut Cardboard Skyscraper Building Scene Decorative Candle Shade For Wedding Party Home Table Decor Black Paper Lantern Cover
Laser Cut Cardboard Skyscraper Building Scene Decorative Candle Shade For Wedding Party Home Table Decor Black Paper Lantern Cover
like
Find Similar
Set of four black skyscraper laser-cut paper lantern covers for wedding decor - Skyscraper Style
Laser Cut Cardboard Skyscraper Building Scene Decorative Candle Shade For Wedding Party Home Table Decor Black Paper Lantern Cover
$12.97
Mix MOQ : 10
3D Pop Up Wedding Invitations Laser Cut Rose Flower Arch Couple Silhouette Glitter Pearlescent Paper Greeting Cards For Marriage Ceremony
3D Pop Up Wedding Invitations Laser Cut Rose Flower Arch Couple Silhouette Glitter Pearlescent Paper Greeting Cards For Marriage Ceremony
like
Find Similar
Elegant gold glitter 3D pop-up wedding invitation featuring laser-cut roses and couple - Glitter Golden Yellow
3D pop-up wedding invitation featuring laser-cut silver glitter rose arch and couple - Silver Glitter
3D laser cut gold glitter wedding invitation with 3D roses and couple silhouette - Light Gold Glitter
Macro detail of 3D laser-cut wedding invitation featuring rose arch and glitter finish - Glitter Rose Gold
+4
3D Pop Up Wedding Invitations Laser Cut Rose Flower Arch Couple Silhouette Glitter Pearlescent Paper Greeting Cards For Marriage Ceremony
$1.44
Mix MOQ : 30
Laser Cut Rose Wedding Invitation Cards Pearl Paper Glitter Pocket Set With Inner Page And Envelope For Engagement Party
Laser Cut Rose Wedding Invitation Cards Pearl Paper Glitter Pocket Set With Inner Page And Envelope For Engagement Party
like
Find Similar
Detail of rose gold glitter card featuring intricate laser-cut floral patterns and texture - Lapis Lazuli
Detailed laser-cut rose pattern on navy blue glitter paper invitation cover - Dark Blue
Sparkly silver laser-cut rose floral wedding invitation card on white wood background - Silver
Detail of rose gold glitter wedding invitation featuring intricate laser-cut floral patterns - Rose Gold
+1
Laser Cut Rose Wedding Invitation Cards Pearl Paper Glitter Pocket Set With Inner Page And Envelope For Engagement Party
-4%
$0.69
Mix MOQ : 50
Hawaii Summer Party Stickers Tropical Beach Flamingo Palm Tree Self-Adhesive Decor For Gift Envelope Cup
Hawaii Summer Party Stickers Tropical Beach Flamingo Palm Tree Self-Adhesive Decor For Gift Envelope Cup
like
Find Similar
Tropical summer stickers set featuring flamingos and pineapples on a white background - Summer Round Stickers (L-00138-1)
Hawaii party stickers featuring tropical flamingo and summer beach cartoon patterns - Summer Cartoon Stickers (L-00138-2)
Hawaii Summer Party Stickers Tropical Beach Flamingo Palm Tree Self-Adhesive Decor For Gift Envelope Cup
$0.86
Mix MOQ : 10
3D Cylinder Vase Silicone Mold Diamond Grid Texture For DIY Aromatherapy Plaster Flower Arrangement Cake Decoration Mold
3D Cylinder Vase Silicone Mold Diamond Grid Texture For DIY Aromatherapy Plaster Flower Arrangement Cake Decoration Mold
like
Find Similar
3D cylinder vase silicone mold with diamond texture for DIY plaster and candle making - Cylindrical Diamond Texture Style(19-33)
3D Cylinder Vase Silicone Mold Diamond Grid Texture For DIY Aromatherapy Plaster Flower Arrangement Cake Decoration Mold
$1.44
No MOQ
Round Christmas Stickers Black And Gold Foil Holiday Gift Box Sealing Labels For New Year Party Decor Kraft Paper Vintage
