Everful

Wholesale snowmen

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Snowmen

Find the perfect pieces: christmas supplies, halloween supplies and more

Popular collections in snowmen

All products in snowmen

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Christmas Porch Banner Polyester Fabric Hanging Signs Front Door Holiday Decor Festive Nutcracker Santa Snowman Pattern
Christmas Porch Banner Polyester Fabric Hanging Signs Front Door Holiday Decor Festive Nutcracker Santa Snowman Pattern
like
Find Similar
Christmas door banner set 71x12 inch red black plaid Merry Christmas porch decoration - MC01 Red Black Plaid Merry Christmas
Detailed view of red Christmas porch banners with Santa, Snowman and holiday greetings - MC03 Red Merry Christmas And Happy Newyear
Detailed size chart for Christmas porch banners featuring Santa and Snowman designs - MC04 Red Black Plaid Top Santa Snowman
Detailed view of green Merry Christmas door banners with festive holiday illustrations - MC05 Green Merry Christmas Cartoon Illustration
+14
Christmas Porch Banner Polyester Fabric Hanging Signs Front Door Holiday Decor Festive Nutcracker Santa Snowman Pattern
-5%
$3.01
No MOQ
Christmas Banners Paper Reindeer Santa Snowman Hanging Garland For Party Home Decor Cartoon DIY Festive
Christmas Banners Paper Reindeer Santa Snowman Hanging Garland For Party Home Decor Cartoon DIY Festive
like
Find Similar
Christmas reindeer paper banner with cartoon elk wearing festive hats and scarves - Reindeer Banner
Christmas party banner featuring cartoon Christmas tree cards with Merry Christmas text - Christmas Tree Banner
Christmas bunting banner with cute teddy bears in festive costumes for party decor - Teddy Bear Banner
Christmas snowman bunting banner with Merry Christmas text for festive party decoration - Snowman Banner
+2
Christmas Banners Paper Reindeer Santa Snowman Hanging Garland For Party Home Decor Cartoon DIY Festive
-5%
$0.82-6.57
Mix MOQ : 5
Free Shipping
Christmas Snowman Plush Doll Retractable Long Leg Figurine For Home Holiday Party Nordic Blue Knitted Winter Decor
Christmas Snowman Plush Doll Retractable Long Leg Figurine For Home Holiday Party Nordic Blue Knitted Winter Decor
like
Find Similar
50cm blue telescopic Christmas snowman plush doll with nordic sweater and boots - 50cm-Style A
50cm extendable Christmas snowman plush toy in blue checkered outfit and knit hat - 50cm-Style B
75cm retractable Christmas snowman doll in blue plaid outfit holiday decoration - 75cm-Style B
Blue 102cm retractable Christmas snowman plush figure with Nordic sweater and earflap hat - 102cm-Style A
+1
Christmas Snowman Plush Doll Retractable Long Leg Figurine For Home Holiday Party Nordic Blue Knitted Winter Decor
$10.09-22.48
Mix MOQ : 2
 · 
1 reviews
Christmas Gift Bags Felt Linen Drawstring Pouch 3D Santa Snowman Reindeer Gnome Figure Xmas Holiday Candy Present Treat Bag
Christmas Gift Bags Felt Linen Drawstring Pouch 3D Santa Snowman Reindeer Gnome Figure Xmas Holiday Candy Present Treat Bag
like
Find Similar
Grey linen Christmas gift bag featuring a 3D gnome doll and festive red drawstring closure - P2-20 Faceless Doll Handbag Grey (21*25cm)
Red burlap Christmas gift bag with 3D Santa Claus applique, drawstring, and gold bell - P2-15 Bell Handbag Santa Claus (18*19cm)
Christmas gift bag with a polar bear 3D doll and festive red snowflake linen patterns - P2-14 Printed Handbag Bear (21*24cm)
Grey Christmas fabric gift bag with 3D reindeer doll, red scarf and small gold bell - P2-17 Bell Handbag Reindeer (18*19cm)
+26
Christmas Gift Bags Felt Linen Drawstring Pouch 3D Santa Snowman Reindeer Gnome Figure Xmas Holiday Candy Present Treat Bag
-5%
$0.77-1.26
Mix MOQ : 2
 · 
50 sold recently
Christmas Straw Topper Covers Silicone Reusable Dust Proof Plugs Accessories Santa Claus Penguin Reindeer Snowman Drinkware Decor
Christmas Straw Topper Covers Silicone Reusable Dust Proof Plugs Accessories Santa Claus Penguin Reindeer Snowman Drinkware Decor
like
Find Similar
Brown silicone bear straw cover with green scarf for 10mm reusable straws - 02-Christmas Bear
Reusable 10mm silicone straw topper featuring a red car and Christmas tree design - 03-Christmas Car
Reusable 10mm silicone straw cover featuring a cute red and yellow Christmas bell design - 04-Christmas Bell
Reusable 10mm candy cane silicone straw cover with blue bow for Christmas decor - 05-Candy Cane
+7
Christmas Straw Topper Covers Silicone Reusable Dust Proof Plugs Accessories Santa Claus Penguin Reindeer Snowman Drinkware Decor
$0.16
Mix MOQ : 100
 · 
10 views
LED Light Up Christmas Knit Hat Holiday Glowing Beanie Colorful Santa Snowman Reindeer Patterns For Adults And Kids
LED Light Up Christmas Knit Hat Holiday Glowing Beanie Colorful Santa Snowman Reindeer Patterns For Adults And Kids
like
Find Similar
Detail of knitted Christmas hat with LED lights, striped pattern and a fuzzy pom-pom - Christmas Tree
Detail of teal knitted Christmas hat with white snowflake patterns and LED power switch - Snowflake Style
Close-up of black LED knitted Christmas hat with colorful bulb patterns and ON/OFF switch - Colored Light Style
Close-up of red knitted Christmas hat with LED reindeer pattern and Oh Deer text - Purple Red Reindeer/OH DEER!
