Everful

Wholesale home decor accessories

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Home Decor Accessories

Find the perfect pieces: home decor accents & accessories, artificial decorations, artificial flowers and more

Popular collections in home decor accessories

All products in home decor accessories

filterShow filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Hand-Woven Macrame Wall Hanging Rainbow Cotton Rope Tassel Tapestry Nordic Bohemian Home Decor Art For Bedroom Living Room
Hand-Woven Macrame Wall Hanging Rainbow Cotton Rope Tassel Tapestry Nordic Bohemian Home Decor Art For Bedroom Living Room
like
Find Similar
Bohemian woven tapestry wall hanging with colorful rainbow patterns and tassels - 40*60cm / Dark Blue A
Bohemian woven macrame wall hanging with colorful geometric patterns and wood beads decor - 40*60cm / Brick Red B
Handmade Macrame rainbow wall hanging with colorful tassels and wooden beads for home decor - 40*60cm / Light Blue C
Hand-Woven Macrame Wall Hanging Rainbow Cotton Rope Tassel Tapestry Nordic Bohemian Home Decor Art For Bedroom Living Room
-3%
$7.20
No MOQ
 · 
24 sold recently
Natural Rattan Balls And Stars Handwoven Decorative Ornaments For Home Decor Photography Props Nordic Style
Natural Rattan Balls And Stars Handwoven Decorative Ornaments For Home Decor Photography Props Nordic Style
like
Find Similar
Natural rattan ball and star decorative photography props in neutral beige and brown tones - Three-Color Rattan Ball And Pentagram Set
+9
Natural Rattan Balls And Stars Handwoven Decorative Ornaments For Home Decor Photography Props Nordic Style
$0.07-1.21
Mix MOQ : 5
 · 
1 reviews
Bohemian Handmade Woven Macrame Wall Hanging Cotton Rope Wood Stick Evil Eye Tassel Turkish Nazar Home Decor Art Ornament
Bohemian Handmade Woven Macrame Wall Hanging Cotton Rope Wood Stick Evil Eye Tassel Turkish Nazar Home Decor Art Ornament
like
Find Similar
Handmade Evil Eye macrame wall hanging in cream cotton with blue glass bead charms - Style A
Handwoven Evil Eye wall hanging tapestry in beige cotton rope with 28cm total height - Style B
Bohemian Handmade Woven Macrame Wall Hanging Cotton Rope Wood Stick Evil Eye Tassel Turkish Nazar Home Decor Art Ornament
$4.01
No MOQ
Hand-Woven Cotton Macrame Wall Hanging Large Bohemian Tapestry With Tassels Nordic Decorative Wall Art For Home Living Room
Hand-Woven Cotton Macrame Wall Hanging Large Bohemian Tapestry With Tassels Nordic Decorative Wall Art For Home Living Room
like
Find Similar
Handmade bohemian mosaic tapestry with olive green and cream cotton fringe tassels - 120*85cm / Green
Bohemian handmade woven wall hanging tapestry with gradient fringe and wooden bar - 120*85cm / Gray
Handmade bohemian woven tapestry wall hanging with blue cotton tassels and wooden rod - 120*85cm / Sky Blue
Hand-Woven Cotton Macrame Wall Hanging Large Bohemian Tapestry With Tassels Nordic Decorative Wall Art For Home Living Room
$18.73
No MOQ
Macrame Wall Hanging Shelf Boho Wood Floating Shelves With Cotton Rope Tassel Decoration For Home Living Room Storage Rack
Macrame Wall Hanging Shelf Boho Wood Floating Shelves With Cotton Rope Tassel Decoration For Home Living Room Storage Rack
like
Find Similar
Bohemian double-tier wood floating shelf with handmade macrame cotton rope hanging - Double Layer Dual Use Style
Minimalist double-layer wooden hanging wall shelf with woven white cotton ropes - Simple Double Layer Style
Beige 2-tier macrame wall hanging shelf with decorative wood beads and plant holder - Wood Bead Double Layer Style
Macrame Wall Hanging Shelf Boho Wood Floating Shelves With Cotton Rope Tassel Decoration For Home Living Room Storage Rack
-4%
$5.34-7.26
No MOQ
Wooden Wall Mounted Crystal Display Shelf Moon Phase Floral Pattern Bohemian Mystic Wall Hanging Storage Rack For Jewelry
Wooden Wall Mounted Crystal Display Shelf Moon Phase Floral Pattern Bohemian Mystic Wall Hanging Storage Rack For Jewelry
like
Find Similar
Detail view of black wooden moon phase shelf with golden floral engraving and display tray - Hanging Crystal Shelf
Wooden Wall Mounted Crystal Display Shelf Moon Phase Floral Pattern Bohemian Mystic Wall Hanging Storage Rack For Jewelry
-4%
$2.20
No MOQ
 · 
17 views
Vintage Metal Flower Bucket Vase With Hemp Rope Handle American Pastoral Galvanized Iron Pot For Garden Home Florist Decor
Vintage Metal Flower Bucket Vase With Hemp Rope Handle American Pastoral Galvanized Iron Pot For Garden Home Florist Decor
like
Find Similar
Set of 4 vintage cream metal flower buckets with garden embossing and rope handles - Height 25cm / Retro White
Set of four vintage blue galvanized metal flower buckets with rustic hemp rope handles - Height 25cm / Vintage Blue
+6
Vintage Metal Flower Bucket Vase With Hemp Rope Handle American Pastoral Galvanized Iron Pot For Garden Home Florist Decor
-12%
$1.78-3.52
No MOQ
 · 
18 views
Handmade Macrame Evil Eye Wall Hanging Decor Bohemian Cotton Rope Glass Bead Charm Amulet For Home Car Wall Art Decoration Gift
Handmade Macrame Evil Eye Wall Hanging Decor Bohemian Cotton Rope Glass Bead Charm Amulet For Home Car Wall Art Decoration Gift