Round Christmas Stickers Black And Gold Foil Holiday Gift Box Sealing Labels For New Year Party Decor Kraft Paper Vintage
like
Find Similar
Black and gold Christmas round stickers featuring Merry Christmas and Happy New Year text - 50mm / Black Gold Style (A)
Round Christmas Stickers Black And Gold Foil Holiday Gift Box Sealing Labels For New Year Party Decor Kraft Paper Vintage
$1.07
No MOQ
Laser Cut Wedding Invitations Glitter Cardstock Bride Silhouette Cards For Engagement Party Anniversary Bridal Shower Greeting Card
Laser Cut Wedding Invitations Glitter Cardstock Bride Silhouette Cards For Engagement Party Anniversary Bridal Shower Greeting Card
like
Find Similar
Golden glitter laser cut wedding invitation card with elegant bride silhouette and flowers - Glitter Cyan Gold
Elegant laser-cut bride silhouette wedding invitation with silver glitter and floral insert - Silver Glitter
Detail of laser-cut rose gold glitter wedding invitation with bride silhouette and flowers - Glitter Champagne Gold
Pink glitter laser cut wedding invitation card featuring a bride silhouette and floral details - Glitter Pink
+2
Laser Cut Wedding Invitations Glitter Cardstock Bride Silhouette Cards For Engagement Party Anniversary Bridal Shower Greeting Card
-5%
$0.52
Mix MOQ : 50
Halloween Cartoon Pumpkin Face Decorative Stickers Roll For Party Gift Packaging Happy Halloween Round Adhesive Labels
Halloween Cartoon Pumpkin Face Decorative Stickers Roll For Party Gift Packaging Happy Halloween Round Adhesive Labels
like
Find Similar
1 option
Halloween Cartoon Pumpkin Face Decorative Stickers Roll For Party Gift Packaging Happy Halloween Round Adhesive Labels
$0.36
Mix MOQ : 5
Laser Cut Wedding Invitation Card Pearlescent Paper Hollow Lace Pocket Invitation With Satin Ribbon Bow For Ceremony Marriage Party
Laser Cut Wedding Invitation Card Pearlescent Paper Hollow Lace Pocket Invitation With Satin Ribbon Bow For Ceremony Marriage Party
like
Find Similar
Elegant laser cut white wedding invitation cover with a silk beige bow and inner card - White
Elegant lavender laser-cut wedding invitation with white insert card and beige silk ribbon bow - Light Purple
Navy blue laser cut wedding invitation with cream satin ribbon and elegant paper insert - Deep Blue
Elegant laser-cut burgundy wedding invitation with cream satin ribbon and floral hollow design - Dark Red
Laser Cut Wedding Invitation Card Pearlescent Paper Hollow Lace Pocket Invitation With Satin Ribbon Bow For Ceremony Marriage Party
$0.43
Mix MOQ : 50
Elegant Laser Cut Rose Floral Wedding Invitations With Envelopes Pearl Paper Greeting Cards For Engagement Bridal Shower Party Celebration
Elegant Laser Cut Rose Floral Wedding Invitations With Envelopes Pearl Paper Greeting Cards For Engagement Bridal Shower Party Celebration
like
Find Similar
Elegant laser-cut floral wedding invitation set with printed card and RSVP on soft fabric - White
Detailed laser-cut rose hollow wedding invitation set with watercolor flower insert card - Ivory
Detail of pink laser-cut rose wedding invitation set with floral inner cards and RSVP - Pink
Elegant purple laser cut floral wedding invitation set with RSVP card and floral insert - Lilac Purple
+4
Elegant Laser Cut Rose Floral Wedding Invitations With Envelopes Pearl Paper Greeting Cards For Engagement Bridal Shower Party Celebration
$0.68
Mix MOQ : 50
3D Laser Hollow Out Butterfly Wall Stickers Pearlescent Paper Decorative Decals For Wedding Party Home Decor Room Layout
