Everful

Wholesale mini resin animals

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Mini Resin Animals

Find the perfect pieces: figurine & miniature collectibles, decorative crafts, decorative collectibles and more

All products in mini resin animals

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Cute Princess Resin Figurine With Golden Crown Gradient Hair Cloud Base Desktop Decoration For Kids Room
Cute Princess Resin Figurine With Golden Crown Gradient Hair Cloud Base Desktop Decoration For Kids Room
like
Find Similar
Cute cartoon girl figurine in mint green outfit with pink bow for room decor - Backpack Girl Ornament (BJ-11A)
Cute resin princess figurine with bunny ears and blue outfit for desk decoration - Milk Tea Girl Ornament (BJ-11B)
Cute pink princess cake topper girl figurine with gold pigtails and a large bow tie - Bowknot Girl Ornament (BJ-11C)
Cute resin princess figurine with pink bunny ears holding a flower in yellow outfit - Girl Holding Flower Ornament (BJ-11D)
+4
Cute Princess Resin Figurine With Golden Crown Gradient Hair Cloud Base Desktop Decoration For Kids Room
$2.07-2.10
No MOQ
Realistic Penguin Animal Model Figures Simulation Emperor Penguin Plastic Educational Desktop Toy Ornaments Kids
Realistic Penguin Animal Model Figures Simulation Emperor Penguin Plastic Educational Desktop Toy Ornaments Kids
like
Find Similar
Realistic solid penguin animal model with red facial details and 14cm length dimension - Skiing Penguin (PL127-114)
Lifelike Emperor Penguin model figure with dimensions 7x4.5x3cm on white background - Standing Emperor Penguin (PL127-115)
Realistic adult emperor penguin figurine model toy with size marking 4cm height - Walking Emperor Penguin (PL127-182)
Solid penguin animal model figure with detailed texture and size dimensions shown - Penguin Baby (PL127-435)
+6
Realistic Penguin Animal Model Figures Simulation Emperor Penguin Plastic Educational Desktop Toy Ornaments Kids
-5%
$0.96-9.60
No MOQ
Free Shipping
Cute Bear Figurine Diatom Mud Golden Crown Hands Over Eyes Rose Texture Desktop Car Interior Ornament Cake Topper
Cute Bear Figurine Diatom Mud Golden Crown Hands Over Eyes Rose Texture Desktop Car Interior Ornament Cake Topper
like
Find Similar
4 options
Cute Bear Figurine Diatom Mud Golden Crown Hands Over Eyes Rose Texture Desktop Car Interior Ornament Cake Topper
$1.67
No MOQ
Crochet Mini Potted Flower Ornament Hand-woven Yarn Sunflower Tulip Rose Daisy Car Dashboard Desk Decor Cute
Crochet Mini Potted Flower Ornament Hand-woven Yarn Sunflower Tulip Rose Daisy Car Dashboard Desk Decor Cute
like
Find Similar
Handmade crochet sunflower car ornament with ladybird detail on dashboard - Sunflower Potted
Pink and white handmade crochet flower pot decor on dark surface with green bokeh - Puff Flower Potted
Handmade crochet white daisy mini potted plant decor for car interior and dashboard - Daisy Potted
Handmade crochet mini potted plant with two white flowers for car dashboard decor - Lily of the Valley Potted
+6
Crochet Mini Potted Flower Ornament Hand-woven Yarn Sunflower Tulip Rose Daisy Car Dashboard Desk Decor Cute
$1.87-2.16
Mix MOQ : 2
 · 
119 sold recently
Resin Rabbit Family Figurines Hand Painted Rural Style Desktop Decor For Easter Birthday Gift Living Room Ornament
Resin Rabbit Family Figurines Hand Painted Rural Style Desktop Decor For Easter Birthday Gift Living Room Ornament
like
Find Similar
Cute resin father and son rabbit figurine with carrot detail measuring 18cm height - Rabbit Father & Son
Resin rabbit mother and daughter figurines in purple dresses for home decor - Rabbit Mother & Daughter
Resin Rabbit Family Figurines Hand Painted Rural Style Desktop Decor For Easter Birthday Gift Living Room Ornament
$3.30
Mix MOQ : 2
Cute Cartoon Mouse Resin Figurine Shaking Head Car Ornament Desktop Decoration Creative Gift Nodding Mouse Toy
Cute Cartoon Mouse Resin Figurine Shaking Head Car Ornament Desktop Decoration Creative Gift Nodding Mouse Toy
like
Find Similar
Cute pink resin mouse car ornament with Lucky heart and floral decor background - Pink Mouse Lucky Style A
Cute Cartoon Mouse Resin Figurine Shaking Head Car Ornament Desktop Decoration Creative Gift Nodding Mouse Toy
$2.85
No MOQ
Cute Shaking Head Dog Bobblehead Car Dashboard Ornament Resin Miniature Puppy Figurine For Home Office Desk Decor
Cute Shaking Head Dog Bobblehead Car Dashboard Ornament Resin Miniature Puppy Figurine For Home Office Desk Decor
like
Find Similar
Detailed view of a grey resin nodding dog ornament with realistic fur textures on wood - Husky
Macro detail of a white resin bobblehead dog with realistic fur texture and cute expression - White Teddy
Close-up of resin Shiba Inu car ornament with detailed fur texture and smiling face - Shiba Inu
Cute Shaking Head Dog Bobblehead Car Dashboard Ornament Resin Miniature Puppy Figurine For Home Office Desk Decor
$3.17
No MOQ
Handmade Knitted Emotional Support Plant Sunflower Heart Potted Desktop Ornament Gift For Home Office Desk Decoration
Handmade Knitted Emotional Support Plant Sunflower Heart Potted Desktop Ornament Gift For Home Office Desk Decoration
like
Find Similar
Handmade crochet pink heart potted plant with emotional support card on pink background - Pink Heart
Handmade crochet emotional support heart plant in a pot with encouragement card - Red Heart
Handmade knitted sunflower plant with Emotional Support card on bright yellow background - 4-Ring Pointed Sunflower
Detail of crochet sunflower pot with cute smiling face and motivational card - 5-Ring Smiley Sunflower
Handmade Knitted Emotional Support Plant Sunflower Heart Potted Desktop Ornament Gift For Home Office Desk Decoration