like
Find Similar
Bohemian handmade macrame evil eye wall hanging with 12cm diameter and blue fringe - Blue
Macro view of rust red handmade macrame star wall decor with blue glass evil eye - Red
Detailed close-up of handmade yellow woven evil eye wall decor with sunburst fringe - Orange
Handmade bohemian macrame evil eye wall hanging with cream cotton tassels - White
+1
Handmade Macrame Evil Eye Wall Hanging Decor Bohemian Cotton Rope Glass Bead Charm Amulet For Home Car Wall Art Decoration Gift
$2.28
No MOQ
Handmade Macrame Owl Wall Hanging Boho Cotton Woven Tapestry With Wood Bar Nordic Home Decor For Bedroom Living Room Nursery
Handmade Macrame Owl Wall Hanging Boho Cotton Woven Tapestry With Wood Bar Nordic Home Decor For Bedroom Living Room Nursery
like
Find Similar
Olive green macrame owl wall hanging decoration with natural wood rod and tassel fringe - 20*50cm / Green
Handwoven dark brown owl wall hanging in Nordic boho style with tassels and wood beads - 20*50cm / Caramel color
Pink handmade macrame owl wall hanging with wooden stick and long bohemian tassels - 20*50cm / Brick Red
Handmade gray macrame owl wall hanging with wooden rod for bohemian home decor - 20*50cm / Gray
+2
Handmade Macrame Owl Wall Hanging Boho Cotton Woven Tapestry With Wood Bar Nordic Home Decor For Bedroom Living Room Nursery
$5.48
No MOQ
Bohemian Wood Mermaid Tail Wall Shelf Gradient Fish Scale Crystal Display Rack Hollow Out Floating Shelf For Home Bedroom
Bohemian Wood Mermaid Tail Wall Shelf Gradient Fish Scale Crystal Display Rack Hollow Out Floating Shelf For Home Bedroom
like
Find Similar
Mermaid tail floating shelf with blue scale pattern and white double display layers - 30*22cm / Mermaid Tail Style (ms8757)
Bohemian Wood Mermaid Tail Wall Shelf Gradient Fish Scale Crystal Display Rack Hollow Out Floating Shelf For Home Bedroom
$4.61
No MOQ
Boho Handwoven Cotton Rope Lampshade Macrame Tassel Pendant Light Cover Nordic Style Home Decor Chandelier Shade
Boho Handwoven Cotton Rope Lampshade Macrame Tassel Pendant Light Cover Nordic Style Home Decor Chandelier Shade
like
Find Similar
Hand-woven Bohemian cotton lamp shade with three-tier fringe tassels and openwork pattern - Style A Triple Layer Tassel With Comb / Beige
Bohemian three-tier handmade woven tassel lampshade in cream white cotton rope - Style B Triple Layer Tassel With Comb / Beige
Handwoven bohemian macrame lamp shade with double tassels in cream white, 30x50cm size - Style C Double Layer Tassel / Beige
Detail view of Bohemian woven lampshade with dimensions 30x100cm and tiered tassels - Style D Four Layer Tassel / Beige
+4
Boho Handwoven Cotton Rope Lampshade Macrame Tassel Pendant Light Cover Nordic Style Home Decor Chandelier Shade
-5%
$7.12-13.69
No MOQ
 · 
12 views
Handmade Macrame Plant Hanger Cotton Rope Wall Hanging Shelf With Round Wood Tray Bohemian Nordic Home Decor Floating Storage Rack
Handmade Macrame Plant Hanger Cotton Rope Wall Hanging Shelf With Round Wood Tray Bohemian Nordic Home Decor Floating Storage Rack
like
Find Similar
Handmade Macramé plant hanger with wooden tray for Nordic style indoor home wall decor - Round Wooden Board Style
Handmade Macrame Plant Hanger Cotton Rope Wall Hanging Shelf With Round Wood Tray Bohemian Nordic Home Decor Floating Storage Rack
$5.48
No MOQ
 · 
11 views
Handmade Pink Moon Dreamcatcher With Feathers And Decorative Beads Wall Hanging Ornament For Home Bedroom Decor Girl Birthday Gift
Handmade Pink Moon Dreamcatcher With Feathers And Decorative Beads Wall Hanging Ornament For Home Bedroom Decor Girl Birthday Gift
like
Find Similar
Pink moon shaped dream catcher with soft feathers and beads for wall hanging decoration - With LED Light Style / Pink
Handmade Pink Moon Dreamcatcher With Feathers And Decorative Beads Wall Hanging Ornament For Home Bedroom Decor Girl Birthday Gift
-5%
$2.41-2.79
No MOQ
Natural Agate Slice Crystal Suncatcher Hanging Ornament Moon Frame Healing Stone Bohemian Window Wall Home Decor
Natural Agate Slice Crystal Suncatcher Hanging Ornament Moon Frame Healing Stone Bohemian Window Wall Home Decor
like
Find Similar
Close-up of agate slice and crystal crescent moon suncatcher on pink geometric stands - Blue Sodalite
Detailed shot of green agate slice and crystal prism pendant on golden moon wind chime - Green Aventurine
Detail view of purple agate slice and moon shaped crystal suncatcher with golden chains - Purple Crystal
Detailed view of natural red agate moon sun catcher with colorful crystals and gold chain - Agate
+4
Natural Agate Slice Crystal Suncatcher Hanging Ornament Moon Frame Healing Stone Bohemian Window Wall Home Decor
$2.28
No MOQ
 · 
293 sold recently
Nazar Evil Eye Wall Hanging Ornament Lucky Horseshoe Elephant Charm Lampwork Glass Alloy Home Decor Protection Amulet
Nazar Evil Eye Wall Hanging Ornament Lucky Horseshoe Elephant Charm Lampwork Glass Alloy Home Decor Protection Amulet
like
Find Similar
Blue Evil Eye butterfly keychain with moon charms and protective Nazar pendant - Silver Moon Evil Eye Style (EY1362AS00)
Golden horseshoe and elephant wall hanging with blue evil eye charms for good luck - Gold Horseshoe Elephant Style (EY136GD00)