3D Laser Hollow Out Butterfly Wall Stickers Pearlescent Paper Decorative Decals For Wedding Party Home Decor Room Layout
like
Find Similar
Set of 3 rose gold 3D laser-cut hollow butterfly wall stickers for wedding party decor - 12 Piece Large Medium Small / Jade Pearl
3D Laser Hollow Out Butterfly Wall Stickers Pearlescent Paper Decorative Decals For Wedding Party Home Decor Room Layout
$0.58
Mix MOQ : 50
Free Shipping
Christmas Gift Tags Kraft Paper Hanging Labels Santa Snowman Patterns For Holiday Wrapping Decor With Strings
Christmas Gift Tags Kraft Paper Hanging Labels Santa Snowman Patterns For Holiday Wrapping Decor With Strings
like
Find Similar
Set of 100 Kraft Christmas gift tags with 10 designs, red-white and jute strings - MC6-101
100pcs Christmas Kraft paper gift tags with Santa patterns and cotton twine strings - MC6-105
100-pack Christmas kraft paper tags with 10 patterns, red-white cotton and jute twine - MC6-103
Christmas Gift Tags Kraft Paper Hanging Labels Santa Snowman Patterns For Holiday Wrapping Decor With Strings
$2.30
Mix MOQ : 5
Sun Pattern Hollow Laser Cut Paper Lamp Shade Cardstock Candle Sleeve For Festival Party Wedding Atmosphere Night Light
Sun Pattern Hollow Laser Cut Paper Lamp Shade Cardstock Candle Sleeve For Festival Party Wedding Atmosphere Night Light
like
Find Similar
Detail view of yellow laser-cut sun paper lanterns with hollowed decorative patterns - Sun Hollow Lamp Shade (Lamp Shade-Sun)
Sun Pattern Hollow Laser Cut Paper Lamp Shade Cardstock Candle Sleeve For Festival Party Wedding Atmosphere Night Light
$0.58
Mix MOQ : 50
3D Pop-up Birthday Card Luminous Music Paper Carving Greeting Card With Envelope For Birthday Party
3D Pop-up Birthday Card Luminous Music Paper Carving Greeting Card With Envelope For Birthday Party
like
Find Similar
3D pop-up birthday card with black and gold gift box balloons and Happy Birthday lettering - Happy Birthday (Black Gold with Music) / Black/Gold
3D pop-up Happy Birthday card with purple envelope, gift box and balloon decorations - Happy Birthday (Purple No Music) / Purple
3D Pop-up Birthday Card Luminous Music Paper Carving Greeting Card With Envelope For Birthday Party
$2.31-4.61
Mix MOQ : 2
 · 
30 views
Diy Greeting Card Materials Handmade Paper Cards With Buttons Rhinestones Cartoon Animal Kids Teachers Day Birthday Gift
Diy Greeting Card Materials Handmade Paper Cards With Buttons Rhinestones Cartoon Animal Kids Teachers Day Birthday Gift
like
Find Similar
3-pack 3D Christmas DIY cards with bear giraffe rabbit themes and blue envelopes - DIY Animal 3-Pack Set
Diy Greeting Card Materials Handmade Paper Cards With Buttons Rhinestones Cartoon Animal Kids Teachers Day Birthday Gift
$2.77
No MOQ
Graduation Money Pull Surprise Gift Kit Black Gold Cardboard Case With Mortarboard Topper Plastic Bags Party Decor
Graduation Money Pull Surprise Gift Kit Black Gold Cardboard Case With Mortarboard Topper Plastic Bags Party Decor
like
Find Similar
Graduation money pull box kit with 1 congrats grad box, 30 bags and a topper sign - Black Gold Graduation Money Pulling Set(L-00266-1) / Box, Card And Bags
Graduation Money Pull Surprise Gift Kit Black Gold Cardboard Case With Mortarboard Topper Plastic Bags Party Decor
-4%
$1.78
Mix MOQ : 30
Class Of 2024 Graduation Paper Lampshade Laser Cut Hollow Candle Holder Sleeve Black Tabletop Party Decor Graduation Party Supplies
Class Of 2024 Graduation Paper Lampshade Laser Cut Hollow Candle Holder Sleeve Black Tabletop Party Decor Graduation Party Supplies
