Everful

Wholesale purse chains

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Purse Chains

Find the perfect pieces: handbags, shoulder bags, crossbody bags and more

All products in purse chains

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Alloy Glasses Chain Double Layer Metal Paperclip Link Eyewear Strap Geometric Punk Hip Hop For Women
Alloy Glasses Chain Double Layer Metal Paperclip Link Eyewear Strap Geometric Punk Hip Hop For Women
like
Find Similar
Double-layered golden hip hop punk glasses chain with geometric metal links and silicone loops - Gold
Hip-hop punk silver double-layer eyewear chain with large paperclip and link chain design - Silver
Alloy Glasses Chain Double Layer Metal Paperclip Link Eyewear Strap Geometric Punk Hip Hop For Women
$1.15
No MOQ
 · 
17 sold recently
Floral Phone Case With 3D White Flower For iPhone Soft TPU Cream Handheld Metal Chain Loop Japanese Ins Style Women Girls
Floral Phone Case With 3D White Flower For iPhone Soft TPU Cream Handheld Metal Chain Loop Japanese Ins Style Women Girls
like
Find Similar
Cream white iPhone case with 3D floral accent and golden metal chain hand strap - Apricot Heart Daisy Grip with Metal Chain / iPhone 7 Plus/8 Plus
+30
Floral Phone Case With 3D White Flower For iPhone Soft TPU Cream Handheld Metal Chain Loop Japanese Ins Style Women Girls
-9%
$2.75
No MOQ
Glasses Chain With Metal Link And Black Fabric Flower Pendant Anti-Slip Sunglasses Strap Fashion Eyewear Neck Cord Holder
Glasses Chain With Metal Link And Black Fabric Flower Pendant Anti-Slip Sunglasses Strap Fashion Eyewear Neck Cord Holder
like
Find Similar
Fashionable black and gold woven eyewear chain with elegant fabric flower pendants - Black Flower Metal Chain (GL597)
Glasses Chain With Metal Link And Black Fabric Flower Pendant Anti-Slip Sunglasses Strap Fashion Eyewear Neck Cord Holder
$2.02
No MOQ
Free Shipping
Stainless Steel Modular Keychain Gold Silver Rose Gold Plated Metal Chain Key Ring Holder Minimalist DIY Jewelry Gift
Stainless Steel Modular Keychain Gold Silver Rose Gold Plated Metal Chain Key Ring Holder Minimalist DIY Jewelry Gift
like
Find Similar
Rose gold Italian modular keychain with rectangular links and lobster clasp component - Rose Gold
Polished gold-plated stainless steel modular keychain with lobster clasp and round ring - Gold
Italian modular keychain in silver finish featuring links and secure lobster clasp - Silver
Stainless Steel Modular Keychain Gold Silver Rose Gold Plated Metal Chain Key Ring Holder Minimalist DIY Jewelry Gift
-9%
$1.00-1.78
Mix MOQ : 2
Free Shipping
Bridal Hair Vine Artificial Pearl Crystal Rhinestone Handmade Headband Wedding Hair Accessories For Women Soft Chain
Bridal Hair Vine Artificial Pearl Crystal Rhinestone Handmade Headband Wedding Hair Accessories For Women Soft Chain
like
Find Similar
Elegant bridal hair vine with white pearls and crystals on silver wire for weddings - Silver
Detailed view of bridal headpiece featuring gold wire, white pearls, and crystals - Gold
Elegant bridal pearl and crystal hair vine accessory with white ribbons on blue background - Silver With Ribbon
Detailed close-up of bridal headpiece featuring gold wire, white pearls, and crystals - Gold TS1286
+3
Bridal Hair Vine Artificial Pearl Crystal Rhinestone Handmade Headband Wedding Hair Accessories For Women Soft Chain
-4%
$3.29
No MOQ
 · 
20 views
Free Shipping
Mini Straw Hat Keychain With Imitation Artificial Pearl Bow Acrylic Beaded Chain Bag Charm Kawaii Sweet Pendant For Women Girls
Mini Straw Hat Keychain With Imitation Artificial Pearl Bow Acrylic Beaded Chain Bag Charm Kawaii Sweet Pendant For Women Girls
like
Find Similar
Detail of a pink woven mini hat keychain with pearl bow and golden metal lobster clasp - Bow Hat Style / Pink-Hat Style
Creative yellow mini straw hat keychain with white pearl bow on a purple book - Bow Hat Style / Cream-Hat Style
Blue straw hat keychain with pearl bow and gold metal ring on a soft plush background - Bow Hat Style / Blue-Hat Style
Creative mini straw hat keychain with pearl bow pendant and gold ring on plush background - Bow Hat Style / White-Hat Style
+4
Mini Straw Hat Keychain With Imitation Artificial Pearl Bow Acrylic Beaded Chain Bag Charm Kawaii Sweet Pendant For Women Girls
-8%
$0.42-0.44
Mix MOQ : 2
Folding Phone Case For Z Flip With Metal Crossbody Chain Satin Scarf Handle Bear Stand Litchi Leather Style
Folding Phone Case For Z Flip With Metal Crossbody Chain Satin Scarf Handle Bear Stand Litchi Leather Style
like
Find Similar
Champagne gold Galaxy Z Flip case with teddy bear relief and elegant floral silk ribbon - Fine Leather Grain - Gold Bear Stand - Silk Scarf Handle - Crossbody Chain / Samsung ZFlip3
Detail of Galaxy Z Flip case with black plaid pattern, gold bear charm, and silk ribbon - Checkered Pattern - Gold Bear Stand - Silk Scarf Handle - Crossbody Chain / Samsung ZFlip3
+28
Folding Phone Case For Z Flip With Metal Crossbody Chain Satin Scarf Handle Bear Stand Litchi Leather Style
-9%
$4.98
No MOQ
Folding Phone Case Houndstooth Pattern With Large Artificial Pearl Handheld Chain Balloon Dog Charm Women Luxury Protective Cover
Folding Phone Case Houndstooth Pattern With Large Artificial Pearl Handheld Chain Balloon Dog Charm Women Luxury Protective Cover
like
Find Similar
Detail of Galaxy Z Flip case with houndstooth pattern, pearl handle and puppy charm - Houndstooth-Pearl Chain-White Dog Pendant / Samsung ZFlip3
Detail of houndstooth phone case with pearl strap and black balloon dog charm for Z Flip - Houndstooth-Pearl Chain-Black Dog Pendant / Samsung ZFlip3