$2.07-2.33
Mix MOQ : 2
 · 
10 sold recently
Lucky Koi Fish Fortune Cat Resin Storage Tray Ornament Desk Key Jewelry Snack Organizer Modern Feng Shui Home Decoration
Lucky Koi Fish Fortune Cat Resin Storage Tray Ornament Desk Key Jewelry Snack Organizer Modern Feng Shui Home Decoration
like
Find Similar
Artistic koi maiden resin statue in green and orange holding golden key tray - Standing Lady
Tang Dynasty style lady figurine holding a golden tray for desk storage and decor - Half-standing Lady
Astronaut French Bulldog resin ornament with golden metal tray for key storage - Grey Astronaut Dog
Lucky koi fish storage ornament with golden tray and fortune cat for home decor - Red Koi
+56
Lucky Koi Fish Fortune Cat Resin Storage Tray Ornament Desk Key Jewelry Snack Organizer Modern Feng Shui Home Decoration
-5%
$0.93-20.57
No MOQ
 · 
10 views
Angel Figurine Hand Painted Resin Sister Sculpture Friendship Memorial Gift Home Decor Desktop Ornament
Angel Figurine Hand Painted Resin Sister Sculpture Friendship Memorial Gift Home Decor Desktop Ornament
like
Find Similar
Friendship sculpture figurine featuring two women in dresses with Best Friends engraving - Two Girls (Best Friends)
Close-up of resin angel figurine holding a white bird with Forever my Friend engraving - Angel Holding Bird (Forever Friend)
Friendship angel sculpture in beige with white bouquet and heartwarming quote on dress - Girl Holding Flowers (Great Friends)
Three sisters resin friendship sculpture in beige finish labeled Big Middle and Lil Sis - Three Girls (Sisters)
+8
Angel Figurine Hand Painted Resin Sister Sculpture Friendship Memorial Gift Home Decor Desktop Ornament
-5%
$2.05-5.21
Mix MOQ : 2
 · 
24 views
Resin Cartoon Palace Cat Figurines Chinese Vintage Imperial Character Desktop Statues For Home Office Car Decoration Gift
Resin Cartoon Palace Cat Figurines Chinese Vintage Imperial Character Desktop Statues For Home Office Car Decoration Gift
like
Find Similar
Cute white resin cat figurine with pink rose crown and pearl base for desk decoration - Palace Cat Queen B
Cartoon resin cat figurine with red hat and yellow fan, dimensions 5.9x5.1x5.2CM - Palace Cat Emperor A
Retro court cat figurine with gold helmet and silver fish, 7.4x5.3cm desktop ornament - Palace Cat General C
White vintage cat figurine with pink cloak and hairpins for cake or car decor, 6.5cm - Palace Cat Concubine D
Resin Cartoon Palace Cat Figurines Chinese Vintage Imperial Character Desktop Statues For Home Office Car Decoration Gift
$2.54
No MOQ
Vintage Brass Elephant Mammoth Miniature Figurine Metal Desk Decoration Home Office Tea Pet Antique Style Art Statue
Vintage Brass Elephant Mammoth Miniature Figurine Metal Desk Decoration Home Office Tea Pet Antique Style Art Statue
like
Find Similar
Vintage bronze mammoth statue with detailed fur texture on elegant wooden base - Mammoth
Miniature solid brass elephant figurine with antique finish for tea ceremony and desk decor - Elephant
Vintage brass elephant figurine with traditional patterns for home and office desk decor - Lucky Elephant
Macro shot of vintage brass elephant statue with detailed floral saddle engraving - Curled Trunk Elephant
+4
Vintage Brass Elephant Mammoth Miniature Figurine Metal Desk Decoration Home Office Tea Pet Antique Style Art Statue
$0.52-1.47
No MOQ
 · 
16 sold recently
Nordic Nordic Minimalist Wooden Dog and Human Interaction Ornaments Beechwood Black Walnut Carved Craft Home Desktop Decor
Nordic Nordic Minimalist Wooden Dog and Human Interaction Ornaments Beechwood Black Walnut Carved Craft Home Desktop Decor
like
Find Similar
Handcrafted wooden dog and family figurines for creative Nordic style desk decoration - Dog and Family (B01)
Handcrafted Nordic style minimalist wooden carving set - Style B02 Woman and Dog - Dog and Woman (B02)
Handcrafted Nordic style wooden dog and boy sculpture figurine home decor style B03 - Dog and Man (B03)
Nordic style handcrafted wooden sculpture of a woman and dog, creative desktop decor - Kneeling Woman and Dog (B04)
+3
Nordic Nordic Minimalist Wooden Dog and Human Interaction Ornaments Beechwood Black Walnut Carved Craft Home Desktop Decor
$4.76
No MOQ
 · 
28 sold recently
Vintage World Famous Painting Resin Refrigerator Magnet 3D Relief Masterpiece Art Fridge Sticker Artistic Home Kitchen Decoration Accessory Gift
Vintage World Famous Painting Resin Refrigerator Magnet 3D Relief Masterpiece Art Fridge Sticker Artistic Home Kitchen Decoration Accessory Gift
like
Find Similar
3D Girl with a Pearl Earring resin fridge magnet with cream embossed relief frame - Frame - Girl with a Pearl Earring
3D resin fridge magnet featuring Vermeer's The Milkmaid in a retro ivory style frame - Frame - The Milkmaid
3D resin fridge magnet featuring Picasso's Le Rêve painting with a vintage cream frame - Frame - The Dream
3D resin fridge magnet featuring a classic oil painting design in vintage rectangle style - Frame - The Blind Girl
+20
Vintage World Famous Painting Resin Refrigerator Magnet 3D Relief Masterpiece Art Fridge Sticker Artistic Home Kitchen Decoration Accessory Gift
-5%
$0.70-0.74
No MOQ
 · 
30 sold recently
Handmade Crystal Ball Ornament Paperweight Ocean Wave Dolphin Heart Bubble Art Glass Desktop Home Office Decor Modern
Handmade Crystal Ball Ornament Paperweight Ocean Wave Dolphin Heart Bubble Art Glass Desktop Home Office Decor Modern
like
Find Similar
Blue and cyan crystal balls with bubbles on a box, ocean wave art glass paperweights - 60mm Ocean Wave Ball - Green Blue
Blue ocean wave crystal ball paperweight with artistic bubbles and clear finish - 80mm Ocean Wave Bubble Ball - Lake Blue
