Everful

Wholesale silk ribbon

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Silk Ribbon

Find the perfect pieces: satin scarves, fashion scarves, polyester scarves and more

All products in silk ribbon

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Christmas Plush Gift Box Ornaments Faux Fur Decorative Presents With Plaid Ribbon And Pine Cones For Holiday Home Decor
Christmas Plush Gift Box Ornaments Faux Fur Decorative Presents With Plaid Ribbon And Pine Cones For Holiday Home Decor
like
Find Similar
White plush Christmas gift box ornament with silver ribbon bow and dimensions 15x13cm - White
Brown faux fur Christmas gift box ornament with plaid ribbon and pine cone 15cm - Brown
Christmas Plush Gift Box Ornaments Faux Fur Decorative Presents With Plaid Ribbon And Pine Cones For Holiday Home Decor
$3.17
No MOQ
Large Christmas Tree Topper Bow Burlap Velvet Plaid Reindeer Pattern Festive Holiday Hanging Decoration Long Ribbon Streamers
Large Christmas Tree Topper Bow Burlap Velvet Plaid Reindeer Pattern Festive Holiday Hanging Decoration Long Ribbon Streamers
like
Find Similar
Large blue velvet Christmas tree topper bow with silver back and long elegant tails - W29*L130cm / Blue Silver Backing
Christmas tree topper large burlap bow with red reindeer print and black plaid ribbons - W30*L110cm / Red Black Plaid Elk Print
Large Christmas Tree Topper Bow Burlap Velvet Plaid Reindeer Pattern Festive Holiday Hanging Decoration Long Ribbon Streamers
$5.42
Mix MOQ : 10
Christmas Pine Cone Hanging Ornaments Natural Snow Tipped Pinecones Fabric Bow Ribbon Berries Rustic Holiday Tree Decor
Christmas Pine Cone Hanging Ornaments Natural Snow Tipped Pinecones Fabric Bow Ribbon Berries Rustic Holiday Tree Decor
like
Find Similar
Natural pine cone ornament with white snow, red polka dot bow and green pine needle decor - Red White Polka Dot Bow Pine Cone (Style B) / 10cm / 35g
Natural pine cone ornament with green snowflake bow and red berries for Christmas decor - Green Snowflake Print Bow Pine Cone (Style D) / 12cm / 41g
Christmas Pine Cone Hanging Ornaments Natural Snow Tipped Pinecones Fabric Bow Ribbon Berries Rustic Holiday Tree Decor
-4%
$1.81-2.14
No MOQ
Christmas Ornaments Painted Shatterproof Plastic Holiday Hanging Decorations Ribbon Gift Box Multicolor Hand Painted
Christmas Ornaments Painted Shatterproof Plastic Holiday Hanging Decorations Ribbon Gift Box Multicolor Hand Painted
like
Find Similar
Champagne gold Christmas ball ornaments set with glitter and matte finishes in a gift box - 6cm 20 Pieces/box / Gold
Mint green and white 6cm Christmas ball set in a transparent gift box with ribbon - 6cm 20 Pieces/box / Blue
Christmas Ornaments Painted Shatterproof Plastic Holiday Hanging Decorations Ribbon Gift Box Multicolor Hand Painted
$10.03
No MOQ
Christmas Hanging Garland Resin Santa Snowman Figurines Plaid Ribbon Bells Stars Snowflakes Holiday Door Wall Decor
Christmas Hanging Garland Resin Santa Snowman Figurines Plaid Ribbon Bells Stars Snowflakes Holiday Door Wall Decor
like
Find Similar
Christmas tree hanging resin ornament with Santa Claus stars and red checkered fabric - Santa Claus
Snowman and snowflake resin garland with red plaid rope for festive holiday decoration - Snowman
Christmas Hanging Garland Resin Santa Snowman Figurines Plaid Ribbon Bells Stars Snowflakes Holiday Door Wall Decor
-4%
$5.75
No MOQ
Christmas Antler Headband Hair Clips For Girls Kids Reindeer Horn Cloth Hair Accessories With Felt Flowers Ribbon Holiday Party
Christmas Antler Headband Hair Clips For Girls Kids Reindeer Horn Cloth Hair Accessories With Felt Flowers Ribbon Holiday Party
like
Find Similar
Christmas reindeer antler headband with pink bows and floral accents for girls - Pink Headband
Christmas reindeer antler hair clips with purple lavender flowers and ribbons - Purple Pair
Christmas Antler Headband Hair Clips For Girls Kids Reindeer Horn Cloth Hair Accessories With Felt Flowers Ribbon Holiday Party
$1.99-2.13
No MOQ
Free Shipping
Christmas Ball Hanging Ornaments Tinplate Candy Box With Ribbon Lanyard Cartoon Santa Claus Pattern Festival Decoration
Christmas Ball Hanging Ornaments Tinplate Candy Box With Ribbon Lanyard Cartoon Santa Claus Pattern Festival Decoration
like
Find Similar
Red Christmas tin ball candy box with Merry Christmas print and red hanging ribbon - Red Merry Christmas Lettering With Tree (C Style)
Christmas tin ball with Santa illustration and Merry Christmas text for tree decoration - Red Santa Claus Head Portrait (B Style)
Blue Christmas tin ball ornament with Santa and reindeer illustration and silk ribbon - Dark Blue Santa Claus And Reindeer (G Style)
Christmas Ball Hanging Ornaments Tinplate Candy Box With Ribbon Lanyard Cartoon Santa Claus Pattern Festival Decoration
-4%
$0.77
No MOQ
Christmas Ball Ornaments Plastic Printed Reindeer Snowflake Vintage Car Pattern Hanging Decoration With Ribbon For Festive Holiday
Christmas Ball Ornaments Plastic Printed Reindeer Snowflake Vintage Car Pattern Hanging Decoration With Ribbon For Festive Holiday
like
Find Similar
8cm Christmas ball ornament with bells pattern, red ribbon hanger, weighing 11g - Bells and Green Leaves
Red Christmas ball ornament with vintage car pattern and green satin ribbon bow - Red with White Car
Red 8cm Christmas ball ornament with Merry Christmas text and snowman graphic - Red Base Christmas Tree
Christmas Ball Ornaments Plastic Printed Reindeer Snowflake Vintage Car Pattern Hanging Decoration With Ribbon For Festive Holiday