+28
Folding Phone Case Houndstooth Pattern With Large Artificial Pearl Handheld Chain Balloon Dog Charm Women Luxury Protective Cover
-9%
$3.27
No MOQ
Camellia Artificial Pearl Folding Phone Case With Crossbody Chain PU Leather Shockproof Cover For Samsung Galaxy Z Flip Series
Camellia Artificial Pearl Folding Phone Case With Crossbody Chain PU Leather Shockproof Cover For Samsung Galaxy Z Flip Series
like
Find Similar
Detail of white wavy leather phone case with camellia flower and pearl strap - Leaf Pattern Camellia Pearl Chain White / Samsung ZFlip3
Detail of quilted black leather phone case with camellia and pearl crossbody strap - Leaf Pattern Camellia Pearl Chain Black / Samsung ZFlip3
+28
Camellia Artificial Pearl Folding Phone Case With Crossbody Chain PU Leather Shockproof Cover For Samsung Galaxy Z Flip Series
-9%
$3.41
No MOQ
Sparkly Full Rhinestone Folding Phone Case With Metal Crossbody Chain Strap Luxury Shimmering Protective Shell Cover
Sparkly Full Rhinestone Folding Phone Case With Metal Crossbody Chain Strap Luxury Shimmering Protective Shell Cover
like
Find Similar
Glittery silver Samsung Galaxy Z Flip case with a long gold crossbody chain strap - Checkered White with Crossbody Chain / Samsung ZFlip3
Close-up of glittery Samsung Galaxy Z Flip case with golden metal chain strap on white background - Checkered Black with Crossbody Chain / Samsung ZFlip3
+28
Sparkly Full Rhinestone Folding Phone Case With Metal Crossbody Chain Strap Luxury Shimmering Protective Shell Cover
-9%
$2.88
No MOQ
Folding Phone Case Leather Texture Heart Ring Grip Balloon Dog Puppy Pendant Resin Chain Wristlet Shockproof
Folding Phone Case Leather Texture Heart Ring Grip Balloon Dog Puppy Pendant Resin Chain Wristlet Shockproof
like
Find Similar
Pink lychee texture folding phone case with heart stand, handle, and black balloon dog charm - Black Heart Ring Style (Includes Card Puppy Chain Pendant) / Samsung ZFlip3
Black leather Galaxy Z Flip case with pink ball grip and clover pendant held by hand - Black Round Ball Ring Style (Includes Card Puppy Chain Pendant) / Samsung ZFlip3
+28
Folding Phone Case Leather Texture Heart Ring Grip Balloon Dog Puppy Pendant Resin Chain Wristlet Shockproof
-9%
$3.35
No MOQ
Butterfly Artificial Pearl Flower Phone Case Transparent TPU Wave Frame With Beaded Butterfly Chain Strap Shockproof For Women
Butterfly Artificial Pearl Flower Phone Case Transparent TPU Wave Frame With Beaded Butterfly Chain Strap Shockproof For Women
like
Find Similar
Laser butterfly and pearl flower phone case for iPhone with transparent beaded hand strap - iPhone 7/8/SE 2020
+30
Butterfly Artificial Pearl Flower Phone Case Transparent TPU Wave Frame With Beaded Butterfly Chain Strap Shockproof For Women
-9%
$1.78
No MOQ
Metal Bead Glasses Chain Non-Slip Lanyard Mask Strap Neck Hanging Anti-Lost Holder Accessory Simple Elegant
Metal Bead Glasses Chain Non-Slip Lanyard Mask Strap Neck Hanging Anti-Lost Holder Accessory Simple Elegant
like
Find Similar
Detail of golden beaded eyeglass chain with lobster clasps and white silicone loops - Gold
Detail of silver beaded eyeglass chain with lobster clasps and silicone loops - Silver
Detail of black beaded metal chain with lobster clasps and anti-slip rubber loops - Gun Black
Rose gold beaded chain strap for glasses and face masks with adjustable silicone loops - Rose Gold
Metal Bead Glasses Chain Non-Slip Lanyard Mask Strap Neck Hanging Anti-Lost Holder Accessory Simple Elegant
-6%
$0.27
Mix MOQ : 2
 · 
20 sold recently
Stainless Steel Glasses Chain Vacuum Plated Non Fading Anti Slip Eyeglass Lanyard Necklace Holder For Women Men
Stainless Steel Glasses Chain Vacuum Plated Non Fading Anti Slip Eyeglass Lanyard Necklace Holder For Women Men
like
Find Similar
Minimalist gold stainless steel eyeglass chain with durable twist rope texture links - Gold
Stainless Steel Glasses Chain Vacuum Plated Non Fading Anti Slip Eyeglass Lanyard Necklace Holder For Women Men
$2.02
No MOQ
Free Shipping
Gothic Bow Hair Clip Ribbon Artificial Leather Heart Buckle Metal Chain Pixel Heart Pendant Lolita Punk Hair Accessory Women
Gothic Bow Hair Clip Ribbon Artificial Leather Heart Buckle Metal Chain Pixel Heart Pendant Lolita Punk Hair Accessory Women
like
Find Similar
Gothic black bow hair clip with leather strap, heart buckle and pixel heart chain pendant - Black
Detail of burgundy gothic bow hair clip with leather strap, silver buckle and heart chain - Burgundy
Detail of gothic white bow hair clip with black leather strap and pixel heart chain - White
Gothic Bow Hair Clip Ribbon Artificial Leather Heart Buckle Metal Chain Pixel Heart Pendant Lolita Punk Hair Accessory Women
$1.24
Mix MOQ : 2
Zinc Alloy Iron Lobster Clasp Keychain Ring Set For DIY Jewelry Making Phone Chain Hooks Key Ring Accessories
Zinc Alloy Iron Lobster Clasp Keychain Ring Set For DIY Jewelry Making Phone Chain Hooks Key Ring Accessories
like
Find Similar
Silver lobster clasp and flat key ring set for DIY handmade keychain accessories - 32mm / Silver
Golden zinc alloy lobster clasp with flat split key ring for DIY handmade keychains - 32mm / Gold
Golden zinc alloy lobster clasp with spring ring set for DIY keychain jewelry making - 32mm / KC Gold
Gunmetal zinc alloy lobster clasp with split key ring for DIY keychain crafts - 32mm / Gunmetal
+8
Zinc Alloy Iron Lobster Clasp Keychain Ring Set For DIY Jewelry Making Phone Chain Hooks Key Ring Accessories
-5%
$0.42-0.57
Mix MOQ : 2
Houndstooth Foldable Phone Case With Camellia Flower And Artificial Pearl Chain Strap Handbag Style For Foldable Smartphones