Artistic crystal glass ball paperweight with red spiral pattern and ocean bubble interior - 80mm Ocean Wave Bubble Ball - Orange Red
Artistic crystal glass wave sphere with blue ocean bubbles for desktop home decoration - 80mm Ocean Wave Bubble Ball - Green Blue
+13
Handmade Crystal Ball Ornament Paperweight Ocean Wave Dolphin Heart Bubble Art Glass Desktop Home Office Decor Modern
-5%
$4.54-13.55
Mix MOQ : 2
 · 
150 sold recently
Resin Pineapple Figurine Nordic Modern Decorative Ornament For Living Room Desktop TV Cabinet Luxury Art
Resin Pineapple Figurine Nordic Modern Decorative Ornament For Living Room Desktop TV Cabinet Luxury Art
like
Find Similar
Golden pineapple decor ornament small size height 14cm width 6cm for home decoration - Small / Gold
Nordic black and gold pineapple figurine home decor sculpture small size 14cm - Small / Black
Modern white and gold pineapple ornament small size 14cm for home table decor - Small / White
Nordic luxury golden resin pineapple ornament home decor medium size 18cm height - Medium / Gold
+5
Resin Pineapple Figurine Nordic Modern Decorative Ornament For Living Room Desktop TV Cabinet Luxury Art
$2.02-3.89
Mix MOQ : 2
 · 
26 views
Miniature Fruit Pie Tart Resin Wood Tray Alloy Spoon Dollhouse Accessories DIY Decorative Ornament
Miniature Fruit Pie Tart Resin Wood Tray Alloy Spoon Dollhouse Accessories DIY Decorative Ornament
like
Find Similar
Macro detail of dollhouse fruit pie with mango and apple on a tiny wooden tray - Orange Apple Pie
Miniature Fruit Pie Tart Resin Wood Tray Alloy Spoon Dollhouse Accessories DIY Decorative Ornament
-5%
$2.05
No MOQ
 · 
31 views
Free Shipping
Miniature Upright Piano Model Dollhouse Furniture With Stool And Music Sheet Plastic Music Instrument Decor For Doll House
Miniature Upright Piano Model Dollhouse Furniture With Stool And Music Sheet Plastic Music Instrument Decor For Doll House
like
Find Similar
Miniature black dollhouse piano with a dark red seat cushion on a simple background - Black
Miniature white upright dollhouse piano with matching stool and sheet music on white background - White
Miniature Upright Piano Model Dollhouse Furniture With Stool And Music Sheet Plastic Music Instrument Decor For Doll House
$1.84
No MOQ
 · 
352 sold recently
Vintage Brass Cobra Snake Figurine Realistic Animal Statue Coiled Snake Desk Decoration Miniature Sculpture Antique Style
Vintage Brass Cobra Snake Figurine Realistic Animal Statue Coiled Snake Desk Decoration Miniature Sculpture Antique Style
like
Find Similar
Detailed view of the intricate scale textures on a vintage brass cobra snake figurine - Cobra Bronze
Macro shot of a coiled vintage brass cobra figurine with detailed snake scale textures - Coiled Snake
Detailed macro view of the intricate lifelike scales on the brass cobra figurine - Swimming Snake
Macro shot of vintage brass snake figurine showing detailed scale texture and S-shaped body - S-shaped Snake (Red Antique)
+7
Vintage Brass Cobra Snake Figurine Realistic Animal Statue Coiled Snake Desk Decoration Miniature Sculpture Antique Style
$0.29-1.44
No MOQ
 · 
12 sold recently
Natural Murex Shell Chicoreus Palmarosae Decorative Conch Sea Shell For Fish Tank Landscaping Home Ornament Craft Specimen
Natural Murex Shell Chicoreus Palmarosae Decorative Conch Sea Shell For Fish Tank Landscaping Home Ornament Craft Specimen
like
Find Similar
8 options
Natural Murex Shell Chicoreus Palmarosae Decorative Conch Sea Shell For Fish Tank Landscaping Home Ornament Craft Specimen
$0.29-12.97
Mix MOQ : 3
 · 
207 sold recently
Top 3% Best Sellers
in Home Decor
Miniature Retro Resin Ornaments Vintage Piano Camera Typewriter Radio Gramophone Desktop Home Decor Photography Props
Miniature Retro Resin Ornaments Vintage Piano Camera Typewriter Radio Gramophone Desktop Home Decor Photography Props
like
Find Similar
Miniature vintage typewriter resin ornament in black finish for desk decoration - Typewriter
Miniature vintage black resin piano statue with golden relief details for home decor - Vintage Piano
Miniature vintage black rotary telephone resin ornament with detailed dimensions - Telephone
Miniature vintage resin phonograph ornament in dark brown with gold accents 6cm tall - Record Player
+2
Miniature Retro Resin Ornaments Vintage Piano Camera Typewriter Radio Gramophone Desktop Home Decor Photography Props
-4%
$0.96-1.07
No MOQ
 · 
37 views
Cartoon Unicorn Moon Resin Night Light Dreamy Starry Sky Ornament For Bedroom Desktop Decoration Girl Heart Student Gift
Cartoon Unicorn Moon Resin Night Light Dreamy Starry Sky Ornament For Bedroom Desktop Decoration Girl Heart Student Gift
like
Find Similar
Cute cartoon moon-shaped night light with purple rabbit mascot on a wooden desk - Pet Moon Style / Pink
Adorable moon shaped night light with cartoon duck figure for bedside desk decor - Pet Moon Style / Purple
Glowing moon-shaped night light with panda figure on cloud base - Pet Moon Style / Green
Cartoon moon night light with cloud base and green character sitting on a wooden desk - Pet Moon Style / Blue
Cartoon Unicorn Moon Resin Night Light Dreamy Starry Sky Ornament For Bedroom Desktop Decoration Girl Heart Student Gift
$4.16
Mix MOQ : 2
Nordic Luxury Ceramic Flower Pot With Golden Bird Iron Stand Marble Pattern Desktop Decorative Vase Succulent Planter Ornaments
Nordic Luxury Ceramic Flower Pot With Golden Bird Iron Stand Marble Pattern Desktop Decorative Vase Succulent Planter Ornaments
like
Find Similar
Nordic ceramic marble pot with gold metal stand and bird ornament, 19.5cm height - Small / Bird Stand + Blue Marble Ceramic / Blue Marble
