Everful

Wholesale mini resin animals

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Mini Resin Animals

Find the perfect pieces: figurine & miniature collectibles, decorative crafts, decorative collectibles and more

All products in mini resin animals

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Silicone Flower Molds Rose Daisy Shape Multi Cavity Fondant Chocolate Soap Resin Clay DIY Baking Decorating Tools
Silicone Flower Molds Rose Daisy Shape Multi Cavity Fondant Chocolate Soap Resin Clay DIY Baking Decorating Tools
like
Find Similar
Detail of 7-cavity white silicone rose petal fondant mold on a rippled display stand - 7 Holes Floral Style (7.5cm/44g)
White silicone mold for fondant roses and daisies on a light blue decorative background - 9 Holes Floral Style (8.7cm/57g)
Silicone Flower Molds Rose Daisy Shape Multi Cavity Fondant Chocolate Soap Resin Clay DIY Baking Decorating Tools
$0.63-0.86
Mix MOQ : 2
3D Woven Rabbit Silicone Mold Easter Bunny Candle Making Soap DIY Plaster Resin Aroma Sculpture Dessert Baking Tool
3D Woven Rabbit Silicone Mold Easter Bunny Candle Making Soap DIY Plaster Resin Aroma Sculpture Dessert Baking Tool
like
Find Similar
Knitted rabbit silicone mold for Easter candles and aromatherapy plaster crafts - Knitted Rabbit With Carrot
Knitted texture bunny silicone mold for Easter rabbit candles and plaster crafts - Knitted Rabbit With Butterfly
3D Woven Rabbit Silicone Mold Easter Bunny Candle Making Soap DIY Plaster Resin Aroma Sculpture Dessert Baking Tool
$3.60-3.98
Mix MOQ : 5
DIY Beaded Ring Candle Holder Silicone Mold Round Bubble Sphere Plaster Resin Epoxy Crafting Desktop Decor
DIY Beaded Ring Candle Holder Silicone Mold Round Bubble Sphere Plaster Resin Epoxy Crafting Desktop Decor
like
Find Similar
Bubble ring candle holder silicone mold for resin DIY with 17.3cm diameter size detail - Small Beaded Candle Holder / Semi-transparent White
20cm diameter beaded sphere silicone mold for 4-hole resin candle holder DIY craft - Large Beaded Candle Holder / Semi-transparent White
DIY Beaded Ring Candle Holder Silicone Mold Round Bubble Sphere Plaster Resin Epoxy Crafting Desktop Decor
$3.11-4.55
Mix MOQ : 2
Heart Splicing Candle Holder Silicone Mold DIY Resin Casting Plaster Ornament Valentine Day Home Decoration Craft
Heart Splicing Candle Holder Silicone Mold DIY Resin Casting Plaster Ornament Valentine Day Home Decoration Craft
like
Find Similar
DIY heart candle holder resin mold set with cylindrical 12.2cm silicone casting tools - Heart Candle Holder A02 (Height 12.2cm)
Cylindrical heart拼接 candle holder silicone mold for DIY resin and wax crafts - Heart Candle Holder B02 (Height 10.2cm)
Heart Splicing Candle Holder Silicone Mold DIY Resin Casting Plaster Ornament Valentine Day Home Decoration Craft
-5%
$1.37-1.64
Mix MOQ : 5
3D Angel Girl Silicone Mold With Wings And Four Leaf Clover DIY Candle Resin Plaster Baking Tool Handcraft Decor
3D Angel Girl Silicone Mold With Wings And Four Leaf Clover DIY Candle Resin Plaster Baking Tool Handcraft Decor
like
Find Similar
DIY silicone mold for angel girl candle with four-leaf clover and flower wreath - Clover Angel Girl 001
Guardian angel silicone mold with 4-leaf clover design for DIY plaster or candle making - Clover Angel Girl 002
New3D Angel Girl Silicone Mold With Wings And Four Leaf Clover DIY Candle Resin Plaster Baking Tool Handcraft Decor
-5%
$3.23
Mix MOQ : 5
Silicone Soap Mold Square Ring Oval Shapes DIY Handmade Craft Resin Casting Tool For Aromatherapy Wax
Silicone Soap Mold Square Ring Oval Shapes DIY Handmade Craft Resin Casting Tool For Aromatherapy Wax
like
Find Similar
2 options
Silicone Soap Mold Square Ring Oval Shapes DIY Handmade Craft Resin Casting Tool For Aromatherapy Wax
$4.61
Mix MOQ : 2
Angel Mermaid Silicone Mold DIY Resin Mirror Surface Plaster Soap Crafting Tools Flexible Handmade Jewelry Making
Angel Mermaid Silicone Mold DIY Resin Mirror Surface Plaster Soap Crafting Tools Flexible Handmade Jewelry Making
like
Find Similar
Translucent white silicone angel mold with detailed wings for DIY crystal resin crafts - Mirror Angel Mold (228-1)
Translucent white silicone mold with cloud-like wave patterns for DIY resin crafts - Mirror Little Mermaid Mold (228-2)
Angel Mermaid Silicone Mold DIY Resin Mirror Surface Plaster Soap Crafting Tools Flexible Handmade Jewelry Making
$0.95
No MOQ
Ice Cream Popsicle Shape Silicone Mold DIY Resin Crafting Mirror Surface Pendant Jewelry Making Tool Handmade Supplies
Ice Cream Popsicle Shape Silicone Mold DIY Resin Crafting Mirror Surface Pendant Jewelry Making Tool Handmade Supplies