Macro shot of silver horseshoe wall hanging with blue evil eye bead and elephant charm - Silver Horseshoe Small Elephant Style (EY133BU00)
Nazar Evil Eye Wall Hanging Ornament Lucky Horseshoe Elephant Charm Lampwork Glass Alloy Home Decor Protection Amulet
-11%
$2.68-3.97
Mix MOQ : 2
Moon Suncatcher Natural Crushed Stone Tree Of Life Handmade Hanging Ornament Boho Wall Decor Rainbow Maker Prism Decor
Moon Suncatcher Natural Crushed Stone Tree Of Life Handmade Hanging Ornament Boho Wall Decor Rainbow Maker Prism Decor
like
Find Similar
Handmade crescent moon suncatcher with purple amethyst crystals and Tree of Life weaving - Purple
Golden moon suncatcher with yellow crystal tree of life and hanging agate slice - Yellow
Bohemian moon-shaped suncatcher with tree of life green crystals and hanging agate slices - Green
Pink crystal moon sun catcher with gold frame and vibrant agate slice pendant - Pink
Moon Suncatcher Natural Crushed Stone Tree Of Life Handmade Hanging Ornament Boho Wall Decor Rainbow Maker Prism Decor
$8.30
No MOQ
 · 
39 sold recently
Natural Wood Decorative Mini Ladder Rustic Pastoral Handmade Vine Prop For Home Wedding Window Display Vintage Brown Ornament
Natural Wood Decorative Mini Ladder Rustic Pastoral Handmade Vine Prop For Home Wedding Window Display Vintage Brown Ornament
like
Find Similar
Three-piece set of natural mini wooden decorative ladders in rustic dark brown finish - Height 15 x Width 10 Ladder Vine Frame
+5
Natural Wood Decorative Mini Ladder Rustic Pastoral Handmade Vine Prop For Home Wedding Window Display Vintage Brown Ornament
$0.49-1.59
Mix MOQ : 3
 · 
25 views
Tree Of Life Dreamcatcher With Purple Gravel Crystal Handmade Feather Wall Hanging Boho Home Bedroom Room Decor Ornament Gift
Tree Of Life Dreamcatcher With Purple Gravel Crystal Handmade Feather Wall Hanging Boho Home Bedroom Room Decor Ornament Gift
like
Find Similar
Tree of Life dreamcatcher with purple crystal stones and layered white feathers - Standard Style
Tree Of Life Dreamcatcher With Purple Gravel Crystal Handmade Feather Wall Hanging Boho Home Bedroom Room Decor Ornament Gift
$8.79
No MOQ
Handmade Seagrass Woven Wall Decor Round Straw Decorative Plates For Living Room Bedroom Bohemian Ethnic Style Background
Handmade Seagrass Woven Wall Decor Round Straw Decorative Plates For Living Room Bedroom Bohemian Ethnic Style Background
like
Find Similar
Macro shot of circular woven wall decor featuring black and natural straw fiber patterns - Small / A1 / Black Diagonal Texture
Round bohemian woven wall basket decor in vintage red and natural white fiber - Small / A2 / Bohemian Red White Natural
Handwoven boho wall decor disc featuring a spiral geometric pattern in orange and black - Small / A3 / Black Orange Spiral
Round woven wall decor in blue, white, and natural fibers with bohemian pattern - Small / A4 / Blue White Natural Concentric
+62
Handmade Seagrass Woven Wall Decor Round Straw Decorative Plates For Living Room Bedroom Bohemian Ethnic Style Background
$3.31-4.47
Mix MOQ : 2
Wood Leopard Butterfly Corner Wall Shelf Decorative Storage Rack Home Bedroom Living Room Bohemian Floating Shelf
Wood Leopard Butterfly Corner Wall Shelf Decorative Storage Rack Home Bedroom Living Room Bohemian Floating Shelf
like
Find Similar
Leopard print butterfly corner shelf dimensions shown with 28cm height and 20cm width - Leopard Butterfly Style (ms10785)
Detail view of bow-shaped wooden corner shelf with brown leopard print and 30cm height - Leopard Bow Style (ms10786)
Wood Leopard Butterfly Corner Wall Shelf Decorative Storage Rack Home Bedroom Living Room Bohemian Floating Shelf
$4.61-4.87
No MOQ
Vintage Metal Flower Bucket Vase With Hemp Rope Handles Retro Iron Garden Pail For Farmhouse Home Decor Flower Arrangement
Vintage Metal Flower Bucket Vase With Hemp Rope Handles Retro Iron Garden Pail For Farmhouse Home Decor Flower Arrangement
like
Find Similar
Detail of vintage white garden flower bucket with yellow stripes and hemp rope handles - Small Height 30cm Diameter 18.5cm / Vintage Blue
Set of 4 vintage cream metal flower buckets with garden embossing and rope handles - Medium Height 35cm Diameter 20.5cm / Retro White
+6
Vintage Metal Flower Bucket Vase With Hemp Rope Handles Retro Iron Garden Pail For Farmhouse Home Decor Flower Arrangement
$2.02-4.01
No MOQ
 · 
48 views
Bohemian Macrame Wall Hanging Mirror Cotton Rope Handmade Woven Mirror With Tassels Floral Shape For Living Room Home Decor
Bohemian Macrame Wall Hanging Mirror Cotton Rope Handmade Woven Mirror With Tassels Floral Shape For Living Room Home Decor
like
Find Similar
Bohemian handmade cotton woven wall mirror with fringe tassels for home wall decoration - Flower Shape (Flower Shape Mirror) / Off White
Bohemian Macrame Wall Hanging Mirror Cotton Rope Handmade Woven Mirror With Tassels Floral Shape For Living Room Home Decor
$7.49
No MOQ
Raven Shape Wooden Wall Shelf Gothic Moon Phase Stars Hollow Crystal Display Shelf Black Floating Jewelry Holder For Home Decor
Raven Shape Wooden Wall Shelf Gothic Moon Phase Stars Hollow Crystal Display Shelf Black Floating Jewelry Holder For Home Decor