-5%
$1.01
No MOQ
Artificial Christmas Wreath PVC Pine Needle Warm LED Lights Baubles Berries Ribbon Bow Front Door Window Holiday Decor
Artificial Christmas Wreath PVC Pine Needle Warm LED Lights Baubles Berries Ribbon Bow Front Door Window Holiday Decor
like
Find Similar
Classic 40cm Christmas wreath with red berries, pine needles and festive ornaments - Gold Red 40cm with Lights
Green 50cm Christmas wreath with red berries, decorative balls and a ribbon bow - Gold Red 50cm with Lights
50cm Christmas wreath with gold and bronze ornaments on green pine needles - Gold Coffee 50cm with Lights
Artificial Christmas Wreath PVC Pine Needle Warm LED Lights Baubles Berries Ribbon Bow Front Door Window Holiday Decor
$22.48-25.36
No MOQ
Christmas Wine Bottle Covers Fabric Santa Snowman Reindeer Festive Holiday Table Decoration Warm Wishes Ribbon
Christmas Wine Bottle Covers Fabric Santa Snowman Reindeer Festive Holiday Table Decoration Warm Wishes Ribbon
like
Find Similar
Christmas snowman wine bottle cover with Warm Wishes sign for festive home table decor - Snowman
Festive Christmas wine bottle cover with Santa Claus print and Warm Wishes tag - Santa Claus
Detailed view of red reindeer wine bottle cover with gold ribbon on wooden table - Elk Style
Christmas Wine Bottle Covers Fabric Santa Snowman Reindeer Festive Holiday Table Decoration Warm Wishes Ribbon
-4%
$0.47
Mix MOQ : 2
 · 
18 sold recently
Elegant Rose Floral Laser Cut Wedding Invitation Cards With Glitter Finish And Ribbon Bow Greeting Cards For Ceremony
Elegant Rose Floral Laser Cut Wedding Invitation Cards With Glitter Finish And Ribbon Bow Greeting Cards For Ceremony
like
Find Similar
Silver glitter laser-cut floral wedding invitation with white bow and rose inner card - Silver
Detailed close-up of champagne gold glitter wedding invitation with laser-cut rose patterns - Cyan Gold
Detail of rose gold glitter laser cut rose invitation with an ivory silk ribbon bow - Rose Gold
Detail of laser-cut gold glitter wedding invitation with cream satin bow and rose liner - Gold Yellow
+1
Elegant Rose Floral Laser Cut Wedding Invitation Cards With Glitter Finish And Ribbon Bow Greeting Cards For Ceremony
$0.72
Mix MOQ : 50
Silk Flower Green Leaf Wreath Headband With Lace Bow Forest Style Bridal Floral Hair Accessories For Wedding Party Photography
Silk Flower Green Leaf Wreath Headband With Lace Bow Forest Style Bridal Floral Hair Accessories For Wedding Party Photography
like
Find Similar
Floral daisy leaf garland headband with white lace ribbons for outdoor photo props - Green
Silk Flower Green Leaf Wreath Headband With Lace Bow Forest Style Bridal Floral Hair Accessories For Wedding Party Photography
-5%
$3.56
No MOQ
Free Shipping
Christmas Elf Bow Hair Clips For Girls Grosgrain Ribbon Glitter Elf Boots Santa Hat Xmas Party Hair Accessory For Kids
Christmas Elf Bow Hair Clips For Girls Grosgrain Ribbon Glitter Elf Boots Santa Hat Xmas Party Hair Accessory For Kids
like
Find Similar
Detailed view of Christmas bow hair clip with festive glitter boots and Santa hat accents - White (MC6647)
Detail of festive elf hair bow with green ribbon and sparkling red glitter boots - Green (MC6648)
Detail of Christmas elf bow hair clip with red ribbon and green glitter hat and legs - Red (MC6649)
Christmas elf boot hair clips for girls with red and green glitter bows and stripes - Red Green and White (MS6650)
Christmas Elf Bow Hair Clips For Girls Grosgrain Ribbon Glitter Elf Boots Santa Hat Xmas Party Hair Accessory For Kids
$1.10-3.29
No MOQ
Handmade Fabric Flower Brooch Wrist Corsage White Camellia With Imitation Artificial Pearl Ribbon For Wedding Party Bridesmaid Accessory
Handmade Fabric Flower Brooch Wrist Corsage White Camellia With Imitation Artificial Pearl Ribbon For Wedding Party Bridesmaid Accessory
like
Find Similar
Detailed view of white fabric bridal flower with pearls and ribbon, measuring 13x9cm - Camellia Brooch (BRS-J410)
Macro detail of bridal corsage with dimensions 13.5x8.5cm and 9g weight specifications - Layered Camellia Brooch (BRS-J411)
Detailed view of white bridal wrist corsage with faux pearls and elastic band dimensions - Camellia Wrist Corsage (BS-J5545)
Detailed view of white fabric flower wrist corsage with pearls and green leaves for weddings - Layered Camellia Wrist Corsage (BS-J5546)
Handmade Fabric Flower Brooch Wrist Corsage White Camellia With Imitation Artificial Pearl Ribbon For Wedding Party Bridesmaid Accessory
-5%
$1.24-1.49
Mix MOQ : 3
Free Shipping
Children Christmas Bow Hair Clips Multi-Layer Mesh Grosgrain Ribbon Polka Dot Red Green White Festive Hair Accessories Girls
Children Christmas Bow Hair Clips Multi-Layer Mesh Grosgrain Ribbon Polka Dot Red Green White Festive Hair Accessories Girls
like
Find Similar
Detailed view of large Christmas lace bow clip with red, green and white layered ribbons - Red Dots Green Mesh
Detailed view of layered Christmas bow clip with red polka dots and green lace ribbons - Red Dots White Mesh
Detail of layered green and white lace bow hair clip with polka dot center ribbon - Green Dots Green Mesh
Close-up of layered Christmas organza bow with red and green ribbons and polka dot detail - Green Dots Red Mesh
Children Christmas Bow Hair Clips Multi-Layer Mesh Grosgrain Ribbon Polka Dot Red Green White Festive Hair Accessories Girls
-4%
$0.80
No MOQ
Thanksgiving Turkey Bow Hair Clips For Kids Grosgrain Ribbon Polka Dot Autumn Festival Girls Hair Accessories Accessories