like
Find Similar
Silicone ice cream mold for DIY resin pendants featuring three various shapes - Small Mirror Ice Cream Mold (3-Cavity Round)
4-cavity ice cream silicone mold for resin casting with purple glitter finish - 4-Cavity Mirror Ice Cream Mold (Rectangular)
Ice Cream Popsicle Shape Silicone Mold DIY Resin Crafting Mirror Surface Pendant Jewelry Making Tool Handmade Supplies
$0.81-1.87
Mix MOQ : 2
Silicone Candle Mold 3D Rope Knot Pillar DIY Vertical Ribbed Aromatherapy Plaster Epoxy Resin Craft Home Decor
Silicone Candle Mold 3D Rope Knot Pillar DIY Vertical Ribbed Aromatherapy Plaster Epoxy Resin Craft Home Decor
like
Find Similar
2 options
Silicone Candle Mold 3D Rope Knot Pillar DIY Vertical Ribbed Aromatherapy Plaster Epoxy Resin Craft Home Decor
$3.75-5.48
Mix MOQ : 20
Mini House Silicone Mold Love Heart Shape For DIY Candle Holder Plaster Night Light Handcrafted Home Decor
Mini House Silicone Mold Love Heart Shape For DIY Candle Holder Plaster Night Light Handcrafted Home Decor
like
Find Similar
4-cavity LOVE house silicone mold for DIY resin candles and decorative plaster crafts - 4-Cavity LOVE House / White
White silicone mold for 4 miniature house shapes with precise dimension measurements - 4-Cavity Heart House / White
Mini House Silicone Mold Love Heart Shape For DIY Candle Holder Plaster Night Light Handcrafted Home Decor
-5%
$1.70-1.86
No MOQ
DIY 3D Couple Heart Kiss Love Silicone Candle Mold For Valentine's Day Wedding Cake Decorating Gypsum Soap Resin Craft Making Tool
DIY 3D Couple Heart Kiss Love Silicone Candle Mold For Valentine's Day Wedding Cake Decorating Gypsum Soap Resin Craft Making Tool
like
Find Similar
Silicone mold dimensions and weight detail for couple hugging heart candle craft - Heart Pattern Couple Style (J-0253)
Silicone mold dimensions 10.6x9.9x5.3cm for DIY couple KISS candle crafts and gift - Kiss Pattern Couple Style (J-0254)
Detailed size parameters of silicone candle mold featuring groom and bride on LOVE base - Love Pattern Couple Style (J-0255)
DIY 3D Couple Heart Kiss Love Silicone Candle Mold For Valentine's Day Wedding Cake Decorating Gypsum Soap Resin Craft Making Tool
$5.76
Mix MOQ : 2
3D Cute Rabbit Carrot Silicone Mold For DIY Nail Art Decoration Resin Craft Fondant Chocolate Cake Mold High Transparency
3D Cute Rabbit Carrot Silicone Mold For DIY Nail Art Decoration Resin Craft Fondant Chocolate Cake Mold High Transparency
like
Find Similar
3D cute bunny rabbit silicone nail art mold for DIY cartoon animal nail decorations - Single Rabbit Style (145)
Clear silicone nail art mold featuring 3D rabbit, carrot, and bow tie shapes for DIY - Miniature Accessory Combo (146)
Detail view of heart-shaped silicone mold with rabbit and carrot patterns for nail art - Heart Relief Rabbit Style (147)
3D Cute Rabbit Carrot Silicone Mold For DIY Nail Art Decoration Resin Craft Fondant Chocolate Cake Mold High Transparency
$0.40
Mix MOQ : 2
Free Shipping
Oeteldonk Dutch Carnival Frog Embroidered Patches Cartoon Animal Heart Iron On Patches For Clothing Hat Decoration
Oeteldonk Dutch Carnival Frog Embroidered Patches Cartoon Animal Heart Iron On Patches For Clothing Hat Decoration
like
Find Similar
Detail of embroidered ribbon patch with gold lettering and dimensions of 11.1x3.6cm - 2023 Ribbon Style (PE9437CT)
Detail of embroidered frog patch with crown and beer mug, diameter 8.5cm measurement - Crown Frog Beer Style (PE9440CT)
Cartoon frog embroidery patch with Atje text for Dutch carnival costumes 7.5x8.5cm - Frog with Large Drink Style (PE9441CT)
9.2cm round embroidered patch featuring cartoon frog and bear for carnival costumes - Two-Tone Background Frog Style (PE9442CT)
+6
Oeteldonk Dutch Carnival Frog Embroidered Patches Cartoon Animal Heart Iron On Patches For Clothing Hat Decoration
-5%
$0.37-1.10
No MOQ
Free Shipping
Metal Animal Reflection Time Gem Keychain Bottle Opener Rectangular Zinc Alloy Key Ring For Car Decor Gift For Men Women
Metal Animal Reflection Time Gem Keychain Bottle Opener Rectangular Zinc Alloy Key Ring For Car Decor Gift For Men Women
like
Find Similar
Lion King theme square metal bottle opener keychain with size and weight dimensions - Lion Cub with Lion Reflection (Style 1)
Close-up of metal bottle opener keychain featuring a cat and lion reflection motif - Cat with Lion Reflection (Style 2)
Detailed view of metal lion keychain with bottle opener dimensions 9.1cm x 3.2cm - Lion Silhouette (Style 3)