like
Find Similar
Class of 2024 laser-cut black paper candle shade with graduation silhouettes for party decor - Graduation Theme Style (Lampshade-2)
Class Of 2024 Graduation Paper Lampshade Laser Cut Hollow Candle Holder Sleeve Black Tabletop Party Decor Graduation Party Supplies
$0.81
Mix MOQ : 50
Christmas Snowman Roll Stickers Round Cartoon Self Adhesive Labels For Holiday Gift Wrapping Envelope Seal Paper Decoration
Christmas Snowman Roll Stickers Round Cartoon Self Adhesive Labels For Holiday Gift Wrapping Envelope Seal Paper Decoration
like
Find Similar
2 options
Christmas Snowman Roll Stickers Round Cartoon Self Adhesive Labels For Holiday Gift Wrapping Envelope Seal Paper Decoration
$1.59-2.33
No MOQ
Christmas Sealing Stickers Gold Round Merry Christmas Labels For Holiday Gift Wrap Envelope Party Decor Elegant Festive
Christmas Sealing Stickers Gold Round Merry Christmas Labels For Holiday Gift Wrap Envelope Party Decor Elegant Festive
like
Find Similar
Roll of 1 inch gold Merry Christmas stickers with reindeer and snowflake patterns - Small / Gold Christmas Patterns (A)
Christmas Sealing Stickers Gold Round Merry Christmas Labels For Holiday Gift Wrap Envelope Party Decor Elegant Festive
$1.84
No MOQ
Happy Easter Bingo Game Cards Including Player Boards And Calling Chips With Bunny Egg Patterns For Kids Group Party Activity
Happy Easter Bingo Game Cards Including Player Boards And Calling Chips With Bunny Egg Patterns For Kids Group Party Activity
like
Find Similar
Happy Easter Bingo game set with 24 player cards and caller chips for party supplies - Easter Bingo Game Cards (Player Cards And Marker Chips)
Happy Easter Bingo Game Cards Including Player Boards And Calling Chips With Bunny Egg Patterns For Kids Group Party Activity
$3.60
Mix MOQ : 50
Elegant Laser Cut Hollow Wedding Invitations Glitter Greeting Cards With Satin Ribbon Invitation For Marriage Party Valentine Supplies
Elegant Laser Cut Hollow Wedding Invitations Glitter Greeting Cards With Satin Ribbon Invitation For Marriage Party Valentine Supplies
like
Find Similar
Laser cut gold glitter wedding invitation with floral insert and cream satin ribbon bow - Cyan Gold
Elegant silver glitter laser cut invitation with ribbon and floral interior card - Silver Glitter
Elegant laser cut rose gold glitter wedding invitation with bow and floral inner card - Glitter Rose Gold
Laser-cut glitter wedding invitation set with rose gold hollow cover and pink ribbon - Glitter Pink
+3
Elegant Laser Cut Hollow Wedding Invitations Glitter Greeting Cards With Satin Ribbon Invitation For Marriage Party Valentine Supplies
$0.72
Mix MOQ : 50
Elegant Laser Cut Wedding Invitation Cards Pearl Paper Hollow Floral Design With Ribbon Bow Butterfly For Marriage Party
Elegant Laser Cut Wedding Invitation Cards Pearl Paper Hollow Floral Design With Ribbon Bow Butterfly For Marriage Party
like
Find Similar
Detail of laser-cut wedding invitation with pink floral insert and golden butterfly - Ivory
Detail of laser-cut gold invitation cover with floral insert and elegant ribbon - Champagne Gold
Detail of laser-cut blue wedding invitation with golden butterfly and elegant floral card - Teal Blue
Detail of laser-cut navy wedding invitation with golden butterfly and satin ribbon bow - Phantom Blue
+4
Elegant Laser Cut Wedding Invitation Cards Pearl Paper Hollow Floral Design With Ribbon Bow Butterfly For Marriage Party
$0.73