+12
LED Light Up Christmas Knit Hat Holiday Glowing Beanie Colorful Santa Snowman Reindeer Patterns For Adults And Kids
$3.46
Mix MOQ : 2
 · 
185 sold recently
Christmas Charms Beads Alloy Enamel Santa Claus Snowman Reindeer Tree Snowflake For DIY Jewelry Making Accessories
Christmas Charms Beads Alloy Enamel Santa Claus Snowman Reindeer Tree Snowflake For DIY Jewelry Making Accessories
like
Find Similar
Detailed top view of a silver snowflake pendant bead with 12x13mm size specification - No.1 - Snowflake / 1 Piece
Detail of Christmas tree charms with red dots, size 8x13mm for DIY jewelry making - No.2 - Star Christmas Tree / 1 Piece
Detailed view of red bell pendant with wave pattern showing 9x14mm size and 3.3g weight - No.3 - Red Patterned Bell / 1 Piece
Detail view of green Christmas wreath charms with red bows and silver loops - No.4 - Christmas Wreath / 1 Piece
+5
Christmas Charms Beads Alloy Enamel Santa Claus Snowman Reindeer Tree Snowflake For DIY Jewelry Making Accessories
$0.79-1.13
Mix MOQ : 2
 · 
11 views
Free Shipping
Vintage Christmas Brooch Pin Alloy Enamel Rhinestone Santa Snowman Tree Reindeer Bell Wreath Festival Party Jewelry Gift For Women
Vintage Christmas Brooch Pin Alloy Enamel Rhinestone Santa Snowman Tree Reindeer Bell Wreath Festival Party Jewelry Gift For Women
like
Find Similar
Vintage red enamel gift box brooch with golden bow and sparkling rhinestones - Red Enamel Gift Box Style (001)
Christmas napkin ring with red bells, green bow and sparkling white rhinestones - Christmas Double Bells Style (002)
Christmas wreath brooch with red enamel bell and bow on a gold finish base - Bell Christmas Wreath Style (003)
Christmas snowman family brooch with gold alloy and sparkling rhinestones for holidays - Snowman Family Style (004)
+42
Vintage Christmas Brooch Pin Alloy Enamel Rhinestone Santa Snowman Tree Reindeer Bell Wreath Festival Party Jewelry Gift For Women
-9%
$0.92-1.55
No MOQ
Free Shipping
Christmas Stockings Fabric Plaid Linen Cartoon Santa Snowman Reindeer Hanging Ornaments Holiday Gift Bags Decoration
Christmas Stockings Fabric Plaid Linen Cartoon Santa Snowman Reindeer Hanging Ornaments Holiday Gift Bags Decoration
like
Find Similar
Red and black plaid Christmas stocking in small cat paw shape with white plush trim - Small Paw Stocking Red
Green and black buffalo plaid pet Christmas stocking with white paw print and plush trim - Small Paw Stocking Green
Christmas tree decoration featuring a black and white checkered paw-shaped stocking with faux fur - Small Paw Stocking Grey
Christmas stocking with Santa Claus design and green sequin cuff hanging on tree - Small Sequin Santa Stocking
+30
Christmas Stockings Fabric Plaid Linen Cartoon Santa Snowman Reindeer Hanging Ornaments Holiday Gift Bags Decoration
$0.49-1.59
No MOQ
 · 
12 sold recently
Free Shipping
Christmas Snow Globe Lantern Retro Bronze LED Lighted Glittering Santa Claus Snowman Ornament For Holiday Home Decor
Christmas Snow Globe Lantern Retro Bronze LED Lighted Glittering Santa Claus Snowman Ornament For Holiday Home Decor
like
Find Similar
Bronze Christmas street lamp night light with Santa Claus and swirling snow glitter - Vintage Hexagonal Santa with Gift Bag
Retro bronze Christmas lantern featuring Santa Claus inside a water-filled snowflake globe - Vintage Hexagonal Standing Santa
Vintage bronze Santa Claus snow globe lantern with warm glowing lights and glitter - Vintage Hexagonal Calling Santa
Vintage bronze Christmas lantern with snowman figure and festive swirling snow effect - Vintage Hexagonal Calling Snowman
+4
Christmas Snow Globe Lantern Retro Bronze LED Lighted Glittering Santa Claus Snowman Ornament For Holiday Home Decor
-4%
$3.43
Mix MOQ : 2
Miniature Christmas Ornaments Santa Claus Snowman Plastic Painted Figurines For Tabletop Micro Landscape DIY Decor