Detailed view of metal bottle opener keychain with cat and tiger art and size dimensions - Cat with Tiger Reflection (Style 4)
+6
Metal Animal Reflection Time Gem Keychain Bottle Opener Rectangular Zinc Alloy Key Ring For Car Decor Gift For Men Women
-8%
$0.92
Mix MOQ : 2
Creative Animal Art Glass Cabochon Metal Keychain Bottle Opener Vintage Dragonfly Sea Turtle Owl Keyring Pendant Men Women Gifts
Creative Animal Art Glass Cabochon Metal Keychain Bottle Opener Vintage Dragonfly Sea Turtle Owl Keyring Pendant Men Women Gifts
like
Find Similar
Dragonfly bottle opener keychain dimensions 3.3x1.2 inches with colorful glass dome art - Colored Dragonfly (Style 1)
Detail view of dragonfly glass cabochon bottle opener keychain with size and weight specs - Hand-painted Dragonfly (Style 2)
Close-up of silver dragonfly bottle opener keychain showing dimensions 8.3x3cm and weight 24g - Colorful Mushroom (Style 3)
Detail view of turtle pattern glass cabochon on a silver metal bottle opener keychain - Art Sea Turtle (Style 4)
+6
Creative Animal Art Glass Cabochon Metal Keychain Bottle Opener Vintage Dragonfly Sea Turtle Owl Keyring Pendant Men Women Gifts
-8%
$0.79
Mix MOQ : 2
Cartoon Animal Embroidery Patches For Clothing DIY Iron On Cat Dog Whale Fish Embroidered Applique Accessories For Bags Jackets
Cartoon Animal Embroidery Patches For Clothing DIY Iron On Cat Dog Whale Fish Embroidered Applique Accessories For Bags Jackets
like
Find Similar
Cute Shiba Inu dog embroidery patch size 2.6x1.6cm variant A for clothing and bags - Shiba Inu Style (A)
Embroidered black and white cat patch variant C, size 2.7 x 1.4 cm for clothes - Black and White Cat Style (C)
Detailed white whale embroidered patch style D measuring 2.8cm wide for clothes - Whale Style (D)
Dark grey cat embroidery patch for clothes and bags, size 2.8cm x 2.2cm, code B - Gray Cat Style (B)
+6
Cartoon Animal Embroidery Patches For Clothing DIY Iron On Cat Dog Whale Fish Embroidered Applique Accessories For Bags Jackets
$0.16
No MOQ
Mini Champagne Wine Stopper ABS Food Grade Silicone Rotational Vacuum Seal Leakproof Cap Preservation Bar Accessories
Mini Champagne Wine Stopper ABS Food Grade Silicone Rotational Vacuum Seal Leakproof Cap Preservation Bar Accessories
like
Find Similar
Mini black ABS plastic champagne stopper with lock icons and non-slip grooves - ABS / Food-grade Silicone / Champagne Stopper / Rotating Lock / Fits 17.5-18mm Bottle
Miniature black matte ABS wine stopper with lock icons and premium retail packaging - ABS / Food-grade Silicone / Wine Stopper / Rotating Lock / Fits 18-19mm Bottle
Electric salt and pepper grinder set KYMQ-64C with dual mills and charging base - 110ml / Electric Pepper Grinder Set / 2 Pack / With Charging Base
Mini Champagne Wine Stopper ABS Food Grade Silicone Rotational Vacuum Seal Leakproof Cap Preservation Bar Accessories
$0.75-21.33
Mix MOQ : 2
 · 
176 sold recently
Waterproof PET Vintage Floral Animal Stickers For DIY Scrapbooking Journaling Decorative Dark Aesthetic Illustration Decals
Waterproof PET Vintage Floral Animal Stickers For DIY Scrapbooking Journaling Decorative Dark Aesthetic Illustration Decals
like
Find Similar
50 pieces of PET botanical stickers with vintage floral and forest animal designs - Multicolor Black Natural Style
Waterproof PET Vintage Floral Animal Stickers For DIY Scrapbooking Journaling Decorative Dark Aesthetic Illustration Decals
$1.03
No MOQ
Carrot Shape Silicone Mold DIY Baking Cake Fondant Decoration Resin Clay Crafting Tools Flexible Durable
Carrot Shape Silicone Mold DIY Baking Cake Fondant Decoration Resin Clay Crafting Tools Flexible Durable
like
Find Similar
Carrot shaped silicone mold for DIY cake baking and fondant craft with multiple cavities - 3-Cavity Carrot
Carrot shape silicone baking mold for DIY cakes with 4 cavities in translucent white - 4-Cavity Carrot
NewCarrot Shape Silicone Mold DIY Baking Cake Fondant Decoration Resin Clay Crafting Tools Flexible Durable
-4%
$0.22-0.29
Mix MOQ : 2
Daisy Flower Silicone Mold For Aroma Stone Gypsum DIY Epoxy Resin Clay Handmade Soap Cake Decorating Tools Baking Molds
Daisy Flower Silicone Mold For Aroma Stone Gypsum DIY Epoxy Resin Clay Handmade Soap Cake Decorating Tools Baking Molds
like
Find Similar
2 options
Daisy Flower Silicone Mold For Aroma Stone Gypsum DIY Epoxy Resin Clay Handmade Soap Cake Decorating Tools Baking Molds
-4%
$0.69
Mix MOQ : 2
Dad Letter Silicone Mold Pink DIY Resin Keychain Craft Chocolate Fondant Baking Tool Father Day Gift
Dad Letter Silicone Mold Pink DIY Resin Keychain Craft Chocolate Fondant Baking Tool Father Day Gift