Mix MOQ : 50
Thanksgiving Gift Bags Non-Woven Laminated Tote Bag Portable Waterproof Shopping Bag For Party Favors Fall Harvest Turkey Pumpkin Patterns
Thanksgiving Gift Bags Non-Woven Laminated Tote Bag Portable Waterproof Shopping Bag For Party Favors Fall Harvest Turkey Pumpkin Patterns
like
Find Similar
Detail of happy harvest printing on non-woven tote bag with pumpkin and maple patterns - Autumn Harvest Style (8005-6) / 33*25*17
Waterproof non-woven Thanksgiving gift bag with fall maple leaves and pumpkin prints - White Happy Thanksgiving Style (8005-4) / 33*25*17
Red Happy Thanksgiving non-woven gift bag with pumpkin truck print and red handle - Red Truck Thanksgiving Style (8005-1) / 33*25*17
Close-up of Happy Thanksgiving non-woven tote bag with turkey and autumn leaves print - Red Turkey Thanksgiving Style (8005-2) / 33*25*17
+2
Thanksgiving Gift Bags Non-Woven Laminated Tote Bag Portable Waterproof Shopping Bag For Party Favors Fall Harvest Turkey Pumpkin Patterns
$0.29
Mix MOQ : 12
Christmas Gift Bags Kraft Paper Wooden Clips Holiday Tags Round Stickers Cotton Rope Decorative Wrapping
Christmas Gift Bags Kraft Paper Wooden Clips Holiday Tags Round Stickers Cotton Rope Decorative Wrapping
like
Find Similar
Christmas gift set details showing paper bags, stickers, wooden clips and cotton ropes - Christmas Gift Bag Set (582 Style)
Christmas gift bag set with 24 paper bags, wooden clips, tags and stickers for holidays - Christmas Gift Bag Set (586 Style)
Christmas paper bag gift set with festive stickers wooden clips and cotton twine - Christmas Gift Bag Set (588 Style)
24-piece Christmas gift bag set with tags, clips, stickers and cotton rope packaging - Christmas Gift Bag Set (589 Style)
+2
Christmas Gift Bags Kraft Paper Wooden Clips Holiday Tags Round Stickers Cotton Rope Decorative Wrapping
$5.42
No MOQ
European Style Laser Cut Wedding Invitation Cards Pearlescent Paper Hollow Floral Leaf Invitations For Party Celebration
European Style Laser Cut Wedding Invitation Cards Pearlescent Paper Hollow Floral Leaf Invitations For Party Celebration
like
Find Similar
Elegant white laser-cut wedding invitation featuring intricate floral hollow designs - White
Elegant ivory laser cut floral wedding invitation envelope made of pearlescent paper - Ivory
Pink laser-cut floral wedding invitation card with elegant hollow geometric pattern - Light Pink
Elegant champagne gold laser-cut wedding invitation envelope with pearlized paper finish - Champagne Gold
+2
European Style Laser Cut Wedding Invitation Cards Pearlescent Paper Hollow Floral Leaf Invitations For Party Celebration
$0.66
Mix MOQ : 50
Christmas Gift Label Stickers Kraft Paper Self Adhesive Merry Christmas To From Writing Space Holiday Festive Wrap
Christmas Gift Label Stickers Kraft Paper Self Adhesive Merry Christmas To From Writing Space Holiday Festive Wrap
like
Find Similar
Roll of Kraft Christmas gift tags with various festive patterns and Merry Christmas text - 75*50mm / Mixed Christmas Elements Patterns (X-993)
Christmas Gift Label Stickers Kraft Paper Self Adhesive Merry Christmas To From Writing Space Holiday Festive Wrap
$2.48
No MOQ
Halloween Silicone Mold Scarecrow Pumpkin Watering Can Signpost Fondant Chocolate Resin Clay DIY Baking Tool Decoration
Halloween Silicone Mold Scarecrow Pumpkin Watering Can Signpost Fondant Chocolate Resin Clay DIY Baking Tool Decoration
like
Find Similar
Halloween silicone mold for pumpkin patch signs, scarecrows and watering cans - Pink