like
Find Similar
Detail view of eagle shaped wooden crystal shelf with moon carvings and dimensions - 33*16cm / Raven Shape (ms9525)
Raven Shape Wooden Wall Shelf Gothic Moon Phase Stars Hollow Crystal Display Shelf Black Floating Jewelry Holder For Home Decor
$5.73
No MOQ
Bohemian Handmade Macrame Wall Hanging Mirror Decor Tassels Half Round Acrylic Mirror For Home Bedroom Decor Aesthetic
Bohemian Handmade Macrame Wall Hanging Mirror Decor Tassels Half Round Acrylic Mirror For Home Bedroom Decor Aesthetic
like
Find Similar
Bohemian macrame wall mirror with white fringe tassels and dimensions of 25x38cm - Off-white (ms9028)
Bohemian Handmade Macrame Wall Hanging Mirror Decor Tassels Half Round Acrylic Mirror For Home Bedroom Decor Aesthetic
$4.87
No MOQ
Retro Iron Wall Hanging Flower Pot Distressed White Metal Planter With Hemp Rope Handle Bird Pattern Decorative Garden Decor
Retro Iron Wall Hanging Flower Pot Distressed White Metal Planter With Hemp Rope Handle Bird Pattern Decorative Garden Decor
like
Find Similar
Detail of vintage wall-mounted iron planter with bird relief and jute rope handle - Retro Bird Hanging Pot (Approx 250g) / Small
Retro Iron Wall Hanging Flower Pot Distressed White Metal Planter With Hemp Rope Handle Bird Pattern Decorative Garden Decor
-5%
$2.46
No MOQ
 · 
11 sold recently
Aladdin Lamp Wishing Pot Vintage Zinc Alloy Enamel Carved Metal Decorative Desktop Ornament Home Decor
Aladdin Lamp Wishing Pot Vintage Zinc Alloy Enamel Carved Metal Decorative Desktop Ornament Home Decor
like
Find Similar
Vintage black and gold Aladdin lamp ornament with enamel finish and chain, 44.5x69.5mm - Small / Black
Vintage gold and green enamel Aladdin magic lamp decorative ornament 44.5x69.5mm - Small / Green
Vintage Aladdin magic lamp in purple enamel with golden floral filigree pattern - Purple
Red and gold vintage Aladdin lamp decorative ornament with intricate floral carvings - Small / Red
+2
Aladdin Lamp Wishing Pot Vintage Zinc Alloy Enamel Carved Metal Decorative Desktop Ornament Home Decor
$1.73
Mix MOQ : 3
 · 
73% reordered
Top 10% Best Sellers
in Home Decor
Free Shipping
Vintage Cast Iron Doorbell Wall Mounted Bird And Flower Design Decorative Garden Hand Bell Rustic Metal Hanging Ornament
Vintage Cast Iron Doorbell Wall Mounted Bird And Flower Design Decorative Garden Hand Bell Rustic Metal Hanging Ornament
like
Find Similar
Retro oversized cast iron dinner bell with vintage scrollwork and hanging rope - Spear Tip Hanging Bell 8425
Vintage cast iron welcome bell with bird and leaf motif, rustic finish, 46cm tall - Branch Bird Doorbell 7059
Vintage style large cast iron doorbell with braided rope and rustic finish - Hanging Bell 7220-Large
Antique bronze cast iron garden wall bell with decorative bird and scrollwork design - Hanging Bell 7220-Small
+21
Vintage Cast Iron Doorbell Wall Mounted Bird And Flower Design Decorative Garden Hand Bell Rustic Metal Hanging Ornament
-4%
$5.34-14.80
No MOQ
 · 
15 sold recently
Handmade Dreamcatcher With Feather Tree Of Life Crystal Beads Hanging Wall Decor For Bedroom Boho Home Ornament Wedding Gift
Handmade Dreamcatcher With Feather Tree Of Life Crystal Beads Hanging Wall Decor For Bedroom Boho Home Ornament Wedding Gift
like
Find Similar
Rainbow dream catcher with LED lights, 55cm long featuring pink and yellow feathers - Dreamy Rainbow Quality Choice / Default Quality Choice
Pink heart-shaped dreamcatcher with feathers and beads for wall decor, 60cm total length - The Only (light Pink) Quality Choice / Default Quality Choice
Dreamcatcher wall hanging with colorful feathers, 16cm diameter for boho home decor - Dream Candy Quality Selection / Default Quality Choice
Pink and purple crescent moon dreamcatcher with feathers and beads, 16x59cm size - Crescent Moon Elf Quality Selection / Default Quality Choice
+17
Handmade Dreamcatcher With Feather Tree Of Life Crystal Beads Hanging Wall Decor For Bedroom Boho Home Ornament Wedding Gift
$8.24-17.37
No MOQ
 · 
59 views
Free Shipping
Butterfly Crystal Suncatcher Wind Chime With Natural Stone Beads Sun Moon Star Metal Hanging Ornament For Garden Decor
Butterfly Crystal Suncatcher Wind Chime With Natural Stone Beads Sun Moon Star Metal Hanging Ornament For Garden Decor
like
Find Similar
Silver butterfly and crescent moon suncatcher with amethyst stones and crystals - Purple Crystal
Detail of silver butterfly suncatcher with crystal pendants and moon star charms - Watermelon Red (Synthetic)
Detail of silver butterfly suncatcher with colorful crystal beads and moon charm on arm - Fluorite
Detailed close-up of butterfly suncatcher with crystal beads and metal celestial charms - Red Aventurine
+37
Butterfly Crystal Suncatcher Wind Chime With Natural Stone Beads Sun Moon Star Metal Hanging Ornament For Garden Decor
$3.17
Mix MOQ : 2
 · 
111 sold recently
Boho Evil Eye Wall Hanging Jute Rope Hand Woven Moon Shape Nazar Amulet Home Bedroom Decor With Tassel Glass
Boho Evil Eye Wall Hanging Jute Rope Hand Woven Moon Shape Nazar Amulet Home Bedroom Decor With Tassel Glass
like
Find Similar