Thanksgiving Turkey Bow Hair Clips For Kids Grosgrain Ribbon Polka Dot Autumn Festival Girls Hair Accessories Accessories
like
Find Similar
Detail of Thanksgiving turkey hair clips with orange polka dot ribbons and resin decor - Orange And Black Polka Dot Style
Set of two Thanksgiving turkey pumpkin hair clips with orange and brown layered ribbons - Orange And Brown Swallowtail Style
Thanksgiving turkey hair bows set with orange and blue ribbon for autumn kids accessories - Orange And Blue Polka Dot Style
Close-up of Thanksgiving turkey hair bows with orange ribbon on a rustic autumn tray - Orange And Black Plaid Style
Thanksgiving Turkey Bow Hair Clips For Kids Grosgrain Ribbon Polka Dot Autumn Festival Girls Hair Accessories Accessories
$1.04
Mix MOQ : 10
American Flag Patriotic Wired Ribbon For Independence Day July 4th DIY Gift Wrap Burlap Truck Print Party Decoration Craft Ribbon
American Flag Patriotic Wired Ribbon For Independence Day July 4th DIY Gift Wrap Burlap Truck Print Party Decoration Craft Ribbon
like
Find Similar
Independence Day wired ribbon with vintage truck and American flag star print design - White Vintage Truck Style
Detail of American flag ribbons with stars and stripes for Independence Day decor - Blue Star
Patriotic USA Independence Day ribbon with stars and stripes for festive party decorations - Classic American Flag Style
Independence Day faux linen ribbon with vintage red truck and American flag pattern - Khaki Faux Burlap Truck Style
American Flag Patriotic Wired Ribbon For Independence Day July 4th DIY Gift Wrap Burlap Truck Print Party Decoration Craft Ribbon
-4%
$2.96
Mix MOQ : 2
2m Halloween Tinsel Garland Metallic Foil Ribbon With Pumpkin Bat Skull Charms For Spooky Party Yard Home Decoration Supplies
2m Halloween Tinsel Garland Metallic Foil Ribbon With Pumpkin Bat Skull Charms For Spooky Party Yard Home Decoration Supplies
like
Find Similar
2M Halloween orange and black tinsel garland with pumpkin charms for party decoration - 2M Orange Black Pumpkin Tinsel
2M Halloween black and silver tinsel garland with 40g weight for festive home decoration - 2M Silver Black Skeleton Tinsel
2m Halloween purple and black tinsel garland with bat cutouts for party decor - 2M Purple Black Bat Tinsel
2M Halloween garland in purple and black tinsel for spooky party yard decorations - 2M Rose Red Black Bat Tinsel
2m Halloween Tinsel Garland Metallic Foil Ribbon With Pumpkin Bat Skull Charms For Spooky Party Yard Home Decoration Supplies
-3%
$0.50
Mix MOQ : 2
Christmas Velvet Bow Hair Clip Streamer Festive Hair Tie With Gold Letters Red Green Ribbon Hair Accessories For Women Party
Christmas Velvet Bow Hair Clip Streamer Festive Hair Tie With Gold Letters Red Green Ribbon Hair Accessories For Women Party
like
Find Similar
Close-up of dark green velvet bow clip with gold Merry Christmas print and star pattern - Hair Clip Style / Christmas Green
Detail of Christmas green velvet bow with golden Merry Christmas text and elastic hair tie - Elastic Band Style / Green
Close-up of red velvet Christmas bow hair clip with gold Merry Christmas print and gemstone - Red Gemstone Hair Clip / Red
Detail of green velvet Christmas bow clip with emerald gem and gold Merry Christmas text - Green Gemstone Hair Clip / Green
+2
Christmas Velvet Bow Hair Clip Streamer Festive Hair Tie With Gold Letters Red Green Ribbon Hair Accessories For Women Party
$0.95-1.04
Mix MOQ : 2
Christmas Wreath Garland With Warm LED Lights Artificial Pine Needles Red Berries Pine Cones Large Ribbon Bow Holiday Staircase Decoration
Christmas Wreath Garland With Warm LED Lights Artificial Pine Needles Red Berries Pine Cones Large Ribbon Bow Holiday Staircase Decoration
like
Find Similar
Christmas wreath with 45cm diameter featuring red berries, pine cones and LED lights - 45cm / K1-24 Red Bow Style (45CM)
45cm LED Christmas staircase swag with red berries, pine cones and gold-edged ribbon bows - 45cm / K3-39 Gold Ribbon Style (45CM)
Christmas Wreath Garland With Warm LED Lights Artificial Pine Needles Red Berries Pine Cones Large Ribbon Bow Holiday Staircase Decoration
$6.92
No MOQ
 · 
17 views
Patriotic Ribbon Red Truck Flag Star Print Wired Edge Ribbon For Independence Day July 4th Party Decor DIY Gift Wrapping
Patriotic Ribbon Red Truck Flag Star Print Wired Edge Ribbon For Independence Day July 4th Party Decor DIY Gift Wrapping
like
Find Similar
3m Patriotic American Independence Day ribbon with red truck and flag prints - Khaki Truck Ribbon
Independence Day patriotic ribbon with vintage red truck and American flag pattern - White Truck Ribbon
Detail of spiral polyester ribbons featuring American flag stars and stripes patterns - Five-Pointed Star Ribbon
3m American Independence Day decorative ribbon with stars and stripes flag pattern - US Flag Ribbon
Patriotic Ribbon Red Truck Flag Star Print Wired Edge Ribbon For Independence Day July 4th Party Decor DIY Gift Wrapping
$0.98
Mix MOQ : 2
Wipe Your Paws Dog Wreath Door Hanging Decor For Home Cute Pet Puppy Plastic Sign Burlap Ribbon Garland With Paw Prints
Wipe Your Paws Dog Wreath Door Hanging Decor For Home Cute Pet Puppy Plastic Sign Burlap Ribbon Garland With Paw Prints
like
Find Similar
1 option
Wipe Your Paws Dog Wreath Door Hanging Decor For Home Cute Pet Puppy Plastic Sign Burlap Ribbon Garland With Paw Prints
$10.66
Mix MOQ : 2
European Laser Cut Birdcage Candy Box Pearlescent Paper Hollow Wedding Favor Box Ribbon Chocolate Gift Boxes Party Decoration