Golden birdcage decorative stand with dark green ceramic pot, height 19.5cm - Small / Bird Stand + Teal Ceramic / Teal
Nordic gold birdcage plant holder with green marble ceramic pot and bird ornament - Small / Bird Stand + Green Marble Ceramic / Green Marble
Nordic ceramic marble flower pot with gold iron bird stand and 19.5cm height dimension - M / Bird Stand + Green Marble Ceramic / Green Marble
+3
Nordic Luxury Ceramic Flower Pot With Golden Bird Iron Stand Marble Pattern Desktop Decorative Vase Succulent Planter Ornaments
$3.29-3.60
Mix MOQ : 2
 · 
42 views
American Cottage Resin Incense Burner Hand Painted Fairytale House Backflow Incense Holder For Home Office Decor Gift
American Cottage Resin Incense Burner Hand Painted Fairytale House Backflow Incense Holder For Home Office Decor Gift
like
Find Similar
Handcrafted resin forest cabin incense burner with green roof and apple motif on a gold base - Forest Cabin / Multicolor
American Cottage Resin Incense Burner Hand Painted Fairytale House Backflow Incense Holder For Home Office Decor Gift
$8.07
Mix MOQ : 2
Resin Angel Girl Figurine With Wings Cartoon Fairy Desktop Ornament For Bedroom Home Decor Heart Base Nordic Style Gift
Resin Angel Girl Figurine With Wings Cartoon Fairy Desktop Ornament For Bedroom Home Decor Heart Base Nordic Style Gift
like
Find Similar
Cute angel girl figurine ornament with heart base for bedroom desktop decoration - Closed Eyes Rest Head Style (Style A)
Cute angel girl resin figurine with rabbit ears and wings on purple heart base - Pink Rabbit Ears Style (Style B)
Cute resin girl figurine with blue pigtails, cat ears and bat wings in blue-grey dress - Blue Hair Cat Ears Style (Style C)
Cute green girl figurine with wings and elf ears for tabletop room decoration - Double Bun Elf Style (Style D)
Resin Angel Girl Figurine With Wings Cartoon Fairy Desktop Ornament For Bedroom Home Decor Heart Base Nordic Style Gift
$3.54
No MOQ
Miniature Pig Figurine Brass Alloy Vintage Distressed Animal Statue Zodiac Lucky Charm Home Office Desk Decor
Miniature Pig Figurine Brass Alloy Vintage Distressed Animal Statue Zodiac Lucky Charm Home Office Desk Decor
like
Find Similar
Miniature vintage brass pig figurine for desk decoration or keychain, size 2.1x3.1cm - Boar
Miniature vintage copper pig figurine with detailed texture for desk decor and keychains - Sow
Macro shot of retro brass pig figurine showing vintage metal texture and details - Piglet
Detailed macro view of vintage brass zodiac pig figurine with brushed metal texture - Pig Incense Holder
+1
Miniature Pig Figurine Brass Alloy Vintage Distressed Animal Statue Zodiac Lucky Charm Home Office Desk Decor
$0.37-0.66
No MOQ
 · 
10 sold recently
Cute Praying Girl Figurine With Rabbit Ears Resin Cartoon Desktop Ornament For Home Decor Cake Topper Gift For Kids
Cute Praying Girl Figurine With Rabbit Ears Resin Cartoon Desktop Ornament For Home Decor Cake Topper Gift For Kids
like
Find Similar
Cute bunny girl cake topper with light blue dress and rabbit ears for birthday decor - Blue Rabbit Girl (1095-3B)
Cute Praying Girl Figurine With Rabbit Ears Resin Cartoon Desktop Ornament For Home Decor Cake Topper Gift For Kids
$2.19
No MOQ
Easter Plush Bunny Rabbit Desktop Ornament With Natural Wood Base Cute Animal Figurine For Holiday Home Tabletop Decoration
Easter Plush Bunny Rabbit Desktop Ornament With Natural Wood Base Cute Animal Figurine For Holiday Home Tabletop Decoration
like
Find Similar
6 options
Easter Plush Bunny Rabbit Desktop Ornament With Natural Wood Base Cute Animal Figurine For Holiday Home Tabletop Decoration
$2.74-3.69
Mix MOQ : 2
Miniature Plates Tiny Trays Resin Bow Accessories DIY Dollhouse Food Play Phone Case Decoration Cute Colorful
Miniature Plates Tiny Trays Resin Bow Accessories DIY Dollhouse Food Play Phone Case Decoration Cute Colorful
like
Find Similar
Mini resin dollhouse square plates with 3D bow decoration in assorted pastel colors - Square Pink Plate
Mini resin food tray set with yellow toast, pink bows, orange pizza and kitten shovel - Square Yellow Plate
Mini blue square resin plates with yellow bows and a tiny silver spatula toy accessory - Square Blue Plate
Miniature dollhouse set featuring purple gift bags, a pizza slice, and a metal fork - Square Purple Plate
+10
Miniature Plates Tiny Trays Resin Bow Accessories DIY Dollhouse Food Play Phone Case Decoration Cute Colorful
$0.06
No MOQ
 · 
40 sold recently
Mini Artificial Flower Vase Glass Bottle Car Dashboard Ornament Interior Decoration Aesthetic Fresh Style Decor
Mini Artificial Flower Vase Glass Bottle Car Dashboard Ornament Interior Decoration Aesthetic Fresh Style Decor
like
Find Similar
Pink faux flower bouquet in clear glass bottle car ornament on dashboard - Pink Flower
Car dashboard ornament featuring a glass vase with pink and white flowers - Pink Flower
Car dashboard mini glass vase with white artificial flowers and Good Luck label - White Small Flower
Car dashboard decoration with light blue artificial flowers in a clear glass bottle - Light Blue Jasmine
+32
Mini Artificial Flower Vase Glass Bottle Car Dashboard Ornament Interior Decoration Aesthetic Fresh Style Decor
$0.72
No MOQ
 · 
49 sold recently
Anatomical Heart Shaped Vase Resin Desktop Sculpture Flower Pot Halloween Home Decor Modern Art Style Ornament
Anatomical Heart Shaped Vase Resin Desktop Sculpture Flower Pot Halloween Home Decor Modern Art Style Ornament
like
Find Similar
Artistic black heart ceramic vase with detailed weight and dimension size annotations - Black
White heart-shaped resin vase with product packaging dimensions and weight specifications - White