Bohemian jute woven evil eye wall decor with fringe and blue glass amulet, size 30x24cm - Iron Ring Hemp Rope Blue Evil Eye Wall Decor
Boho Evil Eye Wall Hanging Jute Rope Hand Woven Moon Shape Nazar Amulet Home Bedroom Decor With Tassel Glass
$4.58
No MOQ
 · 
17 views
Nordic Boho Handwoven Tassel Wall Hanging Cotton Rope Sphere Ball Pendant For Living Room Bedroom Door Handle Home Decor
Nordic Boho Handwoven Tassel Wall Hanging Cotton Rope Sphere Ball Pendant For Living Room Bedroom Door Handle Home Decor
like
Find Similar
Handwoven black and white ball tassel pendant decoration for door handles, 70cm length - Spherical / Black Cotton Rope
Handwoven Nordic door hanger with white spherical accents and long tassels 70cm decoration - Spherical / Beige Cotton Rope
Handwoven Nordic door handle tassel with sphere ornament and colorful thread accents - With Ring Ornament / Multicolor
NewNordic Boho Handwoven Tassel Wall Hanging Cotton Rope Sphere Ball Pendant For Living Room Bedroom Door Handle Home Decor
$3.75-8.36
No MOQ
Rustic Wall Mounted Wooden Flower Pot Decor With Artificial Plants Home Sign Lettering Hanging Planter For Wall Art Garden
Rustic Wall Mounted Wooden Flower Pot Decor With Artificial Plants Home Sign Lettering Hanging Planter For Wall Art Garden
like
Find Similar
Pastoral white wooden wall planter with Home text and fence design, 22x22cm size - H22xW11xL22cm / White
Vintage wooden 2-slot wall planter with Home text and rustic fence back, 22cm size - H22xW11xL22cm / Gray
Rustic Wall Mounted Wooden Flower Pot Decor With Artificial Plants Home Sign Lettering Hanging Planter For Wall Art Garden
-11%
$2.54
No MOQ
 · 
18 views
Bohemian Wooden Floating Shelf Wall Mounted Mystical Moon Phase Black Gold Candle Holder Jewelry Display Home Decor
Bohemian Wooden Floating Shelf Wall Mounted Mystical Moon Phase Black Gold Candle Holder Jewelry Display Home Decor
like
Find Similar
Bohemian black wooden candle holder shelf set with mystical gold moon and star engravings - Set of 6
Bohemian Wooden Floating Shelf Wall Mounted Mystical Moon Phase Black Gold Candle Holder Jewelry Display Home Decor
$8.37
Mix MOQ : 20
 · 
31 sold recently
Metal Butterfly Wall Decor Colorful Hand Painted 3D Hanging Ornament For Garden Fence Patio Indoor Outdoor
Metal Butterfly Wall Decor Colorful Hand Painted 3D Hanging Ornament For Garden Fence Patio Indoor Outdoor
like
Find Similar
Colorful metal butterfly wall decor in purple and pink gradient, 16x12 cm size guide - Purple
Blue metal butterfly wall art decor with black spots and 16x12cm size markings - Blue
Green butterfly iron wall art for garden decor with 16cm width and 12cm height - Green
Orange butterfly metal wall decor measuring 16x12cm for indoor and outdoor garden use - Yellow
Metal Butterfly Wall Decor Colorful Hand Painted 3D Hanging Ornament For Garden Fence Patio Indoor Outdoor
$2.07
Mix MOQ : 3
 · 
16 sold recently
Wooden Wall Shelf Hollow Butterfly Lotus Bat Corner Display Rack For Crystal Stone Essential Oil Home Decor
Wooden Wall Shelf Hollow Butterfly Lotus Bat Corner Display Rack For Crystal Stone Essential Oil Home Decor
like
Find Similar
Black butterfly wooden wall shelf with laser-cut patterns and 30x26cm size guide - ms8752 Butterfly Hook
Wooden lotus wall shelf with mandala patterns showing dimensions of 29cm by 23.5cm - ms8420 Lotus
Gothic black bat wooden shelf with crescent moon accent, 30cm wide wall organizer - ms8646 Bat
Triple Moon wooden shelf with black Celtic patterns and laser-cut butterfly hollow design - ms8415 Sun & Moon
+18
Wooden Wall Shelf Hollow Butterfly Lotus Bat Corner Display Rack For Crystal Stone Essential Oil Home Decor
-4%
$4.38
No MOQ
 · 
40 views
Bohemian Handwoven Macrame Wall Mirror Boho Round Decorative Mirror With Tassels Wood Beads For Home Bedroom Living Room Decor
Bohemian Handwoven Macrame Wall Mirror Boho Round Decorative Mirror With Tassels Wood Beads For Home Bedroom Living Room Decor
like
Find Similar
Boho woven mirror with wooden beads and leaf tassels for Nordic wall decor - Coffee Leaf Style
Detailed macro view of bohemian handmade macrame wall mirror with fringe and wood beads - Coffee Wood Bead Style
Detail of woven mirror measuring 26.5cm diameter with handmade cotton fringe - Coffee Tassel Style
Bohemian Handwoven Macrame Wall Mirror Boho Round Decorative Mirror With Tassels Wood Beads For Home Bedroom Living Room Decor
$7.35-9.37
No MOQ
Wooden Flying Birds Wall Hanging Decor Bohemian Mandala Pattern Minimalist Home Decoration For Living Room Bedroom Office
Wooden Flying Birds Wall Hanging Decor Bohemian Mandala Pattern Minimalist Home Decoration For Living Room Bedroom Office
like
Find Similar
Detailed size specifications for a three-piece black wooden bird wall art set with floral patterns - Mandala Patterned Bird (MS6574)
Wooden Flying Birds Wall Hanging Decor Bohemian Mandala Pattern Minimalist Home Decoration For Living Room Bedroom Office
$5.48
No MOQ
Natural Rattan Double Heart Wreath Handmade Rustic Woven Hanging Decoration For Home Wedding Christmas Wall Decor Hanging
Natural Rattan Double Heart Wreath Handmade Rustic Woven Hanging Decoration For Home Wedding Christmas Wall Decor Hanging