European Laser Cut Birdcage Candy Box Pearlescent Paper Hollow Wedding Favor Box Ribbon Chocolate Gift Boxes Party Decoration
like
Find Similar
White laser-cut birdcage candy box with pearl paper finish and elegant white ribbon - White
Laser cut birdcage wedding favor box in pink pearl paper with ribbon bow decoration - Pink
Laser-cut white birdcage candy box with rustic kraft paper and gold organza ribbon - Beige Gold
Elegant laser cut purple candy box with hollow bird pattern and silk ribbon tie - Dark Purple
+3
European Laser Cut Birdcage Candy Box Pearlescent Paper Hollow Wedding Favor Box Ribbon Chocolate Gift Boxes Party Decoration
$0.13
Mix MOQ : 50
Christmas Bow Ornaments With Metal Bells Holly Leaves Fabric Ribbon For Christmas Tree Wreath Decoration Festive Accessories
Christmas Bow Ornaments With Metal Bells Holly Leaves Fabric Ribbon For Christmas Tree Wreath Decoration Festive Accessories
like
Find Similar
Festive red and green plaid Christmas bow with golden leaves and two small bells - Style 2-Red Green Plaid Bow With Bells
Christmas bow decoration with red and green ribbons and small golden bells for wreaths - Style 1-Red Green Solid Ribbon Bow With Bells
Detailed view of red and green plaid Christmas bow with golden bells and holly leaves - Style 3-Stitched Plaid Bow With Red Berries and Bells
Christmas Bow Ornaments With Metal Bells Holly Leaves Fabric Ribbon For Christmas Tree Wreath Decoration Festive Accessories
$0.10-0.12
Mix MOQ : 10
Christmas Window Clings Static Cling PVC Green Ribbon Christmas Tree Decals For Glass Window Shop Home Holiday Decoration
Christmas Window Clings Static Cling PVC Green Ribbon Christmas Tree Decals For Glass Window Shop Home Holiday Decoration
like
Find Similar
Green ribbon Christmas tree static window sticker for festive store glass display - Small Size【40*50CM】
+4
Christmas Window Clings Static Cling PVC Green Ribbon Christmas Tree Decals For Glass Window Shop Home Holiday Decoration
$3.15-28.38
No MOQ
Thanksgiving Autumn Harvest Linen Ribbon Bow Pumpkin Maple Leaf Decorative Wreath Bow For Farmhouse Home Halloween Decoration
Thanksgiving Autumn Harvest Linen Ribbon Bow Pumpkin Maple Leaf Decorative Wreath Bow For Farmhouse Home Halloween Decoration
like
Find Similar
Plaid Thanksgiving bow with maple leaf print, dimensions 48x24cm and weight 29.1g - 9-Ear Maple Leaf Plaid Style
Large maple leaf harvest bow for Thanksgiving home decor, 18.31 inch height and 30.3g weight - 9-Ear Maple Leaf Style
Large Thanksgiving buffalo plaid bow with pumpkin pattern for harvest home decoration - 9-Ear Pumpkin Black & White Plaid
Detailed size chart of a pumpkin truck bow decoration, measuring 16.73 by 9.45 inches - 9-Ear Vintage Truck Pumpkin Style
+1
Thanksgiving Autumn Harvest Linen Ribbon Bow Pumpkin Maple Leaf Decorative Wreath Bow For Farmhouse Home Halloween Decoration
-4%
$1.56
Mix MOQ : 2
European Style Laser Cut Rose Wedding Invitation Card With Envelope Ribbon Hollowed Out Flower Greeting Card For Marriage
European Style Laser Cut Rose Wedding Invitation Card With Envelope Ribbon Hollowed Out Flower Greeting Card For Marriage
like
Find Similar
Macro view of laser-cut rose patterns on white wedding invitation with satin ribbon bow - White
European burgundy laser cut wedding invitation with rose pattern and red satin ribbon bow - Dark Red
Navy blue pearlescent paper wedding invitation with laser cut rose pattern and ribbon - Phantom Blue
Detail of laser-cut rose invitation with white card and beige satin ribbon bow - Champagne Gold
+1
European Style Laser Cut Rose Wedding Invitation Card With Envelope Ribbon Hollowed Out Flower Greeting Card For Marriage
$0.65
Mix MOQ : 50
Sunflower Bear Figurine Handmade Artificial Flower Teddy Bear With Ribbon Bow For Thanksgiving Valentine Birthday Home Office Decor Creative Gift
Sunflower Bear Figurine Handmade Artificial Flower Teddy Bear With Ribbon Bow For Thanksgiving Valentine Birthday Home Office Decor Creative Gift
like
Find Similar
Sunflower bear figurine with yellow petals and a white ribbon bow for garden decor - Sunflower Bear Figurine
Sunflower Bear Figurine Handmade Artificial Flower Teddy Bear With Ribbon Bow For Thanksgiving Valentine Birthday Home Office Decor Creative Gift
$8.65
No MOQ
Christmas Dangle Earrings Festive Alloy Metal Bell Green Ribbon Bow Star Charm Red Green Silver Holiday Party Jewelry For Women
Christmas Dangle Earrings Festive Alloy Metal Bell Green Ribbon Bow Star Charm Red Green Silver Holiday Party Jewelry For Women
like
Find Similar
Detail of Christmas earrings featuring red bells, green bows, and silver stars charms - Christmas Bells Style
Christmas Dangle Earrings Festive Alloy Metal Bell Green Ribbon Bow Star Charm Red Green Silver Holiday Party Jewelry For Women
$1.31
No MOQ
Free Shipping
Artificial Christmas Wreath With Pine Needles Pine Cones Wood Reindeer And Red Balls Ribbon Bow Door Wall Hanging Decor
Artificial Christmas Wreath With Pine Needles Pine Cones Wood Reindeer And Red Balls Ribbon Bow Door Wall Hanging Decor
like
Find Similar
Christmas wreath with green pine needles and red ornaments measuring 40cm and 572g weight - Red Green Pine Needle Wood Sign Deer Style
Artificial Christmas Wreath With Pine Needles Pine Cones Wood Reindeer And Red Balls Ribbon Bow Door Wall Hanging Decor
$8.93
No MOQ
Handmade Seaglass Style Christmas Tree Ornament Stacked Acrylic Hanging Sea Glass Decoration With Star And Satin Ribbon