Anatomical Heart Shaped Vase Resin Desktop Sculpture Flower Pot Halloween Home Decor Modern Art Style Ornament
-5%
$4.93
No MOQ
 · 
22 sold recently
Nordic Handcrafted Painted Wooden Fishing Cat Ornaments Set Decorative Cat Figurine Couple For Home Office Desk Decoration
Nordic Handcrafted Painted Wooden Fishing Cat Ornaments Set Decorative Cat Figurine Couple For Home Office Desk Decoration
like
Find Similar
Handcrafted painted wooden couple cat fishing figurines in a red koi boat decoration - Painted Fishing Cat Ornament Set (C32-9157)
Nordic Handcrafted Painted Wooden Fishing Cat Ornaments Set Decorative Cat Figurine Couple For Home Office Desk Decoration
$4.54
Mix MOQ : 2
Nordic Minimalist Resin Reindeer Ornaments Geometric Origami Style Desktop Cabinet Decorative Standing And Sitting Statues
Nordic Minimalist Resin Reindeer Ornaments Geometric Origami Style Desktop Cabinet Decorative Standing And Sitting Statues
like
Find Similar
Modern black and gold geometric resin reindeer statues in sitting and standing poses - Standing + Sitting / 2-Piece Set / Black
Modern geometric deer figurines in silver and gold, resin art for home decor - Standing + Sitting / 2-Piece Set / Silver
Modern white and gold geometric deer figurines set for nordic home decor displays - Standing + Sitting / 2-Piece Set / White
Modern Nordic resin deer figurine set in matte gold finish for home decor accents - Standing + Sitting / 2-Piece Set / Gold
Nordic Minimalist Resin Reindeer Ornaments Geometric Origami Style Desktop Cabinet Decorative Standing And Sitting Statues
$4.61
No MOQ
 · 
27 views
Natural Crystal Gravel Resin Castle Ornament Fairy Tale Figurine With Gold Foil Desktop Home Office Decoration Gift
Natural Crystal Gravel Resin Castle Ornament Fairy Tale Figurine With Gold Foil Desktop Home Office Decoration Gift
like
Find Similar
Pink translucent resin crystal castle ornament with sparkling sequins for desktop decor - Rose Quartz
Blue natural crystal gravel resin fairy castle figurine for home and office desktop decor - Aquamarine
Pink resin fairy castle figurine with natural crystal stone and glitter heart detail - Rose Quartz Variant 2
Black resin crystal castle ornament with gold glitter accents for home and office decor - Obsidian
+12
Natural Crystal Gravel Resin Castle Ornament Fairy Tale Figurine With Gold Foil Desktop Home Office Decoration Gift
$2.54
No MOQ
 · 
65 sold recently
Handmade Crochet Potted Flower Knitted Plant Ornament With Cute Cat Rabbit Base Desktop Decor For Home Office Gift
Handmade Crochet Potted Flower Knitted Plant Ornament With Cute Cat Rabbit Base Desktop Decor For Home Office Gift
like
Find Similar
Handmade crochet Lily of the Valley in a white cat pot with red knitted flowers - Puff Flower Red
Handmade crochet cat flower pot with blue and white flowers for desktop decor - Puff Flower Blue
Handmade crochet flowers in a white cat-shaped knitted pot for cute desk decoration - Puff Flower Yellow
Handmade crochet cat planter with pink knitted flowers and green leaves on wooden desk - Puff Flower Pink
+20
Handmade Crochet Potted Flower Knitted Plant Ornament With Cute Cat Rabbit Base Desktop Decor For Home Office Gift
-6%
$2.25-3.11
No MOQ
Retro Animal Figurines Copper Plated Alloy Lion Leopard Bear Crocodile Miniature Statue Vintage Desktop Ornament Decor
Retro Animal Figurines Copper Plated Alloy Lion Leopard Bear Crocodile Miniature Statue Vintage Desktop Ornament Decor
like
Find Similar
Detail of a small vintage copper-plated leopard figurine held in hand showing texture - Leopard
Antique bronze bear statue on natural stone base with realistic casting textures - Bear
Vintage copper lion miniature figurine with roaring pose on natural stone base - Lion
Retro Animal Figurines Copper Plated Alloy Lion Leopard Bear Crocodile Miniature Statue Vintage Desktop Ornament Decor
$1.90-2.65
No MOQ
Simulation Chocolate Miniature Food Resin Cabochons Flatback DIY Phone Case Headwear Earring Craft Decor Heart Cat Shapes
Simulation Chocolate Miniature Food Resin Cabochons Flatback DIY Phone Case Headwear Earring Craft Decor Heart Cat Shapes
like
Find Similar
Mini brown square resin chocolate charm for DIY crafts and phone cases, size 15x6mm - Hazelnut Chocolate / Small (6x15mm)
Miniature chocolate resin cookie accessory 15mm for DIY crafts and phone case decor - Solid Color Small Square / Small (3x15mm)
Detailed view of resin chocolate charm with diagonal stripes, sized 8x10x24mm - Long Bar Chocolate / Small (8x10x24mm)
Miniature 15x13mm cashew chocolate resin charm for DIY phone cases and jewelry craft - Small Cashew Chocolate - Light Coffee / Small (15x13x20mm)
+26
Simulation Chocolate Miniature Food Resin Cabochons Flatback DIY Phone Case Headwear Earring Craft Decor Heart Cat Shapes
$0.04-0.08
Mix MOQ : 5
 · 
164 sold recently
Lucky Cat Figurine Resin Cherry Blossom Maneki Neko Cute Cartoon Desk Decor Phone Holder Stand Bobbing Head Ornament
Lucky Cat Figurine Resin Cherry Blossom Maneki Neko Cute Cartoon Desk Decor Phone Holder Stand Bobbing Head Ornament
like
Find Similar
White resin lucky cat ornament with pink cherry blossoms and Xile banner - 7002-Cherry Blossom Cat Joy
Miniature white resin lucky cat figurine with pink cherry blossom and golden bell, 5.5cm height - 7003-Cherry Blossom Cat Style A
Cute white cherry blossom lucky cat figurine ornament and resin phone stand - 7004-Cherry Blossom Cat Style B
White resin lucky cat figurine with pink cherry blossoms and gold bell phone holder - 7005-Cherry Blossom Cat Style C
+2
Lucky Cat Figurine Resin Cherry Blossom Maneki Neko Cute Cartoon Desk Decor Phone Holder Stand Bobbing Head Ornament