like
Find Similar
2 options
Natural Rattan Double Heart Wreath Handmade Rustic Woven Hanging Decoration For Home Wedding Christmas Wall Decor Hanging
$1.30-1.44
Mix MOQ : 2
Real Butterfly Specimen Shadow Box Frame Handmade Insect Taxidermy Display Wood Glass Home Tabletop Wall Decor
Real Butterfly Specimen Shadow Box Frame Handmade Insect Taxidermy Display Wood Glass Home Tabletop Wall Decor
like
Find Similar
3D butterfly specimens in black shadow box frame with Common Tiger and Red sawfly - Black / 6 inch (13.1x18.2cm)
3D hollow shadow box frame with a real metallic green butterfly specimen and white finish - White / 6 inch (13.1x18.2cm)
3D butterfly specimen in deep wood frame with emerald green wings for desktop display - Walnut / 6 inch (13.1x18.2cm)
+15
Real Butterfly Specimen Shadow Box Frame Handmade Insect Taxidermy Display Wood Glass Home Tabletop Wall Decor
$1.38-4.32
No MOQ
 · 
24 views
Nordic Style Wood Bead Evil Eye Hanging Ornament Boho Wall Decor Car Rearview Mirror Pendant For Home Office Protection
Nordic Style Wood Bead Evil Eye Hanging Ornament Boho Wall Decor Car Rearview Mirror Pendant For Home Office Protection
like
Find Similar
Bohemian wood bead hanging ornament with blue evil eye glass pendant 18cm length - Small Size Wood Bead Style
Nordic wooden bead hanging with blue glass evil eye pendant for car and wall decor - Large Size Wood Bead Style
Nordic Style Wood Bead Evil Eye Hanging Ornament Boho Wall Decor Car Rearview Mirror Pendant For Home Office Protection
$1.12
No MOQ
Modern Nordic Wabi-Sabi Matte White Pottery Vase Morandi Color Abstract Irregular Ceramic Floral Desktop Ornament Art Decor
Modern Nordic Wabi-Sabi Matte White Pottery Vase Morandi Color Abstract Irregular Ceramic Floral Desktop Ornament Art Decor
like
Find Similar
Nordic ceramic vase HP698-BG in beige with handcrafted texture and double handles - Beige Long Oval Ear Decor Style (HP698-BG)
Morandi light green ceramic vase with a matte finish, sized 13.5cm by 22.5cm - Yellow Green Long Neck Bottle Style (HP699-YG)
Abstract ceramic vase in matte beige pink with 21cm height and artistic curved design - Khaki Figure 8 Abstract Style (HP700-KHK)
Modern matte grey ceramic wall-mounted vase with organic shape 15cm x 20.5cm - Gray Green Slant Mouth Style (HP701-GYGN)
+1
Modern Nordic Wabi-Sabi Matte White Pottery Vase Morandi Color Abstract Irregular Ceramic Floral Desktop Ornament Art Decor
$8.36-19.02
Mix MOQ : 2
 · 
13 views
Modern Minimalist Rectangular Wood Wall Mounted Shelf Burnt Wood Floating Frame Decor For Bedroom B&B Home Decor
Modern Minimalist Rectangular Wood Wall Mounted Shelf Burnt Wood Floating Frame Decor For Bedroom B&B Home Decor
like
Find Similar
Detail of wall-mounted charred wood frame shelves showing natural grain and rustic texture - Dark Wood Grain Two-Piece Set (MS11474)
Modern black wooden rectangular wall-mounted planter shelf set with natural wood grain - Black Wood Grain Two-Piece Set (MS11475)
Detailed view of dark charred wood frame components with precise size specifications - Black Individual Frame (ms11467)
Detailed view of dark brown wood shelf components with natural texture and dimensions - Dark Brown Individual Frame (ms11468)
Modern Minimalist Rectangular Wood Wall Mounted Shelf Burnt Wood Floating Frame Decor For Bedroom B&B Home Decor
$5.45-10.35
No MOQ
Mediterranean Style Wooden Anchor Thermometer Wall Hook Decorative Nautical Hanging Ornament For Kids Room Home Decor
Mediterranean Style Wooden Anchor Thermometer Wall Hook Decorative Nautical Hanging Ornament For Kids Room Home Decor
like
Find Similar
1 option
Mediterranean Style Wooden Anchor Thermometer Wall Hook Decorative Nautical Hanging Ornament For Kids Room Home Decor
$1.27
Mix MOQ : 2
Tree Of Life Heart Suncatcher K9 Crystal Prism Natural Stone Wire Wrapped Hanging Ornament Rainbow Maker Window Decor
Tree Of Life Heart Suncatcher K9 Crystal Prism Natural Stone Wire Wrapped Hanging Ornament Rainbow Maker Window Decor
like
Find Similar
Tree of Life heart crystal suncatcher with colorful stones and teardrop pendant - Colorful Stone Heart
Pink heart-shaped Tree of Life crystal suncatcher with copper wire and teardrop charm - Pink Quartz Heart
Detail of tree of life heart crystal suncatcher with copper wire and orange stones - Red Agate Heart
Tree of Life heart crystal suncatcher with red stones and prism for window decor - Red Coral Heart
+7
Tree Of Life Heart Suncatcher K9 Crystal Prism Natural Stone Wire Wrapped Hanging Ornament Rainbow Maker Window Decor
$3.46-10.37
Mix MOQ : 3
 · 
20 sold recently
Free Shipping
Bohemian Wooden Moon Phase Wall Shelf Snake Infinity Shape Crystal Display Rack Jewelry Organizer Home Decor Gift
Bohemian Wooden Moon Phase Wall Shelf Snake Infinity Shape Crystal Display Rack Jewelry Organizer Home Decor Gift
like
Find Similar
Detail view of black wooden moon phase shelf with intricate engraved botanical patterns - Snake Infinity Style (ms9520)
Bohemian Wooden Moon Phase Wall Shelf Snake Infinity Shape Crystal Display Rack Jewelry Organizer Home Decor Gift
$4.61
No MOQ