Handmade Seaglass Style Christmas Tree Ornament Stacked Acrylic Hanging Sea Glass Decoration With Star And Satin Ribbon
like
Find Similar
Green ocean-inspired resin Christmas tree ornament with starfish hook, 6.1cm by 3.2cm - Green Ocean Ornament / Green
Seaglass Christmas tree ornament with starfish topper and hanging ribbon 6.2cm height - White Ocean Ornament / White
NewHandmade Seaglass Style Christmas Tree Ornament Stacked Acrylic Hanging Sea Glass Decoration With Star And Satin Ribbon
$2.16
Mix MOQ : 2
Free Shipping
Halloween Witch Hat Headband With Lace Sequins Feather Ribbon Rose Glitter Costume Masquerade Party Hair Accessory For Women
Halloween Witch Hat Headband With Lace Sequins Feather Ribbon Rose Glitter Costume Masquerade Party Hair Accessory For Women
like
Find Similar
Purple sequined witch hat headband with black lace and feathers for Halloween - One Size / Purple
Halloween black sequin witch hat headband with delicate lace and feathers on white background - One Size / Black
Detail of red Halloween witch hat headband with sequins, black lace, and feather accents - One Size / Red
Detailed view of Halloween witch hat headband with sequins, lace, and orange feather - One Size / Orange
Halloween Witch Hat Headband With Lace Sequins Feather Ribbon Rose Glitter Costume Masquerade Party Hair Accessory For Women
$1.21
Mix MOQ : 2
Halloween Wreath Hanging Decoration Tinsel Ribbon Bow Door Ornament Ghost Pumpkin Bat Design Plastic Garland Home Party Decor
Halloween Wreath Hanging Decoration Tinsel Ribbon Bow Door Ornament Ghost Pumpkin Bat Design Plastic Garland Home Party Decor
like
Find Similar
Purple and black sequin Halloween wreath with pumpkin bow and bat silhouette, 42cm height - Purple Bat Purple Black Ribbon Wreath
Halloween wreath with purple green tinsel and orange spider web bow 48cm door decor - Green Ghost Purple Black Ribbon Wreath
Purple Halloween wreath with orange spider bow and black ghost charms for door hanging - Silver Ghost Purple Black Ribbon Wreath
Halloween wreath with orange pumpkins and purple ghost bow on black tinsel base - Orange Pumpkin Orange Black Ribbon Wreath
Halloween Wreath Hanging Decoration Tinsel Ribbon Bow Door Ornament Ghost Pumpkin Bat Design Plastic Garland Home Party Decor
-3%
$5.01
Mix MOQ : 2
Elegant Laser Cut Wedding Invitation Cards Hollow Lace Floral Pattern Ribbon Bow Kraft Paper Greeting Invitations
Elegant Laser Cut Wedding Invitation Cards Hollow Lace Floral Pattern Ribbon Bow Kraft Paper Greeting Invitations
like
Find Similar
Elegant laser-cut white lace wedding invitation with a satin bow and floral inner card - White
Elegant ivory laser cut lace wedding invitation with silk bow and custom internal card - Ivory
Detail of laser-cut butterfly wedding invitation with rustic twine and floral kraft insert - White (With Kraft Paper And Hemp Rope)
Elegant laser-cut white lace wedding invitation with kraft paper and silk ribbon bow - White (With Kraft Paper And Ribbon Bow)
Elegant Laser Cut Wedding Invitation Cards Hollow Lace Floral Pattern Ribbon Bow Kraft Paper Greeting Invitations
-4%
$0.41
Mix MOQ : 50
Patriotic USA Flag Red Truck Star Printed Ribbon For Independence Day Party Decorative Polyester Fabric Ribbon For DIY Craft
Patriotic USA Flag Red Truck Star Printed Ribbon For Independence Day Party Decorative Polyester Fabric Ribbon For DIY Craft
like
Find Similar
Independence Day patriotic ribbon with vintage red truck and American flag pattern - White Truck Ribbon
Detail of spiral polyester ribbons featuring American flag stars and stripes patterns - Five-Pointed Star Ribbon
3m American Independence Day decorative ribbon with stars and stripes flag pattern - US Flag Ribbon
Independence Day ribbon with vintage red truck and American flag patterns on white fabric - Khaki Truck Ribbon
Patriotic USA Flag Red Truck Star Printed Ribbon For Independence Day Party Decorative Polyester Fabric Ribbon For DIY Craft
-4%
$3.33
Mix MOQ : 2
Christmas Wine Bottle Cover Cloth Felt Sequin Embroidery Santa Snowman Reindeer Ribbon Festive Party Dining Table Decor
Christmas Wine Bottle Cover Cloth Felt Sequin Embroidery Santa Snowman Reindeer Ribbon Festive Party Dining Table Decor
like
Find Similar
Detail of Christmas wine bottle cover with Santa Claus sequin embroidery and ribbon - Santa Claus
Detail of Christmas wine bottle cover with snowman embroidery and green sequins - Snowman
Detail of red Christmas wine bottle cover with reindeer motif and green sequins - Deer
NewChristmas Wine Bottle Cover Cloth Felt Sequin Embroidery Santa Snowman Reindeer Ribbon Festive Party Dining Table Decor
-4%
$1.07
No MOQ
Easter Wooden Rainbow Hanging Ornaments Rabbit Gnome Egg Macaron Color Gingham Ribbon Wood Beads Holiday Decoration
Easter Wooden Rainbow Hanging Ornaments Rabbit Gnome Egg Macaron Color Gingham Ribbon Wood Beads Holiday Decoration
like
Find Similar
Weight display of 22.5g for wooden rainbow and bunny Easter hanging ornaments - Rabbit Style
Detailed view of wooden gnome rainbow pendant on a scale weighing 24.0 grams - Gnome Style
Close-up of rainbow wooden Easter ornament weighing 23.6g on a digital scale - Egg Style
Easter Wooden Rainbow Hanging Ornaments Rabbit Gnome Egg Macaron Color Gingham Ribbon Wood Beads Holiday Decoration
$1.41
No MOQ
Christmas Hanging Ornament Multi Layer Ribbon Bow Knot With Alloy Bell Plastic Crystal Pendant Love Is Eternal Print
Christmas Hanging Ornament Multi Layer Ribbon Bow Knot With Alloy Bell Plastic Crystal Pendant Love Is Eternal Print