-4%
$1.37-2.93
Mix MOQ : 2
 · 
10 sold recently
Astronaut Spaceman Figurine Resin Desktop Ornament Model Home Office Decor Gift Set Birthday Valentine's Day Present
Astronaut Spaceman Figurine Resin Desktop Ornament Model Home Office Decor Gift Set Birthday Valentine's Day Present
like
Find Similar
White astronaut figurine sitting on a crescent moon base with a holographic visor mask - Gradient Moon
Astronaut figurine sitting on a white crescent moon with golden helmet accents - Gold Moon
Astronaut sitting on a golden moon figurine with a silver visor for desktop decor - Silver Moon
Astronaut figurine sitting on a white crescent moon for desktop home decoration - Starry Moon
+41
Astronaut Spaceman Figurine Resin Desktop Ornament Model Home Office Decor Gift Set Birthday Valentine's Day Present
$1.12-9.22
Mix MOQ : 2
 · 
36 views
Cute Duck Figurine Resin Desktop Decoration Cartoon Animal Statue For Office Desk Car Interior Stress Relief Home Ornament
Cute Duck Figurine Resin Desktop Decoration Cartoon Animal Statue For Office Desk Car Interior Stress Relief Home Ornament
like
Find Similar
Cute cartoon duck figurine with 'Stay Slim' text and yellow flower collar on a desk - Model A Slimming Duck (Yellow Sunflower Neck)
Cute lying white duck desk ornament with purple flower pattern and smiling face - Model B Happy Duck (Purple Flower Back)
Cute white duck desk ornament in lying pose with pink flower and Jia You text - Model C Fighting Duck (Pink Flower Headpiece)
Cute white prone duck figurine with flower hat and lucky text for desktop decor - Model D Get Rich Duck (Orange Flower Headpiece)
Cute Duck Figurine Resin Desktop Decoration Cartoon Animal Statue For Office Desk Car Interior Stress Relief Home Ornament
$2.22
No MOQ
Resin Unicorn Princess Girl Riding Figurine Holding Star For Desktop Decor Cake Topper Car Interior Dreamy Cute Gift
Resin Unicorn Princess Girl Riding Figurine Holding Star For Desktop Decor Cake Topper Car Interior Dreamy Cute Gift
like
Find Similar
Charming unicorn girl resin figurine with mint dress and gold star for cake or car decor - Blue Unicorn Princess
Resin Unicorn Princess Girl Riding Figurine Holding Star For Desktop Decor Cake Topper Car Interior Dreamy Cute Gift
$1.79
No MOQ
Handmade Crochet Potted Plant With Cute Cat Rabbit Flower Pot Artificial Flowers For Home Office Desk Decor Gift
Handmade Crochet Potted Plant With Cute Cat Rabbit Flower Pot Artificial Flowers For Home Office Desk Decor Gift
like
Find Similar
Handmade crochet Lily of the Valley in a white cat pot with red knitted flowers - Red Puff Flower
Handmade crochet cat flower pot with blue and white flowers for desktop decor - Blue Puff Flower
Handmade crochet flowers in a white cat-shaped knitted pot for cute desk decoration - Yellow Puff Flower
Handmade crochet cat planter with pink knitted flowers and green leaves on wooden desk - Pink Puff Flower
+20
Handmade Crochet Potted Plant With Cute Cat Rabbit Flower Pot Artificial Flowers For Home Office Desk Decor Gift
$2.25-3.03
No MOQ
Free Shipping
French Bulldog Figurine K9 Crystal Dog Statue Aura Rainbow Gradient Desk Decor Home Ornament Modern Minimalist Collectible
French Bulldog Figurine K9 Crystal Dog Statue Aura Rainbow Gradient Desk Decor Home Ornament Modern Minimalist Collectible
like
Find Similar
2-inch K9 crystal French Bulldog figurine with vibrant rainbow gradient finish - Rainbow Ombre
Creative 2-inch yellow and red K9 crystal French bulldog figurine home decor - Red Yellow Gradient
Red and blue gradient K9 crystal French Bulldog figurine sitting in a sleek pose - Red Blue Gradient
2-inch K9 crystal French bulldog figurine in yellow-green gradient glass finish - Yellow Green Gradient
+5
French Bulldog Figurine K9 Crystal Dog Statue Aura Rainbow Gradient Desk Decor Home Ornament Modern Minimalist Collectible
$2.56
No MOQ
 · 
1 reviews
Mini Artificial Fruit Vegetable Models Simulation Foam Miniature For Photography Props Kitchen Table Decor
Mini Artificial Fruit Vegetable Models Simulation Foam Miniature For Photography Props Kitchen Table Decor
like
Find Similar
Artificial red mini apples with glossy finish arranged on a black checkered paper plate - Mini Red Yellow Apple
Miniature artificial red apples with high gloss finish on a gold-edged plate - Mini Red Apple
Miniature green artificial apples set on a grid plate for photography props - Mini Green Apple
Realistic mini dark red artificial fruit prop with glossy finish for photography - Mini Dark Red Apple
+38
Mini Artificial Fruit Vegetable Models Simulation Foam Miniature For Photography Props Kitchen Table Decor
$0.07
Mix MOQ : 5
 · 
566 sold recently
Car Air Vent Freshener Clip Cute Cartoon Animal Astronaut Resin Ornament Rotating Windmill Propeller Interior Decor
Car Air Vent Freshener Clip Cute Cartoon Animal Astronaut Resin Ornament Rotating Windmill Propeller Interior Decor
like
Find Similar
Close-up of cute yellow duck air vent clip with blue propeller on car dashboard - Yellow Duck
Close-up of cute blue penguin car air vent clip with pink bow and clover ornament - Blue Penguin
Detail view of a cute little lion vent clip on a black car air conditioner outlet - Orange Lion
Detail of Teddy Bear car air vent clip with blue bow and four-leaf clover fan decoration - Brown Bear
+16
Car Air Vent Freshener Clip Cute Cartoon Animal Astronaut Resin Ornament Rotating Windmill Propeller Interior Decor
$2.51-3.11
No MOQ
 · 
10 sold recently
Vintage Solid Brass Crocodile Statue Miniature Figurine Desk Ornament Tea Pet Realistic Animal Incense Holder Decor