Houndstooth Foldable Phone Case With Camellia Flower And Artificial Pearl Chain Strap Handbag Style For Foldable Smartphones
like
Find Similar
Detail of houndstooth Z Flip case with white camellia flower and pearl leather chain strap - White / Samsung ZFlip5
Detail of Galaxy Z Flip case featuring houndstooth pattern, camellia and pearl chain - Black / Samsung ZFlip5
+28
Houndstooth Foldable Phone Case With Camellia Flower And Artificial Pearl Chain Strap Handbag Style For Foldable Smartphones
-8%
$3.54
No MOQ
Folding Phone Case With Plush Bear Patch And Furry Wristlet Chain Polycarbonate PU Leather Cute Kawaii Anti-Fall Design
Folding Phone Case With Plush Bear Patch And Furry Wristlet Chain Polycarbonate PU Leather Cute Kawaii Anti-Fall Design
like
Find Similar
Pink Samsung Galaxy Z Flip plush phone case with cute bear embroidery and fluffy ring handle - Embroidered Bear + Plush Wristband / Pink / Samsung ZFlip5
Cute plush bear phone case for Samsung Z Flip with a large purple faux fur ball chain - Embroidered Bear + Plush Wristband / Champagne Gold / Samsung ZFlip5
+28
NewFolding Phone Case With Plush Bear Patch And Furry Wristlet Chain Polycarbonate PU Leather Cute Kawaii Anti-Fall Design
-9%
$2.75
No MOQ
Faux Leather Folding Phone Case Artificial Pearl Hand Chain Rhinestone Bear Decor Ring Holder Luxury Style For Women
Faux Leather Folding Phone Case Artificial Pearl Hand Chain Rhinestone Bear Decor Ring Holder Luxury Style For Women
like
Find Similar
Detail of luxury brown leather Z Flip case with rhinestone bear and pearl chain strap - Black Bear Style / Samsung ZFlip5
Brown leather Z Flip case featuring a golden bear charm, crystal ring, and pearl wrist strap - Iridescent Bear Style / Samsung ZFlip5
+28
Faux Leather Folding Phone Case Artificial Pearl Hand Chain Rhinestone Bear Decor Ring Holder Luxury Style For Women
-9%
$3.09
No MOQ
Foldable Phone Case For Samsung Galaxy Z Flip With 3D Bear Coffee Charm Large Bead Hand Chain Strap Textured PC Shell
Foldable Phone Case For Samsung Galaxy Z Flip With 3D Bear Coffee Charm Large Bead Hand Chain Strap Textured PC Shell
like
Find Similar
Detail of Galaxy Z Flip case with black bead chain, 3D bear charm and coffee cup motif - White / Samsung ZFlip3
Detail of Samsung Z Flip case with 3D teddy bear charm and black beaded handle strap - Black / Samsung ZFlip3
+28
Foldable Phone Case For Samsung Galaxy Z Flip With 3D Bear Coffee Charm Large Bead Hand Chain Strap Textured PC Shell
-9%
$2.88
No MOQ
Quilted Leather Wallet Phone Case With Heart Lock Buckle Artificial Pearl Chain Crossbody Shoulder Strap Luxury For Foldable Phone
Quilted Leather Wallet Phone Case With Heart Lock Buckle Artificial Pearl Chain Crossbody Shoulder Strap Luxury For Foldable Phone
like
Find Similar
Detail of white quilted phone case with gold lock, pearl charms and chain strap - White / Samsung ZFlip3
Detail of quilted leather phone case for Samsung Z Flip with pearl and gold chain straps - Black / Samsung ZFlip3
+28
Quilted Leather Wallet Phone Case With Heart Lock Buckle Artificial Pearl Chain Crossbody Shoulder Strap Luxury For Foldable Phone
-9%
$4.72
No MOQ
Crossbody Flip Phone Case Wallet Quilted Leather Butterfly Lock Artificial Pearl Metal Chain Luxury Fashion Women
Crossbody Flip Phone Case Wallet Quilted Leather Butterfly Lock Artificial Pearl Metal Chain Luxury Fashion Women
like
Find Similar
Detail of white quilted leather phone case with butterfly decor, pearl strap and chain - White / Samsung ZFlip3
Detail of black quilted leather phone case for Samsung Z Flip with pearl strap and butterfly - Black / Samsung ZFlip3
+28
Crossbody Flip Phone Case Wallet Quilted Leather Butterfly Lock Artificial Pearl Metal Chain Luxury Fashion Women
-9%
$4.72
No MOQ
Luxury Folding Phone Case With Faux Artificial Pearl Hand Chain Rhinestone Bear Heart Pendant Hard PC Protective Cover
Luxury Folding Phone Case With Faux Artificial Pearl Hand Chain Rhinestone Bear Heart Pendant Hard PC Protective Cover
like
Find Similar
White Galaxy Z Flip case featuring pearl heart and rhinestone bear with long pearl chain - White Cross Pattern (Heart Bow Bear) / Samsung ZFlip3
Samsung Galaxy Z Flip case in champagne gold with pearl wrist strap and rhinestone charms - Gold Fine Texture (Heart Bow Bear) / Samsung ZFlip3
+28
NewLuxury Folding Phone Case With Faux Artificial Pearl Hand Chain Rhinestone Bear Heart Pendant Hard PC Protective Cover
-8%
$3.25
No MOQ
Argyle Checkered PU Leather Crossbody Phone Case With Metal Chain And Small Wallet Pouch For Foldable Smartphone
Argyle Checkered PU Leather Crossbody Phone Case With Metal Chain And Small Wallet Pouch For Foldable Smartphone
like
Find Similar
Vintage argyle foldable phone case with pearl crossbody strap for Samsung Z Flip - Argyle Black (Lock Wallet + Smile Iron Bead Chain) / OPPO Find N3 Flip
Detail of retro plaid phone case for Samsung Z Flip with coin purse and crossbody chain - Argyle Brown (Lock Wallet + Smile Iron Bead Chain) / OPPO Find N3 Flip
+28
Argyle Checkered PU Leather Crossbody Phone Case With Metal Chain And Small Wallet Pouch For Foldable Smartphone
-9%
$4.19
No MOQ
Camellia Flower Quilted Wallet Phone Case With Crossbody Chain Strap Smile Rhinestone PU Leather Flip Cover
Camellia Flower Quilted Wallet Phone Case With Crossbody Chain Strap Smile Rhinestone PU Leather Flip Cover
like
Find Similar
White litchi pattern folding phone case with wave edges, card slot, and gold flower snap - White / Samsung ZFlip3
Crossbody phone bag with quilted black leather, gold chain, and camellia floral emblem - Black / Samsung ZFlip3
+28