like
Find Similar
Transparent acrylic bell pendant with brown bow and ribbon for Christmas tree decor - Coffee Bell Pendant
Green ribbon bow pendant with gold bell and deer charm for Christmas tree decoration - Green Bell Pendant
Christmas tree ornament with red bow, gold bells and faceted red crystal ball pendant - Red Bell Pendant
Christmas Hanging Ornament Multi Layer Ribbon Bow Knot With Alloy Bell Plastic Crystal Pendant Love Is Eternal Print
$7.06
No MOQ
Free Shipping
Christmas Wine Bottle Covers Felt Santa Reindeer Tree Patterns With Bow Ribbon Festive Holiday Table Decor Gifts
Christmas Wine Bottle Covers Felt Santa Reindeer Tree Patterns With Bow Ribbon Festive Holiday Table Decor Gifts
like
Find Similar
Christmas red wine bottle cover with Santa Claus design and green bow accent - Santa Claus
Christmas wine bottle cover with a green bow and festive felt tree pattern - Christmas Tree
Christmas wine bottle cover featuring red felt fabric with a cute reindeer and green bow - Elk
Christmas Wine Bottle Covers Felt Santa Reindeer Tree Patterns With Bow Ribbon Festive Holiday Table Decor Gifts
$1.30
No MOQ
Artificial Orchid Wedding Wine Glass Decoration Elegant Satin Flower Champagne Cup Decor Ribbon Faux Artificial Pearl Banquet
Artificial Orchid Wedding Wine Glass Decoration Elegant Satin Flower Champagne Cup Decor Ribbon Faux Artificial Pearl Banquet
like
Find Similar
White orchid artificial flower decor for wine glasses with green leaves and pearls - White
Wedding glass decoration with yellow orchid, blue accents and white ribbon pearl pendant - Yellow
Pink orchid wedding wine glass flower decoration with silk ribbon and pearls - Pink
Artificial Orchid Wedding Wine Glass Decoration Elegant Satin Flower Champagne Cup Decor Ribbon Faux Artificial Pearl Banquet
$1.99
Mix MOQ : 2
Free Shipping
Christmas Half Finger Gloves And Plush Hat Festive Ribbon Bow Bells Acrylic Knitted Warm Winter Accessory For Women
Christmas Half Finger Gloves And Plush Hat Festive Ribbon Bow Bells Acrylic Knitted Warm Winter Accessory For Women
like
Find Similar
Christmas red plush beanie hat and fingerless knit gloves with bows and bells set - One Size / Wine Red Set (Gloves And Headband Hat)
Plush wine red winter faux fur headband with soft fabric lining for cold weather - One Size / Wine Red Headband Hat
Detail of red knitted fingerless gloves with bow, golden bells and faux fur trim - One Size / Wine Red Gloves
Christmas Half Finger Gloves And Plush Hat Festive Ribbon Bow Bells Acrylic Knitted Warm Winter Accessory For Women
$1.99-5.71
No MOQ
Christmas Golden Iron Bell Hanging Ornaments Red Velvet Ribbon Bow Star Hollow For Home Door Window Decor
Christmas Golden Iron Bell Hanging Ornaments Red Velvet Ribbon Bow Star Hollow For Home Door Window Decor
like
Find Similar
Christmas hanging decor featuring a red velvet bow and six golden star bells on ribbons - Red Wind Chime Style A (46g)
Christmas red velvet ribbon pendant with six golden bells hanging for tree decor - Red Wind Chime Style B (32g)
Christmas hanging decoration with red velvet bow and seven golden bells, 42cm long - Red Wind Chime Style C (22g)
Christmas Golden Iron Bell Hanging Ornaments Red Velvet Ribbon Bow Star Hollow For Home Door Window Decor
$3.69-4.27
No MOQ
Free Shipping
Christmas Hanging Bell Ornament With Natural Pine Cone Artificial Pine Needle Metal Gold Bell And Plaid Ribbon Bow
Christmas Hanging Bell Ornament With Natural Pine Cone Artificial Pine Needle Metal Gold Bell And Plaid Ribbon Bow
like
Find Similar
Christmas hanging ornament with golden bell pine cones and red heart embroidery ribbon - Heart Bow Gold Bell Pendant
Golden bell Christmas ornament with red plaid bow, pine cones and green needles decoration - Red and White Plaid Bow Gold Bell Pendant
Christmas hanging ornament with golden bell, pine cones, and red plaid bow decoration - Red and Green Plaid Bow Gold Bell Pendant
Christmas Hanging Bell Ornament With Natural Pine Cone Artificial Pine Needle Metal Gold Bell And Plaid Ribbon Bow
$2.31
Mix MOQ : 10
Christmas Hanging Ornaments Plush Tree Bell Shape With Metal Bell Bow Ribbon For Home Party Festive Holiday Decor
Christmas Hanging Ornaments Plush Tree Bell Shape With Metal Bell Bow Ribbon For Home Party Festive Holiday Decor
like
Find Similar
Christmas tree ornament with red plush bell, golden bell charm and Merry Christmas tag - Style with Bells / Red
Christmas tree hanging ornament with plush fabric, golden bell and festive bow - Christmas Tree / Khaki
White faux fur Christmas tree ornament with gold sequin bow and festive bell - Christmas Tree / White
Christmas Hanging Ornaments Plush Tree Bell Shape With Metal Bell Bow Ribbon For Home Party Festive Holiday Decor
$1.38
No MOQ
Free Shipping
Christmas Tree Hanging Ornaments Bells With Glitter Natural Pine Cones Pine Needles And Ribbon Bows Holiday Home Decor
Christmas Tree Hanging Ornaments Bells With Glitter Natural Pine Cones Pine Needles And Ribbon Bows Holiday Home Decor
like
Find Similar
Three-piece set of gold glitter Christmas bells with pine cones and burlap hanging rope - Gold 3-Piece Set
Three-piece red glitter Christmas bell ornaments with pine cones and white bows - Red 3-Piece Set
Set of 3 white glitter Christmas bells with pine cones and burlap bows for hanging - Glitter White 3-Piece Set
Christmas Tree Hanging Ornaments Bells With Glitter Natural Pine Cones Pine Needles And Ribbon Bows Holiday Home Decor
$3.46