like
Find Similar
Father's Day DAD silicone mold with finished brown resin keychain on blue background - DAD Letter Shape (295)
Dad Letter Silicone Mold Pink DIY Resin Keychain Craft Chocolate Fondant Baking Tool Father Day Gift
$0.29
Mix MOQ : 2
Octagonal Tray Silicone Mold Geometric Resin Casting DIY Storage Plate Coaster Home Decor Food Grade
Octagonal Tray Silicone Mold Geometric Resin Casting DIY Storage Plate Coaster Home Decor Food Grade
like
Find Similar
Translucent octagonal silicone mold for DIY resin tray with 10 segmented compartments - Octagonal Tray / Translucent White
Octagonal Tray Silicone Mold Geometric Resin Casting DIY Storage Plate Coaster Home Decor Food Grade
-5%
$3.50
Mix MOQ : 5
Floral Candlestick Silicone Mold Relief Flower Cluster Conical Base DIY Handmade Candle Resin Casting Gypsum Craft Decor
Floral Candlestick Silicone Mold Relief Flower Cluster Conical Base DIY Handmade Candle Resin Casting Gypsum Craft Decor
like
Find Similar
1 option
Floral Candlestick Silicone Mold Relief Flower Cluster Conical Base DIY Handmade Candle Resin Casting Gypsum Craft Decor
$3.46
Mix MOQ : 20
Butterfly Letter Silicone Mold Handmade Fondant Cake Mould Soap Resin Clay Decoration Tool Embrace Your Dreams DIY Craft Baking
Butterfly Letter Silicone Mold Handmade Fondant Cake Mould Soap Resin Clay Decoration Tool Embrace Your Dreams DIY Craft Baking
like
Find Similar
1 option
Butterfly Letter Silicone Mold Handmade Fondant Cake Mould Soap Resin Clay Decoration Tool Embrace Your Dreams DIY Craft Baking
-4%
$0.66
No MOQ
Hummingbird Silicone Mold For Resin Casting Keychain Pendant Making DIY Jewelry Crafts Flexible Pink
Hummingbird Silicone Mold For Resin Casting Keychain Pendant Making DIY Jewelry Crafts Flexible Pink
like
Find Similar
Pink hummingbird silicone resin mold for creative keychain pendants and DIY crafts - Pink
Hummingbird Silicone Mold For Resin Casting Keychain Pendant Making DIY Jewelry Crafts Flexible Pink
$0.32
No MOQ
Silicone Mold Girl Portrait Flower Wreath DIY Succulent Planter Pot Concrete Gypsum Resin Craft Art Candle Cup Making
Silicone Mold Girl Portrait Flower Wreath DIY Succulent Planter Pot Concrete Gypsum Resin Craft Art Candle Cup Making
like
Find Similar
Flower girl resin silicone mold for DIY planters and candles, dimensions 9.6cm by 7.8cm - NO.1 Girl Flower Pot Mold / Translucent White
DIY flower girl resin mold with 3D sleeping girl planter silicone sculpture design - NO.2 Girl Flower Pot Mold / Translucent White
Silicone Mold Girl Portrait Flower Wreath DIY Succulent Planter Pot Concrete Gypsum Resin Craft Art Candle Cup Making
$4.47-4.84
Mix MOQ : 5
Creative Castle House Silicone Mold DIY Fondant Chocolate Cake Decoration Baking Tool Crafting Resin Clay Accessory
Creative Castle House Silicone Mold DIY Fondant Chocolate Cake Decoration Baking Tool Crafting Resin Clay Accessory
like
Find Similar
2 options
Creative Castle House Silicone Mold DIY Fondant Chocolate Cake Decoration Baking Tool Crafting Resin Clay Accessory
$0.40
No MOQ
Cartoon Animal Embroidery Patches Bear Deer Owl Bird Heart Shape Iron On Patches For Clothing Bags DIY Sew Applique
Cartoon Animal Embroidery Patches Bear Deer Owl Bird Heart Shape Iron On Patches For Clothing Bags DIY Sew Applique
like
Find Similar
Adventure animal bear embroidered patch in brown and green finish with size 5x3.5cm - Adventure Bear (1)
Blue heart embroidery patch featuring two pink birds and floral details, size 5.2x4.3cm - Heart Birds (2)
Blue bird and pink flower embroidered patch with green background on variant view - Bird in Flowers (3)
5.0x4.0 CM embroidered owl patch on yellow heart background with blue border - Pink Owl (4)
+5
Cartoon Animal Embroidery Patches Bear Deer Owl Bird Heart Shape Iron On Patches For Clothing Bags DIY Sew Applique
-8%
$0.11
No MOQ
3D Hedgehog Tree Stump Silicone Mold For DIY Resin Epoxy Clay Phone Case Decoration Handmade Craft Baking Cake Mold
3D Hedgehog Tree Stump Silicone Mold For DIY Resin Epoxy Clay Phone Case Decoration Handmade Craft Baking Cake Mold
like
Find Similar
Transparent 3D hedgehog and tree stump silicone resin mold for DIY craft projects - Hedgehog Tree Stump Style (16605)
3D Hedgehog Tree Stump Silicone Mold For DIY Resin Epoxy Clay Phone Case Decoration Handmade Craft Baking Cake Mold
$0.43
No MOQ
Motivational Reward Stickers Round Cartoon Animal Encouragement Labels For Classroom School Teachers Students Adhesive
Motivational Reward Stickers Round Cartoon Animal Encouragement Labels For Classroom School Teachers Students Adhesive
like