Miniature Christmas Ornaments Santa Claus Snowman Plastic Painted Figurines For Tabletop Micro Landscape DIY Decor
like
Find Similar
Miniature resin snowman figurine with black hat and red scarf, 3.3cm height, Style 2 - Snowman No. 2
Miniature Santa Claus figurine holding hands up, painted resin ornament for Christmas decor - Style 4 Santa Claus
Miniature waving Santa Claus figurine, hand-painted resin 6# model, 3cm Christmas decor - Style 6 Santa Claus
Miniature Christmas snowman figurine No. 7 resin ornament, size 2.8cm by 2.5cm - Style 7 Snowman
+10
Miniature Christmas Ornaments Santa Claus Snowman Plastic Painted Figurines For Tabletop Micro Landscape DIY Decor
$0.20-0.29
Mix MOQ : 500
 · 
25 views
Christmas Tablecloth Waterproof PE Plastic Disposable Party Decoration Rectangular Snowflake Santa Snowman Pattern Festive
Christmas Tablecloth Waterproof PE Plastic Disposable Party Decoration Rectangular Snowflake Santa Snowman Pattern Festive
like
Find Similar
Waterproof snowflake Christmas tablecloth with festive trees and Merry Christmas text - Christmas Tree Style 137*274cm
Blue and purple gradient snowflake print disposable plastic tablecloth for party - Purple Blue Snowflake 137*274cm
Red Christmas tablecloth with festive snowmen and Merry Christmas prints on a wooden table - Christmas Snowman Style 137*274cm
Close-up of festive red Christmas tablecloth with reindeer and snowflake patterns - Christmas Reindeer Style 137*274cm
+11
Christmas Tablecloth Waterproof PE Plastic Disposable Party Decoration Rectangular Snowflake Santa Snowman Pattern Festive
$0.63-1.30
Mix MOQ : 3
Christmas Cupcake Brooch Alloy Enamel Snowman Candy Cane Cute Holiday Party Clothing Pin Accessory For Women Men
Christmas Cupcake Brooch Alloy Enamel Snowman Candy Cane Cute Holiday Party Clothing Pin Accessory For Women Men
like
Find Similar
Christmas cupcake brooch with snowman and candy cane on white background - Snowman Cupcake (C348-A)
Christmas Cupcake Brooch Alloy Enamel Snowman Candy Cane Cute Holiday Party Clothing Pin Accessory For Women Men
-13%
$1.24
Mix MOQ : 3
 · 
12 views
Free Shipping
Christmas Gift Bags Stockings Linen Plush Candy Pouches Transparent Heart Window 3D Santa Snowman Reindeer Decorations
Christmas Gift Bags Stockings Linen Plush Candy Pouches Transparent Heart Window 3D Santa Snowman Reindeer Decorations
like
Find Similar
Christmas reindeer gift bag with 28cm plush antlers and linen drawstring candy pouch - Linen Zipper Apple Bag - 3D Reindeer
Plush Santa doll Christmas gift bag with green reindeer hat and heart window - Linen Zipper Apple Bag - 3D Santa Claus
Christmas snowman gift bag with 27x19cm dimensions and Merry Christmas embroidery - Linen Zipper Apple Bag - 3D Snowman
Christmas Santa Claus drawstring gift bag with knit hat and vintage forest green burlap - English Print Apple Bag - Santa Claus
+25
Christmas Gift Bags Stockings Linen Plush Candy Pouches Transparent Heart Window 3D Santa Snowman Reindeer Decorations
-5%
$0.77-2.68
Mix MOQ : 2
Christmas Pendant Necklace Stainless Steel Enamel Santa Claus Reindeer Snowman Holiday Jewelry For Women Gold Tone
Christmas Pendant Necklace Stainless Steel Enamel Santa Claus Reindeer Snowman Holiday Jewelry For Women Gold Tone
like
Find Similar
Detail of gold reindeer pendant necklace with silver texture on 39cm fine cross chain - Deer
Titanium steel Christmas necklace with red and white Santa Claus pendant for women - Cartoon Snowman
Detail of Christmas stocking necklace with 39cm+5cm chain length and 15mm pendant width - Christmas Sock
Detailed view of NOEL gold necklace with dimensions 39+5cm length and 17mm pendant size - NOEL Letters
+13
Christmas Pendant Necklace Stainless Steel Enamel Santa Claus Reindeer Snowman Holiday Jewelry For Women Gold Tone
-4%
$2.02
No MOQ
 · 
56 sold recently
Free Shipping
Christmas Aluminum Foil Balloons Reusable Self Sealing Santa Snowman Reindeer Shape Holiday Party Home Decoration