Mix MOQ : 10
Christmas Tree Cake Topper With LED Light Ribbon Bows Artificial Pearls Merry Christmas Sign Handmade Festive Party Decoration
Christmas Tree Cake Topper With LED Light Ribbon Bows Artificial Pearls Merry Christmas Sign Handmade Festive Party Decoration
like
Find Similar
Christmas tree cake decor with pink bows, pearls, and glowing lights on black background - Ballet Style Christmas Tree with Light-Pink & White Bow
White Christmas tree cake topper with red velvet bows and warm LED fairy lights - Premium Yellow Rhinestone Bow Christmas Tree Decoration-with Light
Macro shot of white tiered fabric Christmas tree with pearls and red velvet bows decoration - Rhinestone Bow Christmas Tree Decoration-with Light-Red & White Bow
Christmas Tree Cake Topper With LED Light Ribbon Bows Artificial Pearls Merry Christmas Sign Handmade Festive Party Decoration
$3.89-4.32
Mix MOQ : 2
Christmas Hanging Ornaments Painted Wood Santa Snowman Reindeer Holiday Tree Decor Plaid Ribbon Twine Rustic Vintage
Christmas Hanging Ornaments Painted Wood Santa Snowman Reindeer Holiday Tree Decor Plaid Ribbon Twine Rustic Vintage
like
Find Similar
Wooden Santa Claus JOY hanging ornament with red plaid string, 5-inch Christmas decor - Square Santa Painted Wood Tag
Round wooden snowman Christmas tree ornament with a classic red and black plaid lanyard - Round Snowman Painted Wood Tag
12cm wooden Christmas ornament with white reindeer family and jute rope on tree - Round Reindeer Painted Wood Tag
Christmas Hanging Ornaments Painted Wood Santa Snowman Reindeer Holiday Tree Decor Plaid Ribbon Twine Rustic Vintage
$0.63-0.75
No MOQ
LED Ribbon String Lights Christmas Tree Decorations Double Layer Bronze Print Mesh Star Musical Note Battery Operated
LED Ribbon String Lights Christmas Tree Decorations Double Layer Bronze Print Mesh Star Musical Note Battery Operated
like
Find Similar
Red 5M LED mesh ribbon with golden star patterns for festive Christmas decoration - Battery Box Flashing String / 5 Meters / Red
5M blue double-layer LED ribbon light with silver moon and star bronzing print - Battery Box Flashing String / 5 Meters / Blue
Purple double-layer LED ribbon light string with silver star patterns, 5m long and 5cm wide - Battery Box Flashing String / 5 Meters / Pink
LED Ribbon String Lights Christmas Tree Decorations Double Layer Bronze Print Mesh Star Musical Note Battery Operated
$2.85
Mix MOQ : 2
Christmas Ribbon Gold Stamped Grosgrain Fabric Gift Wrap Flower Decor Holiday Party Elegant Xmas Tree Merry Christmas
Christmas Ribbon Gold Stamped Grosgrain Fabric Gift Wrap Flower Decor Holiday Party Elegant Xmas Tree Merry Christmas
like
Find Similar
White Christmas ribbon roll with gold trees and red Merry Christmas lettering - Gold Edge Christmas Tree - White / 2.5cm*20 Yards
Christmas ribbon roll with red green and gold stripes with metallic gold edge trim - Red with Army Green Edge / 2.5cm*20 Yards
2.5cm Christmas ribbon with red and green fringe and gold metallic foil print on 10Y roll - Fringe - Red & Green / 2.5cm*10 Yards
Christmas Ribbon Gold Stamped Grosgrain Fabric Gift Wrap Flower Decor Holiday Party Elegant Xmas Tree Merry Christmas
-5%
$1.86-3.29
Mix MOQ : 5
Christmas Tree Hanging Ornaments Glitter Angel Star Tree Shape With Metal Bells And Ribbon Bow Festive Decor
Christmas Tree Hanging Ornaments Glitter Angel Star Tree Shape With Metal Bells And Ribbon Bow Festive Decor
like
Find Similar
Nordic gold glitter star hanging ornament with 3 bells and ribbon for Christmas trees - Star Bell
Glittery gold angel Christmas pendant with a cream bow and three decorative bells, 35cm - Angel Bell
Nordic Christmas glitter tree ornament with bells and bow decoration, 35cm length - Christmas Tree with Small Bells
Christmas Tree Hanging Ornaments Glitter Angel Star Tree Shape With Metal Bells And Ribbon Bow Festive Decor
$1.90
No MOQ
Mini Christmas Wreath Rattan Pine Cone Berry Hanging Ornament Handmade Ribbon Bow Holiday Wall Door Tree Decor
Mini Christmas Wreath Rattan Pine Cone Berry Hanging Ornament Handmade Ribbon Bow Holiday Wall Door Tree Decor
like
Find Similar
Miniature woven vine Christmas wreath with pine cones and light blue ribbon bow - Green Small
Handmade Christmas wreath with brown vine base, white pearls, pinecones and blue ribbon bow - Green Large
Christmas wreath with red berries pine cones and moss on natural woven vine ring - Red Large
Mini Christmas Wreath Rattan Pine Cone Berry Hanging Ornament Handmade Ribbon Bow Holiday Wall Door Tree Decor
-4%
$1.53-1.78
No MOQ
Free Shipping
Christmas Reindeer Pendant Glitter Elk Hanging Ornament With Ribbon Bell For Festive Tree Decor Scene Arrangement
Christmas Reindeer Pendant Glitter Elk Hanging Ornament With Ribbon Bell For Festive Tree Decor Scene Arrangement
like
Find Similar
Red beaded reindeer Christmas ornament with small bells and ribbon hanging hook - Red
Golden Christmas reindeer ornament with red ribbons and three jingle bells - Gold
Silver crystal reindeer hanging ornament with festive bells and a red ribbon strap - Silver
Christmas Reindeer Pendant Glitter Elk Hanging Ornament With Ribbon Bell For Festive Tree Decor Scene Arrangement
$1.10
Mix MOQ : 2
Halloween Wooden Bead Garland With Witch Pumpkin Ghost House Pendants Rustic Farmhouse Hanging Decor With Tassel And Gingham Ribbon
Halloween Wooden Bead Garland With Witch Pumpkin Ghost House Pendants Rustic Farmhouse Hanging Decor With Tassel And Gingham Ribbon
like
Find Similar