Find Similar
Cute cartoon animal dessert reward stickers for kids, 30mm round roll labels for schools - 30x30mm / Cartoon Dessert Style (syf-26)
Cartoon animal reward stickers for children featuring stars and motivational text - 30x30mm / Trophy and Star Style (syf-27)
500pcs gift heart stickers roll for sealing packages, orange and pink 1 inch round labels - 25x25mm / Gift Box Heart Style (syf-38)
+2
Motivational Reward Stickers Round Cartoon Animal Encouragement Labels For Classroom School Teachers Students Adhesive
$0.81-1.10
No MOQ
Quilted Cotton Makeup Bag Zipper Closure Cute Bear Floral Animal Print Thickened Travel Cosmetic Pouch Organizer For Women
Quilted Cotton Makeup Bag Zipper Closure Cute Bear Floral Animal Print Thickened Travel Cosmetic Pouch Organizer For Women
like
Find Similar
Detailed view of quilted cotton makeup bag with cute bear pattern and French fabric label - Striped Bear
Quilted cotton makeup bag with cute bear pattern on a wooden table with soft sunlight - Floral Bear
Handheld quilted cosmetic bag featuring cute cartoon dog patterns and French text - Dog
Detail of yellow quilted cotton makeup bag with bear pattern on a wooden table - Duck
+1
Quilted Cotton Makeup Bag Zipper Closure Cute Bear Floral Animal Print Thickened Travel Cosmetic Pouch Organizer For Women
$4.38
No MOQ
 · 
20 views
Free Shipping
Star Heart Shape Silicone Mold For DIY Baking Fondant Chocolate Resin Craft Textured Pink Flexible Tool
Star Heart Shape Silicone Mold For DIY Baking Fondant Chocolate Resin Craft Textured Pink Flexible Tool
like
Find Similar
Pink star-shaped silicone mold for DIY resin accessories and handmade jewelry crafts - Pentagram
Pink heart and star silicone mold for DIY lollipops and resin crafts with star texture - Heart and Star Shape
Star Heart Shape Silicone Mold For DIY Baking Fondant Chocolate Resin Craft Textured Pink Flexible Tool
-6%
$0.27-0.41
Mix MOQ : 2
Silicone Mold Cartoon Puppy Dog Bear Shape DIY Handmade Candle Soap Resin Chocolate Cake Baking Valentine Day Decor
Silicone Mold Cartoon Puppy Dog Bear Shape DIY Handmade Candle Soap Resin Chocolate Cake Baking Valentine Day Decor
like
Find Similar
Detail view of pink silicone mold with 3D cartoon bear figure and size dimensions - Left Ear - White Bear with Pink Hat
DIY cartoon dog silicone mold for crafts and candles with finished puppy display - Right Ear - Brown Bear with Blue Hat
Silicone Mold Cartoon Puppy Dog Bear Shape DIY Handmade Candle Soap Resin Chocolate Cake Baking Valentine Day Decor
$1.07
No MOQ
Christmas Tree Silicone Mold Star Cone Shape For DIY Aromatherapy Candle Soap Resin Plaster Handcraft Festive Decor
Christmas Tree Silicone Mold Star Cone Shape For DIY Aromatherapy Candle Soap Resin Plaster Handcraft Festive Decor
like
Find Similar
DIY Christmas tree silicone mold and yellow cone candle with red star 13cm height - NO.1 Christmas Cone-Wave Texture / White Semi-Transparent
Christmas star cone candle silicone mold with 13.1cm height for DIY craft projects - NO.2 Christmas Cone-Star Texture / White Semi-Transparent
Christmas Tree Silicone Mold Star Cone Shape For DIY Aromatherapy Candle Soap Resin Plaster Handcraft Festive Decor
-4%
$1.59-1.78
Mix MOQ : 5
Christmas Relief Santa Claus Knitted Texture Flower Pot Silicone Mold DIY Candle Holder Plaster Resin Craft Making
Christmas Relief Santa Claus Knitted Texture Flower Pot Silicone Mold DIY Candle Holder Plaster Resin Craft Making
like
Find Similar
Knitted sweater pattern silicone candle mold for DIY plaster pots and 3D resin art crafts - Knitted Sweater Style
Christmas Santa relief silicone mold for DIY planters and candle cups with 8.8cm diameter - Relief Santa Claus Style
Christmas Relief Santa Claus Knitted Texture Flower Pot Silicone Mold DIY Candle Holder Plaster Resin Craft Making
$4.32
Mix MOQ : 5
Winged Angel Girl Portrait Silicone Mold For DIY Candlestick Plaster Epoxy Resin Succulent Flower Pot Crafting
Winged Angel Girl Portrait Silicone Mold For DIY Candlestick Plaster Epoxy Resin Succulent Flower Pot Crafting
like
Find Similar
Angel girl with wings silicone mold for DIY resin flowerpot and plaster sculpture - NO.1 Wing Angel Candle Holder
Silicone angel girl mold for resin DIY including height and width size measurements - NO.2 Wing Angel Candle Holder
Winged Angel Girl Portrait Silicone Mold For DIY Candlestick Plaster Epoxy Resin Succulent Flower Pot Crafting
$3.11-3.40
No MOQ
Cylindrical Storage Jar Silicone Mold Snowflake Relief DIY Resin Plaster Candle Holder Crafting Christmas Decoration