NewCamellia Flower Quilted Wallet Phone Case With Crossbody Chain Strap Smile Rhinestone PU Leather Flip Cover
-9%
$4.40
No MOQ
Crossbody Folding Phone Case With Tweed Wallet Card Holder Artificial Pearl Leather Chain Strap Camellia Flower For Samsung Z Flip
Crossbody Folding Phone Case With Tweed Wallet Card Holder Artificial Pearl Leather Chain Strap Camellia Flower For Samsung Z Flip
like
Find Similar
Detail of tweed Samsung Z Flip case with mini pocket, pearl chain and gold rose button - White Camellia Wallet Style / Huawei pocket 2
Detailed luxury crossbody phone case with a camellia metal clasp and pearl chain strap - Black Camellia Wallet Style / Huawei pocket 2
+28
NewCrossbody Folding Phone Case With Tweed Wallet Card Holder Artificial Pearl Leather Chain Strap Camellia Flower For Samsung Z Flip
-9%
$4.19
No MOQ
Glitter Earphone Case With Acrylic Chain Star Butterfly Charm TPU Protective Cover Fashion Accessories For Women
Glitter Earphone Case With Acrylic Chain Star Butterfly Charm TPU Protective Cover Fashion Accessories For Women
like
Find Similar
Close-up of glittery pink AirPods Pro case with star pendant and pink chain handle - AirPods 1/2 Gen / Butterfly Pendant-Pink
Close-up of yellow glitter AirPods case with stars pendant and metal carabiner - AirPods 1/2 Gen / Star Pendant-Yellow
Glitter blue case for AirPods with star charm and acrylic chain accessory detail - AirPods 1/2 Gen / Star Pendant-Blue
Close-up of glitter AirPods case with silver star pendant and acrylic chain decoration - AirPods 1/2 Gen / Star Pendant-Silver
+26
NewGlitter Earphone Case With Acrylic Chain Star Butterfly Charm TPU Protective Cover Fashion Accessories For Women
-9%
$1.96
No MOQ
Large Alloy Hair Claw Clips Geometric Hollow Link Chain Rhinestone Enamel Flower Hair Clamps For Women
Large Alloy Hair Claw Clips Geometric Hollow Link Chain Rhinestone Enamel Flower Hair Clamps For Women
like
Find Similar
Large geometric hollow rectangle hair claw clip in elegant gold-plated finish - Square Chain Style
Large golden alloy hair claw clip with minimalist chain design and rhinestone accents - Oval Chain Style
Elegant gold heart-shaped claw clip with a polished chain-link metal design - Heart Style
Set of four flower hair claws in cream, yellow, pink and blue with rhinestone details - Solid Color Flower Style
+4
Large Alloy Hair Claw Clips Geometric Hollow Link Chain Rhinestone Enamel Flower Hair Clamps For Women
$0.61-1.30
Mix MOQ : 2
 · 
10 views
Women's Quartz Watch Vintage Rectangular Dial Rhinestone Bezel Metal Chain Bracelet Strap Elegant Fashion For Ladies
Women's Quartz Watch Vintage Rectangular Dial Rhinestone Bezel Metal Chain Bracelet Strap Elegant Fashion For Ladies
like
Find Similar
Detail of a vintage-style gold rectangular quartz watch with sparkling rhinestone bezel - Gold
Elegant rectangular women's watch with red dial, gold chain strap and crystal bezel - Red
Elegant gold vintage square watch for women with green dial and rhinestone bezel decoration - Green
Close-up of rectangular blue dial women's watch with rhinestone bezel and silver chain strap - Navy Blue
+2
Women's Quartz Watch Vintage Rectangular Dial Rhinestone Bezel Metal Chain Bracelet Strap Elegant Fashion For Ladies
$3.11
No MOQ
 · 
43 views
Hip Hop Knit Beanie Hat For Women Men Winter Warm Acrylic Skull Cap With Butterfly Metal Chain Pin Accessories Y2K Streetwear
Hip Hop Knit Beanie Hat For Women Men Winter Warm Acrylic Skull Cap With Butterfly Metal Chain Pin Accessories Y2K Streetwear
like
Find Similar
Black hip-hop beanie with butterfly pendants and silver chains in a punk street style - One Size / Black
Detail of white knit beanie featuring silver butterfly and cross chain pin accessories - One Size / White
Detailed macro shot of a pink knitted beanie featuring a silver butterfly and chain charm - One Size / Pink
Close-up of grey knitted beanie with punk metal safety pins and butterfly chain charms - One Size / Gray
+8
Hip Hop Knit Beanie Hat For Women Men Winter Warm Acrylic Skull Cap With Butterfly Metal Chain Pin Accessories Y2K Streetwear
$2.45
No MOQ
Vintage Alloy Wolf Head Brooch With Tassel Chain For Men Women Western Domineering Suit Collar Pin Fashion Jewelry Gift
Vintage Alloy Wolf Head Brooch With Tassel Chain For Men Women Western Domineering Suit Collar Pin Fashion Jewelry Gift
like
Find Similar
Silver wolf head lapel pins with long tassels on a black crocodile texture jewelry box - Wolf Head Style (With Double Chain) / Silver
Wolf head brooch in golden finish with double layered long chains on black textured box - Wolf Head Style (With Double Chain) / Gold
Wolf head golden alloy ear studs with detailed 3D texture on black jewelry box - Wolf Head Style (Without Chain) / Gold
Silver alloy wolf head cufflinks with polished finish on black textured box - Wolf Head Style (Without Chain) / Silver
Vintage Alloy Wolf Head Brooch With Tassel Chain For Men Women Western Domineering Suit Collar Pin Fashion Jewelry Gift
$0.79
No MOQ
 · 
1 reviews
Women Straw Fedora Hat With Metal Chain PU Leather Band Wide Brim Sun Protection Summer Beach Vintage Jazz Woven Straw Hat
Women Straw Fedora Hat With Metal Chain PU Leather Band Wide Brim Sun Protection Summer Beach Vintage Jazz Woven Straw Hat
like
Find Similar
Detail of red woven sun hat with black leather band and chunky gold chain buckle - Red
Classic yellow straw fedora hat with black ribbon and gold chain detail for sun protection - Yellow
Detailed texture of purple straw fedora hat featuring a bold gold chain and black band - Purple