Christmas Aluminum Foil Balloons Reusable Self Sealing Santa Snowman Reindeer Shape Holiday Party Home Decoration
like
Find Similar
Candy cane aluminum foil balloon with red and white stripes for Christmas decor, 84x39cm - Christmas Candy Cane
Christmas Santa Claus shaped foil balloon for holiday party decoration, 48x81cm size - Cute Santa Claus
Christmas snowman foil balloon with black hat and green scarf decoration, 89x50cm - Large Smiling Snowman
Christmas gift box stack foil balloon 124x70cm for holiday party decoration - Christmas Gift
+21
Christmas Aluminum Foil Balloons Reusable Self Sealing Santa Snowman Reindeer Shape Holiday Party Home Decoration
$0.17-0.73
Mix MOQ : 50
Christmas Brooch Enamel Pin Zinc Alloy Cartoon Santa Claus Snowman Tree Sock Bell Cute Festive Party Accessory Gift
Christmas Brooch Enamel Pin Zinc Alloy Cartoon Santa Claus Snowman Tree Sock Bell Cute Festive Party Accessory Gift
like
Find Similar
Close-up of snowflake enamel brooch with heart detail, size 2.9cm x 2.9cm, weight 4.0g - 1# Christmas Snowflake
Detailed view of Christmas boot enamel pin measuring 2.8cm by 2.9cm and weighing 4g - 2# Christmas Boot
Detailed view of enamel snowflake Christmas tree brooch measuring 2.5cm by 2.9cm - 3# Christmas Tree
Detail view of enamel Santa Claus brooch with Merry Christmas text and size 3x2.8cm - 4# Santa Claus Waving
+4
Christmas Brooch Enamel Pin Zinc Alloy Cartoon Santa Claus Snowman Tree Sock Bell Cute Festive Party Accessory Gift
-8%
$0.45
Mix MOQ : 2
Free Shipping
Plush Christmas Pins Santa Snowman Reindeer Tree Soft Embroidered Badge Holiday Decor For Clothing Bags
Plush Christmas Pins Santa Snowman Reindeer Tree Soft Embroidered Badge Holiday Decor For Clothing Bags
like
Find Similar
Plush Christmas reindeer accessory with gold antlers and red nose, size 6cm by 7cm - Adjustable / Christmas Reindeer Blue
Close-up of a plush snowman charm with red hat and scarf, measuring H 6.5cm x W 5cm - Adjustable / Snowman
Close-up of a plush yellow Christmas stocking brooch with red bow and white pom-poms - Adjustable / Christmas Stocking Shoe
Detail of plush Santa Claus ornament with embroidery, 5.5cm height for DIY crafts and gifts - Adjustable / Santa Claus
+8
Plush Christmas Pins Santa Snowman Reindeer Tree Soft Embroidered Badge Holiday Decor For Clothing Bags
-11%
$0.20-0.28
Mix MOQ : 5
 · 
11 views
Christmas Snowman Plush Doll Ornaments Desktop Decoration Plush Foam Flannel For Holiday Home Party Atmosphere Cute Nordic Style
Christmas Snowman Plush Doll Ornaments Desktop Decoration Plush Foam Flannel For Holiday Home Party Atmosphere Cute Nordic Style
like
Find Similar
Mini plush snowman figurine with red scarf and wood branch arms, 11cm holiday ornament - Small / Red
Plush Christmas snowman doll with red plaid hat and scarf, 15cm height desktop ornament - Medium / Red
Plush Christmas snowman doll with red knitted scarf, 18cm tall tabletop decoration - Large / Red
Plush Christmas snowman figurine with brown scarf and dimensions 18x14x10cm - Large / Gold
+5
Christmas Snowman Plush Doll Ornaments Desktop Decoration Plush Foam Flannel For Holiday Home Party Atmosphere Cute Nordic Style
$2.54-3.69
Mix MOQ : 2
 · 
23 views
Christmas Watercolor Pillow Covers Linen Decorative Throw Pillowcases Snowman Santa Claus Ice Skates For Sofa Home Decor
Christmas Watercolor Pillow Covers Linen Decorative Throw Pillowcases Snowman Santa Claus Ice Skates For Sofa Home Decor
like
Find Similar
Square Christmas pillow case with snowman and pink rose print on linen fabric - Dreamy Snowy House And Pink Rose Style (YMX54-1) / 45x45cm (Pillow Case Only)
Christmas pillow cover featuring vintage ice skates with holly leaves and red berries - Vintage Ice Skates And Red Berries Style (YMX54-2) / 45x45cm (Pillow Case Only)
Pastel snowman Christmas pillow cover with decorative holiday gift boxes on white background - Cute Snowman And Pink Gift Box Style (YMX54-3) / 45x45cm (Pillow Case Only)