Handmade Lotus Macrame Wall Hanging Cotton Rope Boho Tassel Decoration With Wood Beads For Living Room Bedroom Home Art Decor
Handmade Lotus Macrame Wall Hanging Cotton Rope Boho Tassel Decoration With Wood Beads For Living Room Bedroom Home Art Decor
like
Find Similar
Detail showing bohemian macrame wall hanging with wooden lotus frame and bead accents - Lotus Handmade Woven Tapestry (ms6318)
Handmade Lotus Macrame Wall Hanging Cotton Rope Boho Tassel Decoration With Wood Beads For Living Room Bedroom Home Art Decor
$7.46
No MOQ
Tree Of Life Dreamcatcher Luminous Natural Crystal Stone Chips Hanging Ornament With Feathers For Home Car Decor Bohemian Style
Tree Of Life Dreamcatcher Luminous Natural Crystal Stone Chips Hanging Ornament With Feathers For Home Car Decor Bohemian Style
like
Find Similar
Tree of Life dreamcatcher with green feathers and natural crystal beads for car decor - Green Aventurine
Handmade Tree of Life dream catcher with orange feathers and natural crystal stones - Red Agate
White dream catcher with tree of life crystal design and soft feathers hanging in nature - White Crystal
Handmade purple crystal dream catcher car pendant with amethyst tree of life and feathers - Deep Amethyst
+6
Tree Of Life Dreamcatcher Luminous Natural Crystal Stone Chips Hanging Ornament With Feathers For Home Car Decor Bohemian Style
$3.60
Mix MOQ : 2
 · 
156 sold recently
Free Shipping
Crystal Suncatcher Wind Chime Sun Moon Heart Colorful Metal Prism Rainbow Maker Window Garden Hanging Home Decoration
Crystal Suncatcher Wind Chime Sun Moon Heart Colorful Metal Prism Rainbow Maker Window Garden Hanging Home Decoration
like
Find Similar
Golden suncatcher with moon and star frame featuring pink blue gems and crystal ball - Moon Star Style 20cm/36g
Golden star suncatcher with purple crystal accents and iridescent light reflection - Sun Pointed Bead Style 20cm/36g
Detail view of crystal suncatcher with sun and star metal frame and dimension markings - Sun Heart Style 36cm/34g
Detail showing dimensions of golden moon and star suncatcher with crystal pendants - Moon Heart Style 36cm/34g
+2
Crystal Suncatcher Wind Chime Sun Moon Heart Colorful Metal Prism Rainbow Maker Window Garden Hanging Home Decoration
$1.92-2.74
No MOQ
 · 
304 sold recently
Top 5% Best Sellers
in Home Decor
Free Shipping
Bohemian Macrame Wall Hanging Cotton Woven Tapestry Colorful Leaves Tassels Nordic Style Handwoven Wall Decor For Home
Bohemian Macrame Wall Hanging Cotton Woven Tapestry Colorful Leaves Tassels Nordic Style Handwoven Wall Decor For Home
like
Find Similar
Bohemian woven cotton wall hanging with colorful leaves and fringe on a wooden rod - Colorful
Bohemian Macrame Wall Hanging Cotton Woven Tapestry Colorful Leaves Tassels Nordic Style Handwoven Wall Decor For Home
$9.37
No MOQ
Bohemian Evil Eye Wood Bead Tassel Hanging Ornament Mediterranean Style Door Handle Car Mirror Wall Decor Accessory
Bohemian Evil Eye Wood Bead Tassel Hanging Ornament Mediterranean Style Door Handle Car Mirror Wall Decor Accessory
like
Find Similar
Handmade wood bead ring with evil eye accent and long white cotton tassel charm - Style A (25cm Long)
Boho evil eye wall hanging charm with wooden beads and long white tassels for home decor - White Tassel with Pearl Decor Style (B)
Ethnic wood bead charm with dark grey tassels and evil eye bead on a door handle - Style C (25cm Long)
Boho wood bead tassel charm with letter D and blue evil eye glass bead ornament - Style D (25cm Long)
+3
Bohemian Evil Eye Wood Bead Tassel Hanging Ornament Mediterranean Style Door Handle Car Mirror Wall Decor Accessory
$1.41
Mix MOQ : 5
Handmade Bohemian Macrame Wall Hanging Cotton Woven Dream Catcher Moon Star Owl Tassel Decor For Home Living Room Bedroom Art
Handmade Bohemian Macrame Wall Hanging Cotton Woven Dream Catcher Moon Star Owl Tassel Decor For Home Living Room Bedroom Art
like
Find Similar
Bohemian moon-shaped dream catcher with cream cotton ropes and hanging tassels - Moon
Handmade bohemian white star dreamcatcher wall hanging with black metal pendant - Star
Handmade woven cotton dreamcatcher with crescent moon design and wooden owl charm - Owl
Handmade Bohemian macrame dream catcher with woven leaf tassels on a wooden ring - Bamboo Ring 30cm
+4
Handmade Bohemian Macrame Wall Hanging Cotton Woven Dream Catcher Moon Star Owl Tassel Decor For Home Living Room Bedroom Art
$3.31-7.64
No MOQ
Art Nouveau Resin Lady Relief Wall Hanging Decorative Flower Wreath Fairy Wall Ornament For Garden Home Wall Decoration
Art Nouveau Resin Lady Relief Wall Hanging Decorative Flower Wreath Fairy Wall Ornament For Garden Home Wall Decoration
like
Find Similar
European fairy style resin wall relief with red-haired woman and colorful floral frame - Beauty Wreath Wall Hanging
Art Nouveau Resin Lady Relief Wall Hanging Decorative Flower Wreath Fairy Wall Ornament For Garden Home Wall Decoration
$7.78
Mix MOQ : 50
Free Shipping
Modern Minimalist Pine Wood Picture Frame Solid Wood Photo Frame Wall Hanging Tabletop Home Art Decor Rectangular Frame
Modern Minimalist Pine Wood Picture Frame Solid Wood Photo Frame Wall Hanging Tabletop Home Art Decor Rectangular Frame
like
Find Similar