Vintage Solid Brass Crocodile Statue Miniature Figurine Desk Ornament Tea Pet Realistic Animal Incense Holder Decor
like
Find Similar
Antique brass crocodile figurine incense holder for tea pets and desk decoration - Small Crawling Crocodile
Miniature vintage copper crocodile figurine in an antique brass finish held by hand - Crocodile
Vintage bronze crocodile miniature figurine with detailed texture for desk decor - Mini Crocodile
Vintage bronze crocodile figurine with detailed scale texture for tea table decor - Baby Crocodile
+2
Vintage Solid Brass Crocodile Statue Miniature Figurine Desk Ornament Tea Pet Realistic Animal Incense Holder Decor
$0.43-4.61
No MOQ
 · 
20 views
Vintage Solid Brass Sparrow Figurine Miniature Bird Ornament Realistic Metal Desktop Decoration Tea Pet Home Office
Vintage Solid Brass Sparrow Figurine Miniature Bird Ornament Realistic Metal Desktop Decoration Tea Pet Home Office
like
Find Similar
Miniature solid brass sparrow figurine with vintage finish and detailed feather texture - Small Sparrow
Vintage brass sparrow figurine decorative desktop ornament with detailed feather textures - Sparrow C
Vintage Solid Brass Sparrow Figurine Miniature Bird Ornament Realistic Metal Desktop Decoration Tea Pet Home Office
$0.45-0.56
No MOQ
 · 
26 sold recently
Artificial Succulent Plants In Cement Texture Resin Pots With Hanging Legs Cartoon Face Faux Greenery Desktop Decor
Artificial Succulent Plants In Cement Texture Resin Pots With Hanging Legs Cartoon Face Faux Greenery Desktop Decor
like
Find Similar
Creative hanging leg artificial succulent in a grey cylindrical cement pot with a cute face - Shy Face Style
Detail of creative succulent cement pot featuring human-like face and rope hanging legs - Mustache Style
Detailed view of artificial succulent in a cement pot with smiling face and hanging legs - Smile Face Style
Detail of creative gray cement bear succulent planter with white rope dangling feet decoration - Bear Style
+1
Artificial Succulent Plants In Cement Texture Resin Pots With Hanging Legs Cartoon Face Faux Greenery Desktop Decor
$4.90
No MOQ
 · 
60 views
Angel Figurine Resin Statue European Retro Praying Kneeling Cherub Sculpture Desktop Ornament Home Decoration Gift
Angel Figurine Resin Statue European Retro Praying Kneeling Cherub Sculpture Desktop Ornament Home Decoration Gift
like
Find Similar
Abstract white resin praying angel sculpture decor for home, height 21cm weight 550g - Praying Angel Holding Hands (White)
Antique white praying angel statue sculpture 21cm height classic architectural decor - Praying Angel Holding Hands (Antique)
White resin praying boy angel figurine, minimalist decor piece, 11cm height variant - Little Praying Angel (Boy)
White resin angel figurine sitting and holding face decoration, height 8cm, weight 140g - Face Cupped Angel (White)
+34
Angel Figurine Resin Statue European Retro Praying Kneeling Cherub Sculpture Desktop Ornament Home Decoration Gift
$1.59-10.37
Mix MOQ : 2
 · 
28 views
Glass Bud Vases Transparent Embossed Relief Textured Flower Bottles For Wedding Centerpiece Home Dining Table Decor Vintage
Glass Bud Vases Transparent Embossed Relief Textured Flower Bottles For Wedding Centerpiece Home Dining Table Decor Vintage
like
Find Similar
Set of transparent embossed glass vases with various vintage patterns for home decor - Clear (10 Pieces Set)
Size chart for 10-piece set of green vintage glass vases with embossed patterns - Green (10 Pieces Set)
Set of 10 amber transparent glass vases with vintage embossed patterns in a gift box - Amber (10 Pieces Set)
Set of 12 assorted transparent glass bud vases with detailed dimensions and sturdy packaging - Clear (12 Pieces Set)
+35
Glass Bud Vases Transparent Embossed Relief Textured Flower Bottles For Wedding Centerpiece Home Dining Table Decor Vintage
$0.39-16.43
No MOQ
 · 
882 sold recently
Top 3% Best Sellers
in Home Decor
Resin Girl Figurine Statue Modern Fashion Cartoon Q Version Miniature Desktop Ornament Home Decoration Creative Gift
Resin Girl Figurine Statue Modern Fashion Cartoon Q Version Miniature Desktop Ornament Home Decoration Creative Gift
like
Find Similar
Detailed view of cartoon girl figurine with blue hair and woven texture cardigan - Gray Blue Long Hair Beige Cardigan (Naier Girl C)
Detail of cartoon girl resin figurine in yellow suit holding a briefcase for home decor - Brown Long Hair Yellow Elegant Suit (Naier Girl D)
Resin Girl Figurine Statue Modern Fashion Cartoon Q Version Miniature Desktop Ornament Home Decoration Creative Gift
$2.13
No MOQ
Cute Panda Resin Storage Tray Ornament Key Holder Entryway Home Decor Creative Sculpture Figurine Organizer
Cute Panda Resin Storage Tray Ornament Key Holder Entryway Home Decor Creative Sculpture Figurine Organizer
like
Find Similar
Panda figurine with gold tray and wooden key rack for home entry storage and decor - Panda Yuanbao Storage Combo Desktop Ornament
Cute panda desktop organizer set with golden tray and wooden key rack for home decor - Panda Yuanbao Storage Combo Set A
Panda tray organizer with Pingan Xile art set for entryway and key storage - Panda Yuanbao Storage Combo Set B
Panda bamboo style tissue box figurine home decor, size 14.4x10.1x22cm resin statue - Panda Bamboo Tissue Box Ornament
+29
Cute Panda Resin Storage Tray Ornament Key Holder Entryway Home Decor Creative Sculpture Figurine Organizer
$1.64-32.25
No MOQ
 · 
124 views
Handmade Crochet Flower Potted Plant Heart Rose Sunflower Bunny Pot Base Knitted Art Home Office Desktop Decor Gift
Handmade Crochet Flower Potted Plant Heart Rose Sunflower Bunny Pot Base Knitted Art Home Office Desktop Decor Gift
like
Find Similar