Mint green square Christmas pillowcase with vintage Santa Claus and gift box prints - Vintage Santa Claus And Gifts Pile Style (YMX54-4) / 45x45cm (Pillow Case Only)
Christmas Watercolor Pillow Covers Linen Decorative Throw Pillowcases Snowman Santa Claus Ice Skates For Sofa Home Decor
$1.15
Mix MOQ : 2
Christmas Polymer Clay Beads Mixed Santa Claus Snowman Christmas Tree Candy Cane Spacer Beads DIY Jewelry Making Crafts
Christmas Polymer Clay Beads Mixed Santa Claus Snowman Christmas Tree Candy Cane Spacer Beads DIY Jewelry Making Crafts
like
Find Similar
Blue polymer clay beads with Christmas stocking pattern for DIY jewelry making - Blue Christmas Socks
Blue cylindrical polymer clay beads featuring Santa Claus patterns for DIY jewelry - Blue Santa Claus
Handmade polymer clay Santa Claus loose beads for DIY Christmas jewelry making - Red Santa Claus
Flat round polymer clay beads with Christmas hat patterns for DIY jewelry making - Red Christmas Hat
+13
Christmas Polymer Clay Beads Mixed Santa Claus Snowman Christmas Tree Candy Cane Spacer Beads DIY Jewelry Making Crafts
$0.01
Mix MOQ : 100
 · 
34 views
Christmas Dining Chair Covers Linen Snowman Snowflake Nutcracker Letters Printed Holiday Home Backrest Protector Decoration
Christmas Dining Chair Covers Linen Snowman Snowflake Nutcracker Letters Printed Holiday Home Backrest Protector Decoration
like
Find Similar
Detail view of festive blue linen chair covers with snowman and JOY text in Christmas decor - YT03-1 (Blue Snowman JOY)
Blue Christmas chair covers with white and gold snowflake patterns for festive dining decor - YT03-2 (Blue Snowflake)
Blue Christmas chair covers with Merry Christmas text and white tree pattern for dining room - YT03-3 (Blue Xmas Tree Merry Christmas)
Christmas chair cover featuring blue Ho Ho Ho letters and snowflakes for dining room decor - YT03-4 (Light Blue HO HO HO)
+12
Christmas Dining Chair Covers Linen Snowman Snowflake Nutcracker Letters Printed Holiday Home Backrest Protector Decoration
$2.45
Mix MOQ : 2
Christmas Tapestry Polyester Cartoon Santa Claus Snowman Print Wall Hanging Home Decor Holiday Party Backdrop
Christmas Tapestry Polyester Cartoon Santa Claus Snowman Print Wall Hanging Home Decor Holiday Party Backdrop
like
Find Similar
Cartoon Christmas train tapestry featuring Santa, reindeer, and snowman for wall decor - Cartoon Train Style (2) / 150x100(Peach Skin)
Detailed close-up of blue Christmas tapestry with Santa and reindeer on living room wall - Lake Blue Background Three Friends (4) / 150x100(Peach Skin)
Merry Christmas peach skin tapestry with Santa Claus, Snowman and festive Xmas tree decor - Snowy Christmas Tree Group (6) / 150x100(Peach Skin)
Christmas snowman tapestry wall hanging decoration for home living room or bedroom decor - Snowman Family Joy (1) / 150x100(Peach Skin)
+104
Christmas Tapestry Polyester Cartoon Santa Claus Snowman Print Wall Hanging Home Decor Holiday Party Backdrop
-5%
$2.46-9.86
No MOQ
Plush Christmas Snowman Doll Ornament With Knitted Hat Scarf And Earmuffs For Holiday Home Desktop Party Decor
Plush Christmas Snowman Doll Ornament With Knitted Hat Scarf And Earmuffs For Holiday Home Desktop Party Decor
like
Find Similar
Short-legged plush Christmas snowman doll in warm brown knits, size 22x14x10cm - Round Hat Style
Plush Christmas snowman doll in warm brown knit with dimensions 28x15x11cm - Pointy Hat Style
Plush Christmas Snowman Doll Ornament With Knitted Hat Scarf And Earmuffs For Holiday Home Desktop Party Decor
-4%
$3.43
No MOQ
 · 
1 reviews
Christmas DIY Stickers Cartoon Santa Claus Snowman Reindeer For Kids Holiday Party Decoration Adhesive Paper Crafts
Christmas DIY Stickers Cartoon Santa Claus Snowman Reindeer For Kids Holiday Party Decoration Adhesive Paper Crafts
like
Find Similar