Halloween wooden bead garland with black haunted house charm and checkered tassel - Ghost Style
Halloween wood bead garland with orange Jack-o'-lantern pumpkin charm and jute tassel - Pumpkin Pattern
Halloween wooden bead garland with witch head pendant and checkered tassel decoration - Witch Pattern
Halloween Wooden Bead Garland With Witch Pumpkin Ghost House Pendants Rustic Farmhouse Hanging Decor With Tassel And Gingham Ribbon
-5%
$2.19
No MOQ
Christmas Wine Bottle Cover Bags Printed Soft Fabric With Gold Ribbon Santa Snowman Reindeer Festive Table Decor
Christmas Wine Bottle Cover Bags Printed Soft Fabric With Gold Ribbon Santa Snowman Reindeer Festive Table Decor
like
Find Similar
Christmas wine bottle cover with Santa Claus print and golden ribbon closure - Santa Claus
Christmas wine bottle cover featuring a cute snowman design on a blue gradient fabric - Snowman
Christmas wine bottle cover with elk and snowy cabin print and golden ribbon - Elk
Christmas Wine Bottle Cover Bags Printed Soft Fabric With Gold Ribbon Santa Snowman Reindeer Festive Table Decor
-4%
$0.60
No MOQ
Christmas Reindeer Hanging Ornaments With Bow Ribbon And Metal Bells Glitter Deer Holiday Tree Decorations For Home Party
Christmas Reindeer Hanging Ornaments With Bow Ribbon And Metal Bells Glitter Deer Holiday Tree Decorations For Home Party
like
Find Similar
Silver Christmas reindeer hanging ornament with double bells and a bow on a white chair - Silver
Golden Christmas reindeer ornament with glitter texture, ribbon bow and hanging bells - Gold
Copper reindeer Christmas ornament with red satin bow and three gold bells on wooden chair - Red
Christmas Reindeer Hanging Ornaments With Bow Ribbon And Metal Bells Glitter Deer Holiday Tree Decorations For Home Party
-4%
$0.41
Mix MOQ : 2
Christmas Decorative Ribbon Faux Linen With Fringe Edge Red Truck Snowman Printing For Gift Wrapping Festive Ornament
Christmas Decorative Ribbon Faux Linen With Fringe Edge Red Truck Snowman Printing For Gift Wrapping Festive Ornament
like
Find Similar
Christmas ribbon roll with vintage truck and tree print on red rustic fabric - Red Truck Style
Grey Christmas ribbon with white truck and snowy tree print on white plush background - Grey Truck Style
Christmas burlap ribbon with snowman pattern and Let it SNOW text for gift wrapping - Natural Khaki Snowman Style
Christmas Decorative Ribbon Faux Linen With Fringe Edge Red Truck Snowman Printing For Gift Wrapping Festive Ornament
-4%
$2.14
Mix MOQ : 2
Christmas Reindeer Hanging Ornament Glitter Plastic Deer With Bells And Ribbon Bow Holiday Tree Decoration Accessory
Christmas Reindeer Hanging Ornament Glitter Plastic Deer With Bells And Ribbon Bow Holiday Tree Decoration Accessory
like
Find Similar
Sparkling red reindeer Christmas ornament with bow and bells hanging on a festive tree - Red
Sparkling gold reindeer Christmas tree ornament with bell bow for festive party decor - Gold
Silver glitter reindeer Christmas ornament with bow and bell hanging on tree - Silver
Christmas Reindeer Hanging Ornament Glitter Plastic Deer With Bells And Ribbon Bow Holiday Tree Decoration Accessory
$0.46
No MOQ
Christmas Reindeer Antlers And Red Nose Car Decoration Flannel Plush Horns With Bells And Ribbons Holiday Auto Ornament
Christmas Reindeer Antlers And Red Nose Car Decoration Flannel Plush Horns With Bells And Ribbons Holiday Auto Ornament
like
Find Similar
Christmas car reindeer antlers set with brown plush antlers, red nose, and gold bells - Brown
Detail view of plush red reindeer antlers and nose car decoration with bells - Red
Detail of Christmas car reindeer antlers with plush fabric and white plastic clips - Khaki
Christmas Reindeer Antlers And Red Nose Car Decoration Flannel Plush Horns With Bells And Ribbons Holiday Auto Ornament
$2.74
No MOQ
Christmas Tree Ribbon Burlap Fabric Retro Truck Print Merry Christmas Festive Decorative Garland For Holiday Wrapping
Christmas Tree Ribbon Burlap Fabric Retro Truck Print Merry Christmas Festive Decorative Garland For Holiday Wrapping
like
Find Similar
Red Christmas ribbon roll featuring white vintage truck and snowy Christmas tree prints - 1 Roll 5 Meters / Red
Christmas burlap ribbon with red truck and green tree patterns for holiday decor - 1 Roll 5 Meters / Hemp Color
Rustic Christmas car print ribbon with Merry Christmas text and golden stitched edges - 1 Roll 5 Meters / Gray
Christmas Tree Ribbon Burlap Fabric Retro Truck Print Merry Christmas Festive Decorative Garland For Holiday Wrapping
$1.73
No MOQ
Christmas Double Layer Bow Hair Clip With Reindeer Plaid Print Webbing Ribbon Long Streamer For Women Girls Holiday Party
Christmas Double Layer Bow Hair Clip With Reindeer Plaid Print Webbing Ribbon Long Streamer For Women Girls Holiday Party
like
Find Similar
Detail of white Christmas bow hair clip with colorful holiday gift patterns on green surface - White
Detail of a red Christmas bow hair clip with festive gift box patterns on green background - Red
Christmas layered bow hair clip with gold deer pattern and green red plaid ribbon - Christmas Green
Christmas Double Layer Bow Hair Clip With Reindeer Plaid Print Webbing Ribbon Long Streamer For Women Girls Holiday Party
$1.15
Mix MOQ : 2
Go to

More in accessories

Explore more in silk ribbon

longpartydecorativecarehollowartificialgirlsdailywhitemaking
bandpolyestersatin silksatin silk scarfsatin hairhairpinpolyester ribbonwaiststar

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access