Classic straw sun hat with black ribbon and gold chain detail for outdoor travel - Khaki
+20
Women Straw Fedora Hat With Metal Chain PU Leather Band Wide Brim Sun Protection Summer Beach Vintage Jazz Woven Straw Hat
$3.40
No MOQ
Ethnic Style Long Hair Chain Alloy Glass Gemstone Artificial Pearl Tassel Retro Middle Eastern Head Jewelry For Women
Ethnic Style Long Hair Chain Alloy Glass Gemstone Artificial Pearl Tassel Retro Middle Eastern Head Jewelry For Women
like
Find Similar
Detail of ethnic gold Maang Tikka with pink crystals and pearls on dark hair - Pink
Rear view of model wearing a vintage gold head chain with green gems and white pearls - Green
Bohemian gold head chain with colorful gemstones and pearls shown on model's hair - Colorful
Bohemian gold head chain with pink roses and tassels displayed on long black hair - Rose Red
+8
Ethnic Style Long Hair Chain Alloy Glass Gemstone Artificial Pearl Tassel Retro Middle Eastern Head Jewelry For Women
$3.75
No MOQ
 · 
18 views
Free Shipping
Transparent Smartphone Case With Silver Metal Bear Charm Bracelet Chain Anti Drop Acrylic TPU Cover Y2K Style
Transparent Smartphone Case With Silver Metal Bear Charm Bracelet Chain Anti Drop Acrylic TPU Cover Y2K Style
like
Find Similar
Light green matte phone case for Samsung S21 Ultra with silver bear metal chain strap - iPhone 6/6S / Acrylic Bear Bracelet
+28
Transparent Smartphone Case With Silver Metal Bear Charm Bracelet Chain Anti Drop Acrylic TPU Cover Y2K Style
-9%
$2.10
No MOQ
Vintage Woolen Fedora Hat Wide Brim Flat Rim With Leather Band Gold Metal Chain Buckle Fashion Jazz Cap Women Men
Vintage Woolen Fedora Hat Wide Brim Flat Rim With Leather Band Gold Metal Chain Buckle Fashion Jazz Cap Women Men
like
Find Similar
Detail of red fedora hat with brown leather band and golden triple-ring metal buckle - M (56-58cm) / Red
Detail of yellow wool fedora with brown faux leather band and gold metal chain buckle - M (56-58cm) / Yellow
Detail of purple fedora hat featuring a brown faux leather band and gold metal chain - M (56-58cm) / Purple
Detail of a brown wool fedora with a leather band and gold buckle on a white background - M (56-58cm) / Khaki
+25
Vintage Woolen Fedora Hat Wide Brim Flat Rim With Leather Band Gold Metal Chain Buckle Fashion Jazz Cap Women Men
$4.18
Mix MOQ : 2
Fashion Fedora Hat Woolen Felt Wide Brim With Metal Chain Vintage Jazz Cap For Men Women Autumn Winter Accessories
Fashion Fedora Hat Woolen Felt Wide Brim With Metal Chain Vintage Jazz Cap For Men Women Autumn Winter Accessories
like
Find Similar
Detail of red wool fedora featuring a wide brim and decorative silver metal chain link - M (56-58cm) / Red
Vibrant yellow wide brim fedora hat with gold chain band in wool-like felt finish - M (56-58cm) / Yellow
Deep purple wool wide brim fedora hat with stylish silver metal chain band detail - M (56-58cm) / Purple
Detail of wide brim brown fedora hat featuring a chunky gold metal chain decoration - M (56-58cm) / Khaki
+25
Fashion Fedora Hat Woolen Felt Wide Brim With Metal Chain Vintage Jazz Cap For Men Women Autumn Winter Accessories
-5%
$4.52
Mix MOQ : 2
Wide Brim Fedora Hat Woolen Felt Jazz Cap With Gold Chain Decoration Solid Color Fashion Accessory For Men Women
Wide Brim Fedora Hat Woolen Felt Jazz Cap With Gold Chain Decoration Solid Color Fashion Accessory For Men Women
like
Find Similar
Detail of red wool fedora hat featuring a chunky gold chain strap decoration - M(56-58cm) / Red
Detailed close-up of yellow felt fedora hat with a bold chunky gold chain accessory - M(56-58cm) / Yellow
Detailed side view of a dark purple wool fedora hat with a thick gold chain decoration - M(56-58cm) / Purple
Classic brown wool fedora hat with a stylish wide brim and decorative gold metal chain - M(56-58cm) / Khaki
+25
Wide Brim Fedora Hat Woolen Felt Jazz Cap With Gold Chain Decoration Solid Color Fashion Accessory For Men Women
$5.04
Mix MOQ : 2
Fedora Hat Woolen Wide Brim Jazz Hat With Thick Gold Chain British Style Autumn Winter For Men Women
Fedora Hat Woolen Wide Brim Jazz Hat With Thick Gold Chain British Style Autumn Winter For Men Women
like
Find Similar
Detailed view of red wool jazz fedora hat featuring a chunky decorative gold chain - M (56-58cm) / Red
Detail of yellow wool felt fedora featuring a bold gold metal chain link decoration - M (56-58cm) / Yellow
Detail of purple fedora hat featuring a bold gold chain band on a minimalist flat brim - M (56-58cm) / Purple
Detail of a brown wool fedora hat featuring a chunky gold chain strap on white background - M (56-58cm) / Khaki
+25
NewFedora Hat Woolen Wide Brim Jazz Hat With Thick Gold Chain British Style Autumn Winter For Men Women
$4.76
Mix MOQ : 2
Rabbit Ear Plush Flip Phone Case With Artificial Pearl Chain Strap Cross-Grain Faux Leather Cute Luxury For Foldable Smartphones
Rabbit Ear Plush Flip Phone Case With Artificial Pearl Chain Strap Cross-Grain Faux Leather Cute Luxury For Foldable Smartphones
like
Find Similar
Detail of white plush rabbit ear case with pearl handle for foldable smartphone - Samsung ZFlip3 / White
Pink plush rabbit ears case for Z Flip phone with decorative pearl strap handle - Samsung ZFlip3 / Pink
+28
Rabbit Ear Plush Flip Phone Case With Artificial Pearl Chain Strap Cross-Grain Faux Leather Cute Luxury For Foldable Smartphones
-9%
$3.35
No MOQ
Luxury Transparent Phone Case With Heart Shaped Mirror Stand Rhinestone Edge And Large Faux Artificial Pearl Hand Chain Bracelet
Luxury Transparent Phone Case With Heart Shaped Mirror Stand Rhinestone Edge And Large Faux Artificial Pearl Hand Chain Bracelet
like
Find Similar