NewHalloween Silicone Mold Scarecrow Pumpkin Watering Can Signpost Fondant Chocolate Resin Clay DIY Baking Tool Decoration
$0.59
Mix MOQ : 2
Decorative Wall Art Cards Cardstock Aesthetic Landscape Photography Poetic English Words For Bedroom Dorm Room Decor
Decorative Wall Art Cards Cardstock Aesthetic Landscape Photography Poetic English Words For Bedroom Dorm Room Decor
like
Find Similar
Nordic ins style decorative wall collage with aesthetic landscape and floral cards - Morning Dew and Evening Mist
Detail view of aesthetic wall collage cards featuring artistic English typography and nature - 100,000 Light Years
Nordic ins style aesthetic sunset scenery posters for bedroom and dorm wall decor - Romantic Forever
Blue aesthetic Nordic landscape cards with inspirational words for bedroom wall decor - Azure World
Decorative Wall Art Cards Cardstock Aesthetic Landscape Photography Poetic English Words For Bedroom Dorm Room Decor
$1.10
Mix MOQ : 2
 · 
25 views
Laser Cut Wedding Invitations Glitter Pearlescent Paper Ribbon Bow Flower Inner Card With Envelopes For Party Banquet
Laser Cut Wedding Invitations Glitter Pearlescent Paper Ribbon Bow Flower Inner Card With Envelopes For Party Banquet
like
Find Similar
Laser cut rose gold glitter wedding invitation with ivory ribbon bow and floral insert - Glitter Rose Gold
Laser-cut silver glitter wedding invitation with white ribbon and floral inner card - Silver Glitter
Champagne gold laser cut wedding invitation card with ribbon bow and floral inner sheet - Light Gold Glitter
Pink glitter laser-cut wedding invitation with elegant ribbon bow and floral card insert - Glitter Pink
+3
NewLaser Cut Wedding Invitations Glitter Pearlescent Paper Ribbon Bow Flower Inner Card With Envelopes For Party Banquet
$0.76
Mix MOQ : 50
Homemade With Love Blank Labels Colorful Star Border Stickers For Kitchen Jars Seasoning Bottles Gift Wrapping Handwritten Roll
Homemade With Love Blank Labels Colorful Star Border Stickers For Kitchen Jars Seasoning Bottles Gift Wrapping Handwritten Roll
like
Find Similar
1 option
Homemade With Love Blank Labels Colorful Star Border Stickers For Kitchen Jars Seasoning Bottles Gift Wrapping Handwritten Roll
-6%
$0.31
No MOQ
Luxury Laser Cut Wedding Invitations Glitter Pearl Paper Floral Hollow Out Engagement Invitation Cards Set With Envelopes For Wedding Party Event Ceremony
Luxury Laser Cut Wedding Invitations Glitter Pearl Paper Floral Hollow Out Engagement Invitation Cards Set With Envelopes For Wedding Party Event Ceremony
like
Find Similar
Elegant laser-cut silver glitter wedding invitation set with floral printed insert cards - Glitter Silver
Champagne gold glitter laser cut wedding invitation set with floral inner cards - Light Gold Glitter
Detailed laser-cut gold glitter wedding invitation with floral insert and RSVP card - Glitter Rose Gold
Glitter gold laser cut wedding invitation set with floral card and RSVP insert - Glitter Golden Yellow
+4
Luxury Laser Cut Wedding Invitations Glitter Pearl Paper Floral Hollow Out Engagement Invitation Cards Set With Envelopes For Wedding Party Event Ceremony
$0.86
Mix MOQ : 50
Christmas Wrapping Paper Roll Coated Paper Santa Claus Snowflake Pattern Holiday Gift Box Decor Festive Xmas Wrap
Christmas Wrapping Paper Roll Coated Paper Santa Claus Snowflake Pattern Holiday Gift Box Decor Festive Xmas Wrap
like
Find Similar