Cylindrical Storage Jar Silicone Mold Snowflake Relief DIY Resin Plaster Candle Holder Crafting Christmas Decoration
like
Find Similar
Cylindrical silicone mold for snowflake embossed candle cup and gypsum storage pot - Ribbon Lace Storage Cup
Silicone cylinder mold for 3D embossed snowflake candle jar or succulent flower pot - Snowflake Storage Cup
Cylindrical Storage Jar Silicone Mold Snowflake Relief DIY Resin Plaster Candle Holder Crafting Christmas Decoration
$3.46-4.03
No MOQ
Silicone Mold Cute Pig Shape Star Clover Pattern DIY Handmade Resin Plaster Wax Cake Chocolate Craft Home Decor
Silicone Mold Cute Pig Shape Star Clover Pattern DIY Handmade Resin Plaster Wax Cake Chocolate Craft Home Decor
like
Find Similar
Star-patterned pig resin mold with finished pink crafts and size specifications - Star Hollow Style / Star Triple Pig
Three-size pig shaped silicone mold with four-leaf clover hollow and finished resin crafts - Clover Hollow Style / Clover Triple Pig
Silicone Mold Cute Pig Shape Star Clover Pattern DIY Handmade Resin Plaster Wax Cake Chocolate Craft Home Decor
-5%
$2.60
Mix MOQ : 2
Lily Calla Lily Shape Silicone Mold Flexible For Fondant Cake Decorating Aromatherapy Candle Making Resin DIY Crafting Tools
Lily Calla Lily Shape Silicone Mold Flexible For Fondant Cake Decorating Aromatherapy Candle Making Resin DIY Crafting Tools
like
Find Similar
3D lily flower silicone mold for DIY fondant cake decorating and plaster crafting - 1# Translucent-B48 (Lily)
Translucent lily flower silicone mold for DIY handmade resin and plaster crafts - 2# Translucent-B47 (Calla Lily)
Lily Calla Lily Shape Silicone Mold Flexible For Fondant Cake Decorating Aromatherapy Candle Making Resin DIY Crafting Tools
$1.18-1.24
No MOQ
Round Rose Flower Ball Silicone Mold DIY Cake Decorating Chocolate Resin Soap Clay Craft Making Tool
Round Rose Flower Ball Silicone Mold DIY Cake Decorating Chocolate Resin Soap Clay Craft Making Tool
like
Find Similar
White silicone mold for DIY rose embossed soaps and candles with bronze-colored finish - Clear
Pink silicone mold for rose cylinder cakes and soaps with floral relief detail - Pink
Round Rose Flower Ball Silicone Mold DIY Cake Decorating Chocolate Resin Soap Clay Craft Making Tool
$0.92
No MOQ
Mini Portable First Aid Pouch Oxford Cloth Medicine Storage Bag For Outdoor Travel Emergency Household Organizer
Mini Portable First Aid Pouch Oxford Cloth Medicine Storage Bag For Outdoor Travel Emergency Household Organizer
like
Find Similar
Portable red and beige canvas first-aid case with white cross and zipper for travel - Red
Portable blue first-aid pouch with cross embroidery and zipper for travel medicines - Blue
Mini Portable First Aid Pouch Oxford Cloth Medicine Storage Bag For Outdoor Travel Emergency Household Organizer
$1.07
No MOQ
Cat Sitting On Moon Enamel Brooch Pin Zinc Alloy Animal Badge Punk Style Decorative Lapel Jewelry For Women Men
Cat Sitting On Moon Enamel Brooch Pin Zinc Alloy Animal Badge Punk Style Decorative Lapel Jewelry For Women Men
like
Find Similar
Punk style alloy cat on the moon enamel pin badge with black and gold metallic finish - Black
Cute gold cat on moon brooch with white enamel detail and star accents for women - White
Cat Sitting On Moon Enamel Brooch Pin Zinc Alloy Animal Badge Punk Style Decorative Lapel Jewelry For Women Men
-13%
$0.70
Mix MOQ : 2
 · 
19 sold recently
Heart Silicone Mold Pixel Geometric Style For Resin Casting DIY Pendant Making Creative Mirror Surface Crafting Tool
Heart Silicone Mold Pixel Geometric Style For Resin Casting DIY Pendant Making Creative Mirror Surface Crafting Tool
like
Find Similar
6-cavity pixel heart silicone mold for resin casting and DIY jewelry making projects - Mirror Pixel Heart Mold
Heart Silicone Mold Pixel Geometric Style For Resin Casting DIY Pendant Making Creative Mirror Surface Crafting Tool
$0.72
No MOQ
Angel Wings Feather Silicone Mold For DIY Crystal Epoxy Resin Jewelry Accessories Cake Fondant Decorating Baking Tool
Angel Wings Feather Silicone Mold For DIY Crystal Epoxy Resin Jewelry Accessories Cake Fondant Decorating Baking Tool
like
Find Similar
Translucent silicone angel wing mold with fine feather texture for DIY resin jewelry - Wing Feather Style
Angel Wings Feather Silicone Mold For DIY Crystal Epoxy Resin Jewelry Accessories Cake Fondant Decorating Baking Tool
$0.40
No MOQ
3D Unicorn Silicone Mold Mirror Surface Resin Casting Tool For DIY Jewelry Pendant Keychain Making Crafting Transparent Mold
3D Unicorn Silicone Mold Mirror Surface Resin Casting Tool For DIY Jewelry Pendant Keychain Making Crafting Transparent Mold