Clear case for Samsung with heart-shaped makeup mirror and large pearl hand strap - Transparent Silver Heart Mirror With Pearl Chain / iPhone 12 Pro Max
+26
Luxury Transparent Phone Case With Heart Shaped Mirror Stand Rhinestone Edge And Large Faux Artificial Pearl Hand Chain Bracelet
-8%
$2.36
No MOQ
Women Fashion Synthetic Leather Belt Golden Square Chain Buckle Elegant Minimalist Decorative Waist Strap For Jeans Dress
Women Fashion Synthetic Leather Belt Golden Square Chain Buckle Elegant Minimalist Decorative Waist Strap For Jeans Dress
like
Find Similar
Elegant red leather belt for women featuring a gold chain-textured rectangular buckle - Red
Elegant brown leather belt for women with golden square chain buckle and white stitching - Khaki
Women's black leather belt featuring a vintage gold chain-link square metal buckle - Black
Elegant brown leather belt for women featuring a polished gold square chain buckle - Camel
Women Fashion Synthetic Leather Belt Golden Square Chain Buckle Elegant Minimalist Decorative Waist Strap For Jeans Dress
$1.44
No MOQ
Vintage Silver Iron Alloy Safety Pin Brooch For Women Men Heart Tassel Chain DIY Jeans Accessory Artificial Pearl Pin
Vintage Silver Iron Alloy Safety Pin Brooch For Women Men Heart Tassel Chain DIY Jeans Accessory Artificial Pearl Pin
like
Find Similar
Silver tassel safety pin with heart charms for denim jeans and stylish accessories - Silver White (0903)
Silver layered heart pendant chain accessory clipped on denim pants with high heels - Silver White With Artificial Pearl (0912)
Silver metal chain brooch with heart charms styled on jeans for a retro look - Vintage Silver With Artificial Pearl (0913)
Silver multi-layer heart chain brooch pin for jeans decoration in punk Y2K style - Silver With Decorative Rings (0914)
Vintage Silver Iron Alloy Safety Pin Brooch For Women Men Heart Tassel Chain DIY Jeans Accessory Artificial Pearl Pin
-10%
$0.92
No MOQ
Holographic Laser PVC Sunglasses Case Portable Gradient Glasses Pouch Bag With Metal Chain And Snap Button For Women
Holographic Laser PVC Sunglasses Case Portable Gradient Glasses Pouch Bag With Metal Chain And Snap Button For Women
like
Find Similar
Vintage retro sunglasses with a peach frame and a gradient holographic pouch - Nail Powder
Frosted orange sunglasses with colorful iridescent clip-on pouch and metal chain - Holographic Orange Yellow
Pink matte sunglasses and black leather case with silver metal chain accessory - Black and Gray
Portable matte pink sunglasses and clear tea frame glasses with golden chain - Clear
Holographic Laser PVC Sunglasses Case Portable Gradient Glasses Pouch Bag With Metal Chain And Snap Button For Women
-8%
$1.24
No MOQ
 · 
25 views
Western Cowboy Hat Wide Brim Suede Felt With Double Layer Artificial Pearl Chain And Teardrop Pendants Retro Party Bride Hat
Western Cowboy Hat Wide Brim Suede Felt With Double Layer Artificial Pearl Chain And Teardrop Pendants Retro Party Bride Hat
like
Find Similar
Khaki suede western cowboy hat featuring white pearl bands and hanging pearl pendants - Camel
Detail of beige felt cowboy hat featuring double-layer pearl chains and teardrop pendants - Beige
Detail view of brown felt cowboy hat featuring double-layer pearl band and waterdrop pendants - Khaki
Black felt western cowboy hat featuring elegant double-row pearl chain and teardrop pendants - Black
+7
Western Cowboy Hat Wide Brim Suede Felt With Double Layer Artificial Pearl Chain And Teardrop Pendants Retro Party Bride Hat
$4.58
No MOQ
Square Anti Blue Light Glasses Fashion Oversized PC Frame Metal Chain Temples Clear Lens Eyewear For Women
Square Anti Blue Light Glasses Fashion Oversized PC Frame Metal Chain Temples Clear Lens Eyewear For Women
like
Find Similar
Green striped square oversized glasses with gold chain temples and clear lenses - Green Striped Clear Lens
Square black and leopard print glasses frame with golden metal chain temples - Black and Leopard Clear Lens
Solid white oversized frames with gold metal chain temples and clear blue light lenses - Solid White Clear Lens
Square eyeglasses in yellow checkered pattern with gold chain metal temples - Yellow Checkered Clear Lens
+1
Square Anti Blue Light Glasses Fashion Oversized PC Frame Metal Chain Temples Clear Lens Eyewear For Women
-4%
$3.29
No MOQ
 · 
23 sold recently
Beaded Glasses Chain Artificial Pearl Mask Lanyard Anti-slip Adjustable Bow-knot Heart Rose Cute Eyewear Accessory For Women Girls
Beaded Glasses Chain Artificial Pearl Mask Lanyard Anti-slip Adjustable Bow-knot Heart Rose Cute Eyewear Accessory For Women Girls
like
Find Similar
Detail of beaded eyewear chain with white resin rose charms and lustrous faux pearls - White Camellia
Pink bow and pearl beaded eyeglass strap with non-slip silicone loops for women - Pink Rose Red Bow
Handmade beaded eyewear chain with white round beads and red matte heart charms - Red Heart
Elegant white pearl lanyard featuring double red velvet roses for masks and glasses - Red Rose
+5
Beaded Glasses Chain Artificial Pearl Mask Lanyard Anti-slip Adjustable Bow-knot Heart Rose Cute Eyewear Accessory For Women Girls
-4%
$1.37
Mix MOQ : 2
Fashion Glasses Chain Non-Slip Metal Alloy Star Artificial Pearl Bead Sunglasses Strap Anti-Lost Eyewear Accessory
Fashion Glasses Chain Non-Slip Metal Alloy Star Artificial Pearl Bead Sunglasses Strap Anti-Lost Eyewear Accessory
like
Find Similar
Detailed close-up of golden star-shaped metal chain links on a minimalist background - Star Twist Bar
Golden star-shaped link eyewear chain with silicone loops on a white prop pedestal - Star