Premium matte dark green metallic gift wrapping paper roll with smooth brushed texture - 43cm*3m / Green Aluminized Paper (Roll)
White Christmas kraft wrapping paper roll with colorful Merry Christmas text patterns - 43cm*3m / Christmas Letters (Roll)
Green Christmas wrapping paper roll featuring Santa Claus patterns and Ho Ho Ho text - 43cm*3m / Santa Claus (Roll)
Christmas wrapping paper rolls featuring green metallic, santa claus, and letter patterns - 43cm*3m*3 Rolls / Set 1 (3 Rolls Set)
Christmas Wrapping Paper Roll Coated Paper Santa Claus Snowflake Pattern Holiday Gift Box Decor Festive Xmas Wrap
-5%
$1.09-3.56
No MOQ
Christmas Gift Bags Drawstring Linen Like Fabric Gnomes Red Truck Print Holiday Candy Treat Packaging Sack Party Decor
Christmas Gift Bags Drawstring Linen Like Fabric Gnomes Red Truck Print Holiday Candy Treat Packaging Sack Party Decor
like
Find Similar
Close-up of linen Christmas drawstring gift bag with gnomes and Merry Christmas print - Three Gnomes Style
Flat lay of Merry Christmas drawstring gift bag with Santa and truck print on wood - Red Truck Style
Christmas Gift Bags Drawstring Linen Like Fabric Gnomes Red Truck Print Holiday Candy Treat Packaging Sack Party Decor
$2.31
No MOQ
Laser Cut Rose Wedding Invitation Cards Hollow Out Pearlescent Paper Elegant European Style Celebration Party Greeting Cards
Laser Cut Rose Wedding Invitation Cards Hollow Out Pearlescent Paper Elegant European Style Celebration Party Greeting Cards
like
Find Similar
Elegant white laser-cut rose invitation card with detailed floral lace pattern for weddings - White
Laser-cut square gold invitation pocket featuring intricate hollow rose flower patterns - Beige Gold
Square golden laser-cut rose wedding invitation card with white inner page insert - Gold
Close-up of red laser cut rose hollow wedding invitation with white paper insert - Pearlescent Red
+4
Laser Cut Rose Wedding Invitation Cards Hollow Out Pearlescent Paper Elegant European Style Celebration Party Greeting Cards
$0.43
Mix MOQ : 50
Christmas Snowman Stickers Roll For DIY Crafts Envelope Seal Waterproof Cartoon Holiday Decorative Adhesive Labels
Christmas Snowman Stickers Roll For DIY Crafts Envelope Seal Waterproof Cartoon Holiday Decorative Adhesive Labels
like
Find Similar
Roll of 500 Christmas snowman stickers with 10 colorful DIY cartoon seal designs - Snowman Theme
Christmas Snowman Stickers Roll For DIY Crafts Envelope Seal Waterproof Cartoon Holiday Decorative Adhesive Labels
$0.86
No MOQ
European Style Laser Cut Wedding Invitations Glitter Pearl Paper Lace Hollow Invitation Cards For Marriage Party Engagement
European Style Laser Cut Wedding Invitations Glitter Pearl Paper Lace Hollow Invitation Cards For Marriage Party Engagement
like
Find Similar
Elegant laser-cut burgundy wedding invitation with ribbon and floral insert card - Dark Red
Elegant gold laser-cut wedding invitation with European scroll patterns on glitter paper - Beige Gold
NewEuropean Style Laser Cut Wedding Invitations Glitter Pearl Paper Lace Hollow Invitation Cards For Marriage Party Engagement
$0.58
Mix MOQ : 50
3D Laser Cut Hollow Butterfly Wall Stickers Reflective Gold Silver DIY Home Decor Wall Art For Living Room TV Party
3D Laser Cut Hollow Butterfly Wall Stickers Reflective Gold Silver DIY Home Decor Wall Art For Living Room TV Party
like
Find Similar
3D metallic gold hollow butterfly wall stickers with intricate laser-cut floral patterns - Reflective Silver
3D hollow laser-cut golden butterfly wall decor with intricate floral patterns - Reflective Gold