like
Find Similar
DIY unicorn silicone mold with a clear crystal resin sculpture on black background - Unicorn Design
3D Unicorn Silicone Mold Mirror Surface Resin Casting Tool For DIY Jewelry Pendant Keychain Making Crafting Transparent Mold
$0.46
No MOQ
Crab Shaped Silicone Fondant Cake Mold DIY Chocolate Baking Tool Realistic Marine Crab Resin Clay Soap Mold Kitchen Baking Accessory
Crab Shaped Silicone Fondant Cake Mold DIY Chocolate Baking Tool Realistic Marine Crab Resin Clay Soap Mold Kitchen Baking Accessory
like
Find Similar
1 option
NewCrab Shaped Silicone Fondant Cake Mold DIY Chocolate Baking Tool Realistic Marine Crab Resin Clay Soap Mold Kitchen Baking Accessory
$0.64
No MOQ
Ballet Girl Silicone Fondant Mold Girl Shape Chocolate Jelly Pudding Mold Handmade Soap Candle Resin Plaster Craft Baking Tools
Ballet Girl Silicone Fondant Mold Girl Shape Chocolate Jelly Pudding Mold Handmade Soap Candle Resin Plaster Craft Baking Tools
like
Find Similar
1 option
Ballet Girl Silicone Fondant Mold Girl Shape Chocolate Jelly Pudding Mold Handmade Soap Candle Resin Plaster Craft Baking Tools
-5%
$0.87
No MOQ
3D Chihuahua Dog Silicone Mold Realistic Puppy Shape For Chocolate Cake Fondant Gypsum Resin DIY Handcraft Baking Tool
3D Chihuahua Dog Silicone Mold Realistic Puppy Shape For Chocolate Cake Fondant Gypsum Resin DIY Handcraft Baking Tool
like
Find Similar
3D Chihuahua dog silicone mold for handmade resin crafts and chocolate cake decorations - Pink
3D Chihuahua Dog Silicone Mold Realistic Puppy Shape For Chocolate Cake Fondant Gypsum Resin DIY Handcraft Baking Tool
$2.07
Mix MOQ : 2
Baby Footprint Silicone Mold For DIY Cake Decorating Chocolate Fondant Plaster Resin Handcraft Pink Baking Tool Accessories
Baby Footprint Silicone Mold For DIY Cake Decorating Chocolate Fondant Plaster Resin Handcraft Pink Baking Tool Accessories
like
Find Similar
Pink silicone baby footprint mold for DIY baking and handmade plaster crafts - Pink
Baby Footprint Silicone Mold For DIY Cake Decorating Chocolate Fondant Plaster Resin Handcraft Pink Baking Tool Accessories
$0.55
Mix MOQ : 2
Crystal Pillar Shape Silicone Mold For Handmade Fondant Cake Decorating Tools Geometric Prism Resin Casting DIY Craft Mold
Crystal Pillar Shape Silicone Mold For Handmade Fondant Cake Decorating Tools Geometric Prism Resin Casting DIY Craft Mold
like
Find Similar
1 option
Crystal Pillar Shape Silicone Mold For Handmade Fondant Cake Decorating Tools Geometric Prism Resin Casting DIY Craft Mold
-4%
$0.21
No MOQ
Cute Cartoon Animal Head Stickers PVC Waterproof Decorative Decals For Laptop Luggage Notebook DIY Kids Gift
Cute Cartoon Animal Head Stickers PVC Waterproof Decorative Decals For Laptop Luggage Notebook DIY Kids Gift
like
Find Similar
50 pieces of cute cartoon animal head stickers for waterproof laptop and luggage decoration - Style 1 (OPQ270)
Detailed spread of cute cartoon animal stickers featuring cats dogs and pandas - Style 2 (OPQ283)
Cute Cartoon Animal Head Stickers PVC Waterproof Decorative Decals For Laptop Luggage Notebook DIY Kids Gift
$0.86
No MOQ
Portable PU Leather Jewelry Box For Women Girls Mirror Travel Mini Jewelry Organizer Case For Earrings Rings Necklaces
Portable PU Leather Jewelry Box For Women Girls Mirror Travel Mini Jewelry Organizer Case For Earrings Rings Necklaces
like
Find Similar
Portable pink jewelry box with mirror, earring panel and ring slots for travel storage - Pink
Blue faux leather jewelry box with mirror and zipper for ring storage - Light Blue
Portable white PU leather jewelry box with mirror for rings and earrings storage - White
Portable PU Leather Jewelry Box For Women Girls Mirror Travel Mini Jewelry Organizer Case For Earrings Rings Necklaces
-9%
$4.98
Mix MOQ : 5
 · 
14 views
Mini Satin Ribbon Bows With Faux Artificial Pearl Decorative Bows For DIY Crafting Hair Accessories Cake Topper Apparel Decoration
Mini Satin Ribbon Bows With Faux Artificial Pearl Decorative Bows For DIY Crafting Hair Accessories Cake Topper Apparel Decoration
like
Find Similar
Yellow ribbon bow with white pearl centerpiece for cake decor and DIY crafts, 35mm wide - Yellow(1)
Brown satin bow ornament with white pearl center and 35mm measurement scale display - Brown (2)
Dark blue ribbon bow with pearl center, measuring 3.5cm to 4cm for cake and DIY decor - Navy Blue (3)
Detailed view of small light yellow ribbon bow with pearl core and size measurement - Light Yellow (4)
+14
Mini Satin Ribbon Bows With Faux Artificial Pearl Decorative Bows For DIY Crafting Hair Accessories Cake Topper Apparel Decoration