Golden star eyeglass chain with trendy long link design and white anti-slip silicone loops - Spaced Stars
Detailed view of the delicate gold-tone star shaped link chain for glasses and masks - Star Pieces
+5
Fashion Glasses Chain Non-Slip Metal Alloy Star Artificial Pearl Bead Sunglasses Strap Anti-Lost Eyewear Accessory
$0.29-1.44
No MOQ
Free Shipping
Gradient Color Wool Felt Fedora Hat Wide Brim Jazz Style With Metal Chain Band Adjustable For Men Women
Gradient Color Wool Felt Fedora Hat Wide Brim Jazz Style With Metal Chain Band Adjustable For Men Women
like
Find Similar
Two-tone gradient wool felt fedora hat in beige and purple with gold chain band - M (56-58cm) / Purple
Camel felt wide brim fedora hat with gold metal chain and black leather woven decorative band - M (56-58cm) / Khaki
Detail of black and white gradient felt fedora hat featuring a gold chain decoration - M (56-58cm) / Black
Detail of white to rose red gradient fedora hat with gold metal chain accent - M (56-58cm) / Rose Red
+5
Gradient Color Wool Felt Fedora Hat Wide Brim Jazz Style With Metal Chain Band Adjustable For Men Women
$4.87
No MOQ
 · 
26 views
Colorful Acrylic Glasses Chain Candy Multi-color Eyewear Lanyard Anti-slip Lightweight Fashion Holder For Women
Colorful Acrylic Glasses Chain Candy Multi-color Eyewear Lanyard Anti-slip Lightweight Fashion Holder For Women
like
Find Similar
Colorful acrylic bead chain for glasses and masks with golden lobster clasps and silicone loops - GB128-Transparent Mixed Color
Colorful acrylic link chain with pearl finish and gold lobster clasp for eyewear - GB124-Pearly Mixed Color
Colorful oval acrylic link eyewear chain with gold metal clips on a white notebook - GB125-Candy Mixed Color
Colorful acrylic mixed-link chain for eyewear or bags with metal lobster clasps - GB127-Matte Mixed Color
+3
Colorful Acrylic Glasses Chain Candy Multi-color Eyewear Lanyard Anti-slip Lightweight Fashion Holder For Women
$2.59
No MOQ
 · 
12 sold recently
Minimalist Butterfly Star Heart Pendant Waist Chain Titanium Steel Fashion Non Fading Body Jewelry For Women
Minimalist Butterfly Star Heart Pendant Waist Chain Titanium Steel Fashion Non Fading Body Jewelry For Women
like
Find Similar
Gold stainless steel belly chain with multiple butterfly charms worn by a model - Gold Butterfly Waist Chain
Elegant gold butterfly charm necklace displayed on a minimalist stone pedestal base - Multi-Butterfly Necklace
Elegant gold butterfly charm bracelet with sparkling crystals on warm natural background - Butterfly Bracelet with Rhinestones
Minimalist Butterfly Star Heart Pendant Waist Chain Titanium Steel Fashion Non Fading Body Jewelry For Women
$2.16-3.15
No MOQ
Free Shipping
Vintage Viking Thor Hammer Mjolnir Pendant Necklace For Men Stainless Steel Wolf Head Byzantine Chain Jewelry Bottle Opener
Vintage Viking Thor Hammer Mjolnir Pendant Necklace For Men Stainless Steel Wolf Head Byzantine Chain Jewelry Bottle Opener
like
Find Similar
Close-up of Viking wolf head stainless steel bracelet with vintage gold and silver finish - Wolf Head Bracelet With Leather Pouch (Brown Bag)
Vintage Thor's Hammer Mjolnir beer bottle opener in stainless steel with Celtic engravings - Thor's Hammer Bottle Opener (Steel Color)
Vintage Viking Thor Hammer Mjolnir Pendant Necklace For Men Stainless Steel Wolf Head Byzantine Chain Jewelry Bottle Opener
-9%
$2.36-4.66
Mix MOQ : 2
Fashion Rimless Square Sunglasses Women UV400 Protection Oversized Metal Chain Hollow Temples Gradient PC Lens Luxury
Fashion Rimless Square Sunglasses Women UV400 Protection Oversized Metal Chain Hollow Temples Gradient PC Lens Luxury
like
Find Similar
Chic rimless square sunglasses with grey lenses and gold hollow chain temples - Gold Frame Black Grey
Stylish rimless square sunglasses with purple gradient lenses and gold chain temples - Gold Frame Gradient Grey Lens
Fashion rimless square sunglasses with pink gradient lenses and gold chain temples - Gold Frame Tea Pink Gradient Lens
Fashion rimless square sunglasses with blue-yellow gradient lenses and gold chain temples - Gold Frame Green Yellow Lens
+2
Fashion Rimless Square Sunglasses Women UV400 Protection Oversized Metal Chain Hollow Temples Gradient PC Lens Luxury
-4%
$3.83
No MOQ
 · 
13 views
Fedora Hat For Women And Men Solid Color Woolen Felt Wide Brim With Gold Metal Chain And Leather Band Retro Jazz Cap
Fedora Hat For Women And Men Solid Color Woolen Felt Wide Brim With Gold Metal Chain And Leather Band Retro Jazz Cap
like
Find Similar
Close-up of red wool fedora hat featuring a stylish gold and black braided chain trim - M (56-58cm) / Red (Black Chain Decor)
Close-up of bright yellow wool fedora hat with gold metal chain and black leather band - M (56-58cm) / Yellow (Black Chain Decor)
Detailed close-up of dark purple felt fedora hat featuring a stylish gold chain decoration - M (56-58cm) / Purple (Black Chain Decor)
Detailed view of brown fedora hat with elegant gold chain link and black ribbon band - M (56-58cm) / Khaki (Black Chain Decor)
+22
Fedora Hat For Women And Men Solid Color Woolen Felt Wide Brim With Gold Metal Chain And Leather Band Retro Jazz Cap
$3.98
Mix MOQ : 2
Tweed Newsboy Cap And Bucket Hat Vintage Plaid Pattern Metal Chain Decoration Flat Top Autumn Winter Warmth Elegant Women
Tweed Newsboy Cap And Bucket Hat Vintage Plaid Pattern Metal Chain Decoration Flat Top Autumn Winter Warmth Elegant Women
like
Find Similar
Chic black and gold tweed baker boy hat with decorative gold chain on white background - Adjustable / Plaid Newsboy Cap / Black
White tweed newsboy hat with gold chain detail and metallic buttons for women - Adjustable / Plaid Newsboy Cap / White