Handmade crochet Lily of the Valley in a white cat pot with red knitted flowers - Puff Flower Red
Handmade crochet cat flower pot with blue and white flowers for desktop decor - Puff Flower Blue
Handmade crochet flowers in a white cat-shaped knitted pot for cute desk decoration - Puff Flower Yellow
Handmade crochet cat planter with pink knitted flowers and green leaves on wooden desk - Puff Flower Pink
+20
Handmade Crochet Flower Potted Plant Heart Rose Sunflower Bunny Pot Base Knitted Art Home Office Desktop Decor Gift
$2.25-3.03
No MOQ
Easter Bunny Eggshell Figurines Resin White Gold Rabbit Statues Festive Home Ornaments Tabletop Decoration Gifts
Easter Bunny Eggshell Figurines Resin White Gold Rabbit Statues Festive Home Ornaments Tabletop Decoration Gifts
like
Find Similar
Easter resin rabbit figurines in eggshell with product size and packaging details - Rabbit Eggshell Style / One Pair
Easter Bunny Eggshell Figurines Resin White Gold Rabbit Statues Festive Home Ornaments Tabletop Decoration Gifts
-4%
$3.29
No MOQ
Modern Abstract Couple Kiss Figurine Resin Romantic Human Sculpture Home Office Desktop Decor Heart Gesture Art Ornament
Modern Abstract Couple Kiss Figurine Resin Romantic Human Sculpture Home Office Desktop Decor Heart Gesture Art Ornament
like
Find Similar
Nordic resin sculpture Kissing Lovers in champagne and silver finish for home decor - A Deep Kiss - Large / Champagne
Modern gold resin couple kissing statue home decor piece with dimensions shown - A Deep Kiss - Large / Gold
Abstract champagne gold kissing sculpture resin ornament for home decor, height 13cm - A Deep Kiss - Mini Style / Champagne
Abstract lovers sculpture in sandstone finish, minimalist home decor accessory in small size - A Deep Kiss - Mini Style / Sandstone Color
+2
Modern Abstract Couple Kiss Figurine Resin Romantic Human Sculpture Home Office Desktop Decor Heart Gesture Art Ornament
-5%
$1.59-4.24
No MOQ
 · 
51 views
Fairy Couple Hanging Ornament Resin Leaf Swing Miniature Figurine Garden Decor Pastoral Style Home Decoration
Fairy Couple Hanging Ornament Resin Leaf Swing Miniature Figurine Garden Decor Pastoral Style Home Decoration
like
Find Similar
Miniature fairy couple on swing resin ornament for garden micro landscape decor - Flower Fairy on Swing
Fairy Couple Hanging Ornament Resin Leaf Swing Miniature Figurine Garden Decor Pastoral Style Home Decoration
$2.85
No MOQ
 · 
11 views
Nordic Wooden Elephant Horse Figurines Handcrafted Home Decor Ornaments Morandi Minimalist Desktop Statues Art
Nordic Wooden Elephant Horse Figurines Handcrafted Home Decor Ornaments Morandi Minimalist Desktop Statues Art
like
Find Similar
Small beige Dala elephant wood carving statue, 15cm length, 230g home decor piece - Small / Beige
Large cream Dala Elephant wooden ornament with detailed product dimensions and size specs - Large / Beige
Nordic style beige wooden elephant sculptures set in two sizes for home decoration - Pair (Large + Small) / Beige
Pink wooden Dala elephant statue, Nordic style small home decor ornament, small size - Small / Pink
+26
Nordic Wooden Elephant Horse Figurines Handcrafted Home Decor Ornaments Morandi Minimalist Desktop Statues Art
-5%
$2.46-5.61
No MOQ
 · 
18 views
3D Resin Fridge Magnet World Travel Souvenir City Landmarks Refrigerator Magnetic Sticker Home Kitchen Decor
3D Resin Fridge Magnet World Travel Souvenir City Landmarks Refrigerator Magnetic Sticker Home Kitchen Decor
like
Find Similar
3D Dubai city travel souvenir fridge magnet with landmarks and camel design - (1) Dubai - Wood
3D resin fridge magnet featuring Pattaya Thailand beach and parasailing scenery - (5) Pattaya Thailand
3D Koh Samui Thailand beach scenery fridge magnet with palm trees and boat details - (7) Koh Samui Thailand
3D resin Thailand Chiang Mai souvenir magnet featuring Wat Phra That Doi Suthep temple - (8) Chiang Mai Thailand
+92
3D Resin Fridge Magnet World Travel Souvenir City Landmarks Refrigerator Magnetic Sticker Home Kitchen Decor
$1.70-3.14
No MOQ
 · 
192 sold recently
Mini Buddha Statue Natural Crystal Carved Gemstone Figurine Desktop Zen Ornament Home Office Decoration Meditation Gift
Mini Buddha Statue Natural Crystal Carved Gemstone Figurine Desktop Zen Ornament Home Office Decoration Meditation Gift
like
Find Similar
Natural pink crystal baby Buddha statue sculpture carving with smooth polished finish - Rose Quartz
Miniature green crystal Buddha statue with polished finish and detailed carving - Green Aventurine
Natural amethyst Shakyamuni Buddha sculpture with polished crystal texture on white background - Purple Crystal
Spotted grey stone Buddha figurine in a seated meditation pose for home decor - Larvikite
+15
Mini Buddha Statue Natural Crystal Carved Gemstone Figurine Desktop Zen Ornament Home Office Decoration Meditation Gift
$6.34-6.92
Mix MOQ : 3
 · 
39 sold recently
Free Shipping
Stained Glass Style Acrylic Bird Desktop Ornaments 7 Birds Sitting On Branch Modern Art Sculpture Home Office Decoration
Stained Glass Style Acrylic Bird Desktop Ornaments 7 Birds Sitting On Branch Modern Art Sculpture Home Office Decoration
like
Find Similar
Colorful stained glass style acrylic seven birds on a branch decor with black base - 7 Birds (With Base)
Stained Glass Style Acrylic Bird Desktop Ornaments 7 Birds Sitting On Branch Modern Art Sculpture Home Office Decoration
$3.60
Mix MOQ : 2
Go to

More in home & kitchen

Explore more in mini resin animals

resinphonebag pendantgirlshangingshapecakeholdertableholiday
diydesktop ornamentstylediy accessoriesresin keychainmetalclawstrapheadwhite

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access