24-sheet set of Christmas DIY stickers with Santa, snowman and reindeer designs - 11*16cm / 8 Designs
DIY Christmas stickers set featuring Santa, Reindeer, and Snowman for creative fun - 14.5*17cm / 6 Designs
DIY Christmas stickers set featuring cartoon Santa, Snowman and Reindeer for kids - 14.5*21cm / 4 Designs
Cartoon Christmas DIY stickers set with Santa, reindeer and snowman for holiday decoration - Christmas OHC-113 / Set of 25 Sheets (Including 1 Cover)
+13
Christmas DIY Stickers Cartoon Santa Claus Snowman Reindeer For Kids Holiday Party Decoration Adhesive Paper Crafts
-5%
$0.18-3.63
No MOQ
 · 
27 sold recently
Miniature Christmas Town Resin Micro Landscape DIY Decoration Snowman Reindeer Penguin Bear Cartoon Festive Desk Decor
Miniature Christmas Town Resin Micro Landscape DIY Decoration Snowman Reindeer Penguin Bear Cartoon Festive Desk Decor
like
Find Similar
Miniature snowman figurine with red hat and green gift bag for Christmas DIY decor - Elf Snowball
Miniature snowman figurine with purple hat and blue ribbon for DIY winter decor - Gift Hat Snowman
Miniature pink pig in blue Merry Christmas gift box figurine for DIY holiday decor - Surprise Gift Box
Miniature snowman figurine for Christmas DIY decor, 4cm wide resin snow scene ornament - Snowman Sled
+7
Miniature Christmas Town Resin Micro Landscape DIY Decoration Snowman Reindeer Penguin Bear Cartoon Festive Desk Decor
$0.13-0.24
Mix MOQ : 3
 · 
14 views
Handmade Cotton Rope Woven Storage Basket Cute Cherry Handbag Christmas Reindeer Snowman Gift Bag For Picnic Home Desk Organizer
Handmade Cotton Rope Woven Storage Basket Cute Cherry Handbag Christmas Reindeer Snowman Gift Bag For Picnic Home Desk Organizer
like
Find Similar
Handwoven red and white cotton rope storage basket with cherry charms and dual handles - Red Cherry Bag (19cm Diameter)
Cute cherry and reindeer Christmas woven cotton rope storage bag for holiday picnic - Candy Reindeer
Handmade red and white woven cotton bucket bag with cute cartoon smiley face and tassels - Little Braid Man
Handmade woven cotton cherry tote bag with festive snowman and red plush star decorations - Star Snowman
+1
Handmade Cotton Rope Woven Storage Basket Cute Cherry Handbag Christmas Reindeer Snowman Gift Bag For Picnic Home Desk Organizer
$3.75
No MOQ
Christmas Snow Globe Lantern Water Filled LED Lighted Retro Bronze Desktop Ornament Santa Snowman Reindeer Decor
Christmas Snow Globe Lantern Water Filled LED Lighted Retro Bronze Desktop Ornament Santa Snowman Reindeer Decor
like
Find Similar
Bronze Christmas lantern with Santa Claus and glitter water inside for holiday decor - Flat Crystal Santa Claus
Bronze Christmas lantern with snowman scene and swirling glitter light effect - Flat Crystal Snowman
Christmas water lantern featuring a golden deer and glitter snow in bronze finish - Flat Crystal Reindeer
Vintage Christmas water lantern with Santa decorating tree and sparkling glitter - Flat Crystal Christmas Tree
Christmas Snow Globe Lantern Water Filled LED Lighted Retro Bronze Desktop Ornament Santa Snowman Reindeer Decor
$3.03
Mix MOQ : 2
 · 
24 views
Christmas Charms Zinc Alloy Enamel Santa Claus Snowman Tree Pendant For DIY Jewelry Making Keychain
Christmas Charms Zinc Alloy Enamel Santa Claus Snowman Tree Pendant For DIY Jewelry Making Keychain
like
Find Similar
Christmas tree DIY alloy pendants with green enamel and gold finish details - #1 Christmas Tree (Green Enamel)
DIY Christmas tree enamel pendants in green and gold alloy for jewelry making, 13x22mm - #3 Christmas Tree (Mini)
Detail of 14x15mm ice skate alloy charms with red and green enamel for DIY jewelry making - #10 Ice Skates
Christmas tree alloy pendant for DIY jewelry making with green enamel finish and gold back - #2 Christmas Tree (Polka Dot)
+16
Christmas Charms Zinc Alloy Enamel Santa Claus Snowman Tree Pendant For DIY Jewelry Making Keychain
$0.08-0.15
Mix MOQ : 10