Classic black and white houndstooth tweed bucket hat for women with retro texture - Adjustable / Plaid Bucket Hat / Black
Chic black and white tweed plaid flat top beret hat with classic woven texture - Adjustable / Plaid Bucket Hat / White
+1
Tweed Newsboy Cap And Bucket Hat Vintage Plaid Pattern Metal Chain Decoration Flat Top Autumn Winter Warmth Elegant Women
-4%
$2.74
Mix MOQ : 3
 · 
19 views
British Style Women's Fedora Hat With Blue Chain Decoration Vintage Woolen Felt Wide Brim Jazz Hat For Autumn Winter Fashion Accessories
British Style Women's Fedora Hat With Blue Chain Decoration Vintage Woolen Felt Wide Brim Jazz Hat For Autumn Winter Fashion Accessories
like
Find Similar
Detail of fuchsia wool fedora hat featuring a chunky dark blue decorative chain link - Rose Red
Classic black wide brim fedora hat with a stylish blue chunky chain decoration for women - Black
Detail of burgundy wool fedora hat featuring a chunky navy blue plastic chain link band - Burgundy
Detail shot of navy blue wool fedora featuring a decorative thick chain and wide flat brim - Navy Blue
+17
British Style Women's Fedora Hat With Blue Chain Decoration Vintage Woolen Felt Wide Brim Jazz Hat For Autumn Winter Fashion Accessories
$3.75
No MOQ
Fedora Hat Wide Brim Wool Felt With Gold Metal Chain Vintage British Style Jazz Cap For Men Women Solid Color Elegant
Fedora Hat Wide Brim Wool Felt With Gold Metal Chain Vintage British Style Jazz Cap For Men Women Solid Color Elegant
like
Find Similar
Dark brown wide brim wool fedora hat with elegant gold chain decoration for style - One Size(58cm) / Coffee
Brown wool felt fedora hat featuring a stylish chunky gold chain band accessory - One Size(58cm) / Dark Camel
White wool fedora hat for men and women featuring a bold gold metal chain band - One Size(58cm) / White
Classic khaki wool fedora hat featuring a stylish chunky gold chain band for winter fashion - One Size(58cm) / Beige
+23
Fedora Hat Wide Brim Wool Felt With Gold Metal Chain Vintage British Style Jazz Cap For Men Women Solid Color Elegant
$4.29
No MOQ
Wide Brim Fedora Hat Woolen Felt With Thick Gold Metal Chain Decoration Western Jazz Style For Men Women
Wide Brim Fedora Hat Woolen Felt With Thick Gold Metal Chain Decoration Western Jazz Style For Men Women
like
Find Similar
Detail of pink wide brim fedora hat featuring a decorative thick gold acrylic chain - Adult (57-60cm) / Pink
Close-up of a red wide-brim fedora hat featuring a chunky gold chain accessory detail - Adult (57-60cm) / Red
Close-up of bright yellow fedora hat featuring a chunky rose gold acrylic chain decoration - Adult (57-60cm) / Yellow
Detail of dark purple wide brim fedora hat featuring a chunky gold acrylic chain decoration - Adult (57-60cm) / Purple
+23
Wide Brim Fedora Hat Woolen Felt With Thick Gold Metal Chain Decoration Western Jazz Style For Men Women
$4.18
Mix MOQ : 2
Women Straw Fedora Hat With Artificial Pearl Chain Sun Protection Breathable Beach Summer Elegant Panama Style
Women Straw Fedora Hat With Artificial Pearl Chain Sun Protection Breathable Beach Summer Elegant Panama Style
like
Find Similar
Detail of light brown straw hat featuring a wide flat brim and white faux pearl decorative band - M (56-58cm) / Khaki
Detailed close-up of white straw Panama hat with elegant pearl chain and woven texture - M (56-58cm) / White
Elegant grey straw fedora hat for women with decorative large white pearl chain band - M (56-58cm) / Gray
Detailed view of brown straw fedora with large white pearl chain embellishment - M (56-58cm) / Brown
+23
Women Straw Fedora Hat With Artificial Pearl Chain Sun Protection Breathable Beach Summer Elegant Panama Style
$5.48
No MOQ
Summer Wide Brim Fedora Straw Hat Silver Chain For Men Women Sun Protection Beach Outdoor Vacation
Summer Wide Brim Fedora Straw Hat Silver Chain For Men Women Sun Protection Beach Outdoor Vacation
like
Find Similar
Classic straw fedora hat with silver metal chain decor for sun protection and style - M (56-58cm) / Beige
Classic wide brim straw jazz hat in khaki with chunky silver chain decoration - M (56-58cm) / Khaki
Detail of navy straw fedora hat featuring a decorative silver metal chain band - M (56-58cm) / Navy Blue
Detail of white straw fedora hat featuring a stylish silver metal chain decoration - M (56-58cm) / Pure White
+23
Summer Wide Brim Fedora Straw Hat Silver Chain For Men Women Sun Protection Beach Outdoor Vacation
$4.32
No MOQ
Fedora Straw Hat With Bull Head Metal Decor Leather Band Acrylic Chain Wide Brim Sun Protection Summer Outdoor Beach Jazz Hat
Fedora Straw Hat With Bull Head Metal Decor Leather Band Acrylic Chain Wide Brim Sun Protection Summer Outdoor Beach Jazz Hat
like
Find Similar
Bohemian beige straw sun hat with leather band and vintage metal bull head accent - M (56-58cm) / Beige
Bohemian wide brim straw fedora with longhorn bull skull buckle and metallic accents - M (56-58cm) / Khaki
Navy blue bohemian straw jazz hat with vintage steer skull leather band detail - M (56-58cm) / Navy Blue
Detailed shot of white straw fedora featuring a leather band with bull skull ornament - M (56-58cm) / Pure White
+23
Fedora Straw Hat With Bull Head Metal Decor Leather Band Acrylic Chain Wide Brim Sun Protection Summer Outdoor Beach Jazz Hat
$4.32
No MOQ
Go to

More in bags

Women's Bags
Men's Bags

Explore more in purse chains

crossbodycoineveningstylewideshapedailyfacebeadedwoven
shoulderpartyroundunderarmstarsilvertasselhangingchain keychainmagnetic buckle

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access