3D rose gold butterfly wall sticker with intricate laser-cut hollow floral patterns - Reflective Rose Gold
3D Laser Cut Hollow Butterfly Wall Stickers Reflective Gold Silver DIY Home Decor Wall Art For Living Room TV Party
$0.07
Mix MOQ : 50
European Style Laser Cut Wedding Invitations Pearl Paper Hollow Floral Greeting Cards With Ribbon Bow Envelope For Party
European Style Laser Cut Wedding Invitations Pearl Paper Hollow Floral Greeting Cards With Ribbon Bow Envelope For Party
like
Find Similar
Macro detail of laser-cut lace texture and satin bow on white wedding invitation card - White
Macro detail of laser-cut wedding invitation with champagne gold glitter and white satin bow - Beige Gold
Detail of laser-cut floral pattern on purple wedding invitation with white satin bow - Dark Purple
Detailed laser-cut hollow pattern on gold wedding invitation with white satin bow - Gold
+2
European Style Laser Cut Wedding Invitations Pearl Paper Hollow Floral Greeting Cards With Ribbon Bow Envelope For Party
$0.43
Mix MOQ : 50
European Style Laser Cut Wedding Invitation Cards Pearlescent Paper Lace Floral Hollow Out Design For Party Anniversary Celebration
European Style Laser Cut Wedding Invitation Cards Pearlescent Paper Lace Floral Hollow Out Design For Party Anniversary Celebration
like
Find Similar
Elegant laser cut wedding invitation with white lace sleeve and champagne silk bow - White
Elegant navy blue laser-cut wedding invitation with white satin ribbon and floral lace - Dark Blue
Elegant laser-cut lace wedding invitation set with golden cover, ribbon and floral inner card - Beige Gold
European Style Laser Cut Wedding Invitation Cards Pearlescent Paper Lace Floral Hollow Out Design For Party Anniversary Celebration
$0.43
Mix MOQ : 50
Halloween Cartoon Round Sticker Roll Pumpkin Ghost Spider Pattern For DIY Envelope Sealing Gift Decor Festive Party Supplies
Halloween Cartoon Round Sticker Roll Pumpkin Ghost Spider Pattern For DIY Envelope Sealing Gift Decor Festive Party Supplies
like
Find Similar
500pcs Halloween cartoon roll stickers with pumpkins ghosts and bats for gift sealing - Halloween Cartoon Style
Halloween Cartoon Round Sticker Roll Pumpkin Ghost Spider Pattern For DIY Envelope Sealing Gift Decor Festive Party Supplies
$0.86
No MOQ
Easter Gift Tags Vintage Paper Hanging Label With Hemp Rope For Holiday Party Decoration Retro Illustration Rabbit Egg Style
Easter Gift Tags Vintage Paper Hanging Label With Hemp Rope For Holiday Party Decoration Retro Illustration Rabbit Egg Style
like
Find Similar
Detailed set of 60 vintage Easter gift tags with rabbit illustrations and jute twine - Vintage Bunny Illustration
60-piece vintage Easter gift tags set featuring bunnies and jute twine for party decor - Vintage Easter Combination
Detail view of 60 vintage Easter gift tags with retro rabbit illustrations and twine - Victorian Vintage Illustration
Vintage Easter gift tags set with rustic twine showing 6 different hand-drawn illustrations - Vintage Holiday Elements
Easter Gift Tags Vintage Paper Hanging Label With Hemp Rope For Holiday Party Decoration Retro Illustration Rabbit Egg Style
$1.96
Mix MOQ : 2
 · 
13 views
Go to

More in party supplies

Explore more in heart shaped boxes

hearthollowgoldwindoweveningartificial pearldiyhomeday giftearrings necklaces
partycrossbodyartificialmetaldesigngirlskidsstyletravelbands

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access