$0.07
Mix MOQ : 10
Bear Silicone Mold Flexible 3D Cartoon Polar Bear Shape For DIY Handmade Cake Chocolate Candle Soap Resin Craft Cute Baking
Bear Silicone Mold Flexible 3D Cartoon Polar Bear Shape For DIY Handmade Cake Chocolate Candle Soap Resin Craft Cute Baking
like
Find Similar
Macro detail of S-size polar bear silicone mold and orange resin sleeping bear craft - Size S (Sleeping Pose)
Close-up of bear silicone mold alongside an orange polar bear resin craft in size M - Size M (Prone Pose)
Detailed view of polar bear silicone mold with its finished orange resin bear craft in large size - Size L (Sitting Pose)
Bear Silicone Mold Flexible 3D Cartoon Polar Bear Shape For DIY Handmade Cake Chocolate Candle Soap Resin Craft Cute Baking
$0.75-1.30
No MOQ
Watercolor Bird PET Stickers Waterproof Decorative Animal Decals For DIY Scrapbook Laptop Luggage Journal Stationery
Watercolor Bird PET Stickers Waterproof Decorative Animal Decals For DIY Scrapbook Laptop Luggage Journal Stationery
like
Find Similar
Round composition of transparent PET watercolor bird stickers with vibrant floral elements - Watercolor Birds PET Sticker Pack
Watercolor Bird PET Stickers Waterproof Decorative Animal Decals For DIY Scrapbook Laptop Luggage Journal Stationery
$0.93
No MOQ
Round Vortex Silicone Cake Mold For Fondant Chocolate Candy DIY Handcrafted Soap Resin Clay Crafting Kitchen Baking
Round Vortex Silicone Cake Mold For Fondant Chocolate Candy DIY Handcrafted Soap Resin Clay Crafting Kitchen Baking
like
Find Similar
DIY geometric silicone mold for chocolate and cream sugar featuring 7 spiral holes - 7-Cavity Whirlpool Style (1)
DIY geometric silicone mold for cakes and chocolates with pleated cream shapes - 4-Cavity Cream Tip Style (2)
7-cavity spiral geometric silicone mold for DIY candy, chocolate, and cake decorating - 7-Cavity Spiral Style (3)
Round Vortex Silicone Cake Mold For Fondant Chocolate Candy DIY Handcrafted Soap Resin Clay Crafting Kitchen Baking
$0.43-0.86
Mix MOQ : 2
Heart Shape Bubble Silicone Mold 3D Berry Texture DIY Candle Making Resin Casting Tool Romantic Valentine Day Decor
Heart Shape Bubble Silicone Mold 3D Berry Texture DIY Candle Making Resin Casting Tool Romantic Valentine Day Decor
like
Find Similar
Bubble heart silicone mold with yellow textured heart-shaped finished resin piece - Large Bubble Heart
3D bubble heart silicone mold for DIY resin crafts and romantic gypsum decor - Medium Bubble Heart
Bubble heart silicone mold with textured berry finish and red resin sample product - Small Bubble Heart
Heart Shape Bubble Silicone Mold 3D Berry Texture DIY Candle Making Resin Casting Tool Romantic Valentine Day Decor
-5%
$0.96-1.78
Mix MOQ : 5
Cute Cat Shaped Silicone Resin Mold Mirror Surface DIY Handmade Crafting Tool For Jewelry Pendant Casting Accessory
Cute Cat Shaped Silicone Resin Mold Mirror Surface DIY Handmade Crafting Tool For Jewelry Pendant Casting Accessory
like
Find Similar
3 options
Cute Cat Shaped Silicone Resin Mold Mirror Surface DIY Handmade Crafting Tool For Jewelry Pendant Casting Accessory
-6%
$0.27
No MOQ
Skull Snail Silicone Mold Gothic Halloween DIY Crafting Aromatherapy Candle Resin Plaster Ornament Making
Skull Snail Silicone Mold Gothic Halloween DIY Crafting Aromatherapy Candle Resin Plaster Ornament Making
like
Find Similar
Skull snail silicone mold for DIY Halloween candles and ornaments in translucent finish - Monster Snail
Skull snail silicone mold with red finished casting and dimension labels for DIY crafts - Snail Skull
Skull Snail Silicone Mold Gothic Halloween DIY Crafting Aromatherapy Candle Resin Plaster Ornament Making
-5%
$3.50
Mix MOQ : 5
3D Bear Silicone Mold For Candle Making Resin Casting Plaster DIY Cute Teddy Bear With Party Hat Ornament
3D Bear Silicone Mold For Candle Making Resin Casting Plaster DIY Cute Teddy Bear With Party Hat Ornament
like
Find Similar
DIY bear silicone mold with 8.5cm height for Christmas hat bear plaster ornaments - Cross-legged Bear
DIY silicone mold for making a bear with a party hat, includes precise size measurements - Bear with Hands Behind Back
New3D Bear Silicone Mold For Candle Making Resin Casting Plaster DIY Cute Teddy Bear With Party Hat Ornament
$2.88
Mix MOQ : 5
Go to

More in home & kitchen

Explore more in mini resin animals

resinphonebag pendantgirlshangingshapecakeholdertableholiday
diydesktop ornamentstylediy accessoriesresin keychainmetalclawstrapheadwhite

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access