 · 
22 sold recently
Free Shipping
Christmas Wine Bottle Cover Knitted Mini Sweater And Hat Snowman Pattern For Holiday Dinner Table Decoration
Christmas Wine Bottle Cover Knitted Mini Sweater And Hat Snowman Pattern For Holiday Dinner Table Decoration
like
Find Similar
Christmas snowman wine bottle cover with red sweater and mini hat, size 28x21cm - Red Snowman
Christmas Wine Bottle Cover Knitted Mini Sweater And Hat Snowman Pattern For Holiday Dinner Table Decoration
$1.67
No MOQ
 · 
10 sold recently
Handmade Wool Felt Christmas Ornaments Reindeer Snowman Santa Claus Figures Desktop Decor Nordic Style Festive Gift
Handmade Wool Felt Christmas Ornaments Reindeer Snowman Santa Claus Figures Desktop Decor Nordic Style Festive Gift
like
Find Similar
Handmade wool felt Christmas reindeer figurine wearing red knit sweater 16x10cm - No.1/White Knit Sweater Deer
Handmade light grey wool felt reindeer ornament with grey scarf and star saddle - No.2/Grey Scarf Deer
White wool felt reindeer figurine with red scarf and snowflake vest, size 18x9cm - No.3/Red Vest Scarf Deer
Handmade wool felt deer figurine in white with vintage knit sweater on wooden base - No.4/Black Pattern Knit Deer
+14
Handmade Wool Felt Christmas Ornaments Reindeer Snowman Santa Claus Figures Desktop Decor Nordic Style Festive Gift
-5%
$6.02-12.05
No MOQ
 · 
18 views
Free Shipping
Christmas Table Runner Polyester Cotton Jacquard Woven Snowman Penguin Patterns Holiday Decor With Tassels
Christmas Table Runner Polyester Cotton Jacquard Woven Snowman Penguin Patterns Holiday Decor With Tassels
like
Find Similar
Christmas plaid table runner with festive tree and reindeer pattern on wooden table - 35*140cm / Christmas Plaid (Hemmed Ends)
Christmas snowman table runner with red poinsettia and green holly patterns - 35*140cm / Christmas Flower + Ball (Hand Wash Only)
Christmas table runner with red poinsettia and candles on beige jacquard fabric - 35*140cm / Christmas Flower + Candle (Hand Wash Only)
Christmas snowman table runner with red tassels on a wooden dining table setup - 35*140cm / Christmas Sock + Triangle (Hand Wash Only)
+38
Christmas Table Runner Polyester Cotton Jacquard Woven Snowman Penguin Patterns Holiday Decor With Tassels
$3.46-6.34
No MOQ
Christmas Gift Bag Candy Bag Drawstring Tote Bag Santa Snowman Deer Reindeer Doll Plush Felt For Holiday Party Decor
Christmas Gift Bag Candy Bag Drawstring Tote Bag Santa Snowman Deer Reindeer Doll Plush Felt For Holiday Party Decor
like
Find Similar
Detail of green Christmas gift bag with 3D Santa doll and white snowflake pattern - English Print Santa
Christmas reindeer drawstring burlap gift bag with festive snowflake prints and plush decor - English Print Reindeer
Christmas drawstring gift bag with plush bear head and LOVE print in dark green burlap - English Print Bear
Red felt Christmas gift bag with 3D snowman and sequin tree for holiday treats - Snowman with Striped Collar
+38
Christmas Gift Bag Candy Bag Drawstring Tote Bag Santa Snowman Deer Reindeer Doll Plush Felt For Holiday Party Decor
-5%
$0.74-2.33
No MOQ
 · 
10 views
Christmas Gift Bags Paper Handbags White Cardstock Glitter Merry Christmas Snowman Tree Patterns For Holiday Presents
Christmas Gift Bags Paper Handbags White Cardstock Glitter Merry Christmas Snowman Tree Patterns For Holiday Presents
like
Find Similar
Red Christmas gift bag featuring snowman, tree illustrations and woven handles - S (18x8.5x24cm) / 1 Piece / Snowman and Tree
Red Christmas paper gift bag with golden Merry Christmas text and festive patterns - S (18x8.5x24cm) / 1 Piece / Bronzing Christmas Gift
Red Christmas paper gift bag with festive tree print and golden Merry Christmas text - S (18x8.5x24cm) / 1 Piece / Bronzing Christmas Tree
Red Christmas paper gift bag featuring a snowman illustration and red rope handles - S (18x8.5x24cm) / 1 Piece / Bronzing Big Snowman