64 options
Modern Minimalist Pine Wood Picture Frame Solid Wood Photo Frame Wall Hanging Tabletop Home Art Decor Rectangular Frame
$2.02-12.26
Mix MOQ : 2
 · 
27 views
Bohemian Handmade Woven Tapestry Cotton Rope Round Tassels Wall Hanging With Wood Pole For Bedroom Living Room Decor
Bohemian Handmade Woven Tapestry Cotton Rope Round Tassels Wall Hanging With Wood Pole For Bedroom Living Room Decor
like
Find Similar
Bohemian woven cotton wall hanging with wood beads and light blue fringe accents - Sky Blue
Bohemian Handmade Woven Tapestry Cotton Rope Round Tassels Wall Hanging With Wood Pole For Bedroom Living Room Decor
$12.68
No MOQ
Woven Rainbow Hair Bow Holder Cotton Rope Wood Wall Hanging Storage Organizer Kids Room Nursery Decor Lace Ribbons
Woven Rainbow Hair Bow Holder Cotton Rope Wood Wall Hanging Storage Organizer Kids Room Nursery Decor Lace Ribbons
like
Find Similar
Close-up of rainbow woven wall hanging storage with colorful flower and fruit hair clips - Pink Brown Blue White Rainbow Style (A1)
Detail of bohemian woven rainbow wall hanging with decorative macrame tassels and clips - Red Yellow Green Rainbow Style (A2)
Detail of woven rainbow wall hanging with lace ribbons for hair clip storage - Purple Gold Orange Pink Rainbow Style (A4)
Detail of woven rainbow wall hanging with pink flowers and crochet carrot decor - Pink Orange Silver White Rainbow Style (A5)
+7
Woven Rainbow Hair Bow Holder Cotton Rope Wood Wall Hanging Storage Organizer Kids Room Nursery Decor Lace Ribbons
$4.18
No MOQ
 · 
33 views
Handmade Dream Catcher Tree Of Life Crystal Stone Natural Feathers Wall Hanging Home Decor Bohemian Ethnic Style
Handmade Dream Catcher Tree Of Life Crystal Stone Natural Feathers Wall Hanging Home Decor Bohemian Ethnic Style
like
Find Similar
Dreamcatcher with pink stone Tree of Life design and hanging black feathers - 9548 Black Tree of Life / Black/Multicolor Stones
Pink Tree of Life dreamcatcher with natural feathers hanging on a light blue wall - 9447B Pink Tree of Life / Pink
Handmade black dream catcher with tree of life pattern and natural feathers wall decor - 9496 Colorful Beads Tree of Life / Black
Handmade black dream catcher with tree of life design and natural feathers, 56cm long - 9496A Colorful Rhombus Beads Tree of Life / Black
+5
Handmade Dream Catcher Tree Of Life Crystal Stone Natural Feathers Wall Hanging Home Decor Bohemian Ethnic Style
$4.26-10.95
No MOQ
 · 
90 views
Free Shipping
Mediterranean Heart Shaped Wood Hanging Ornament Tropical Flamingo Gecko Palm Tree IBIZA Beach Party Home Wall Decor
Mediterranean Heart Shaped Wood Hanging Ornament Tropical Flamingo Gecko Palm Tree IBIZA Beach Party Home Wall Decor
like
Find Similar
IBIZA wooden heart ornament with flamingo and palm tree patterns for beach home decor - Flamingo
Detail of heart wooden ornament with green lizard, Ibiza text and tropical palm leaves - Gecko
Macro detail of a heart-shaped wooden Ibiza ornament with palm tree and camper van - Car
Mediterranean Heart Shaped Wood Hanging Ornament Tropical Flamingo Gecko Palm Tree IBIZA Beach Party Home Wall Decor
$1.44
Mix MOQ : 2
Free Shipping
Vintage Portuguese Cork Folding Fan With Wooden Frame Handheld Decorative Fan For Home Decor Travel Souvenir
Vintage Portuguese Cork Folding Fan With Wooden Frame Handheld Decorative Fan For Home Decor Travel Souvenir
like
Find Similar
Detail of vintage cork folding fan with Portuguese blue azulejo patterns and bamboo ribs - Blue Plaid
Detailed close-up of a vintage patchwork cork folding fan with elegant wooden ribs - Colorful Plaid
Detailed view of an open cork fan with vibrant floral patterns on a white table - Daisy
Detailed view of the vintage floral pattern fabric and light wood ribs of a cork folding fan - Romantic Pink Rose
+2
Vintage Portuguese Cork Folding Fan With Wooden Frame Handheld Decorative Fan For Home Decor Travel Souvenir
$2.16
Mix MOQ : 8
 · 
57 sold recently
Bicycle Wall Hanging Decor Iron Flower Basket European Style Metal Plant Holder Rack Home Living Room Decoration
Bicycle Wall Hanging Decor Iron Flower Basket European Style Metal Plant Holder Rack Home Living Room Decoration
like
Find Similar
European style white iron bicycle wall planter for home balcony and garden decor - White
Bicycle Wall Hanging Decor Iron Flower Basket European Style Metal Plant Holder Rack Home Living Room Decoration
$6.47
No MOQ
 · 
45 views
Bohemian Raffia Wall Hanging Woven Fringe Macrame Tassels With Wooden Beads For Home Nursery Boho Wall Decor Gift
Bohemian Raffia Wall Hanging Woven Fringe Macrame Tassels With Wooden Beads For Home Nursery Boho Wall Decor Gift
like
Find Similar
Handmade woven raffia wall hanging with wooden beads and tassels for boho home decor - Classic Check / 60*35cm
Bohemian Raffia Wall Hanging Woven Fringe Macrame Tassels With Wooden Beads For Home Nursery Boho Wall Decor Gift
-4%
$4.03
No MOQ
Go to

More in home & kitchen

Explore more in home decor accessories

homehangingwallholidaywall hangingmagneticmakingwhitedisplaysofa
resindesktoppartymetaldecorativestyleroundstoragetreesmall

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access