+24
Christmas Gift Bags Paper Handbags White Cardstock Glitter Merry Christmas Snowman Tree Patterns For Holiday Presents
$0.57-19.04
Mix MOQ : 5
 · 
11 views
Christmas Party Decoration Glasses Reindeer Antlers Santa Claus Snowman Tree Glitter Festive Eyewear Costume Props
Christmas Party Decoration Glasses Reindeer Antlers Santa Claus Snowman Tree Glitter Festive Eyewear Costume Props
like
Find Similar
Classic black frame sunglasses for women with festive Christmas party accessory styling - Large Christmas Hat
Close-up of reindeer antler Christmas party glasses worn by a model in a festive style - Deer
White snowflake party glasses for Christmas celebrations worn by a person - White Snowflake
Detail view of festive snowman Christmas glasses for holiday party dress up and props - Scarf Snowman
+24
Christmas Party Decoration Glasses Reindeer Antlers Santa Claus Snowman Tree Glitter Festive Eyewear Costume Props
$0.52-1.59
No MOQ
 · 
69 sold recently
Christmas Cookie Cutters Santa Reindeer Snowman Tree Shapes Plastic Fondant Biscuit Embossing Stamp DIY Baking Tools
Christmas Cookie Cutters Santa Reindeer Snowman Tree Shapes Plastic Fondant Biscuit Embossing Stamp DIY Baking Tools
like
Find Similar
6x6cm white cookie cutter with Oh My Deer text sample for Christmas baking decoration - Square Cutter / 6x6cm
Santa Claus cookie cutter with 8.3x9cm size specifications for Christmas baking - Santa Claus Cutter / 8.3x9cm
7cm white Christmas bauble cookie cutter and green embossed fondant stamp for baking - Round Cutter / 7cm Diameter
White HOHOHO letter cookie cutter mold for Christmas baking measuring 4.9x8.3cm - HOHOHO Cutter / 4.9x8.3cm
+19
Christmas Cookie Cutters Santa Reindeer Snowman Tree Shapes Plastic Fondant Biscuit Embossing Stamp DIY Baking Tools
-5%
$1.15-3.53
Mix MOQ : 2
Christmas Honeycomb Paper Ornaments Xmas Tree Hanging Decorations Snowman Bell Candy Shapes Festive Party Scene Layout
Christmas Honeycomb Paper Ornaments Xmas Tree Hanging Decorations Snowman Bell Candy Shapes Festive Party Scene Layout
like
Find Similar
Dark green 10cm honeycomb paper Christmas tree ornament with elegant hanging string - 10cm Multi-layer Christmas Tree / Green
Creamy white 10cm honeycomb paper Christmas tree ornament with festive green background - 10cm Multi-layer Christmas Tree / Beige
Red honeycomb paper lantern ornament for Christmas decor 10x8cm festive hanging craft - 10cm Lantern / Red
Red honeycomb paper lantern centerpiece 10cm Christmas tree hanging decoration - 10cm Gourd Lantern / Red
+19
Christmas Honeycomb Paper Ornaments Xmas Tree Hanging Decorations Snowman Bell Candy Shapes Festive Party Scene Layout
$1.01
No MOQ
Free Shipping
Christmas Ceramic Mug With Reindeer Spoon And Red Bow Handle Lid Festive Santa Snowman Coffee Water Cup Holiday Gift
Christmas Ceramic Mug With Reindeer Spoon And Red Bow Handle Lid Festive Santa Snowman Coffee Water Cup Holiday Gift
like
Find Similar
Close-up of a white Christmas ceramic mug featuring a red bow handle and a reindeer lid - Santa Claus
Christmas ceramic mug with red bow handle, reindeer motif, and matching golden spoon set - Elk
Christmas ceramic mug with red bow handle and Santa Claus print with reindeer spoon - Christmas Gift
White Christmas ceramic mug featuring snowman pattern, red bow handle and reindeer spoon - Snowman
Christmas Ceramic Mug With Reindeer Spoon And Red Bow Handle Lid Festive Santa Snowman Coffee Water Cup Holiday Gift
$4.18
No MOQ
 · 
11 sold recently
Christmas Hair Bows Alligator Clips Grosgrain Ribbon Snowman Christmas Tree Print Holiday Headwear Accessories For Girls Kids
Christmas Hair Bows Alligator Clips Grosgrain Ribbon Snowman Christmas Tree Print Holiday Headwear Accessories For Girls Kids
like
Find Similar
Detail of red Christmas bow hair clip with snowflake pattern and textured ribbon - Red Snowflake Polka Dot (1)
Christmas green ribbon bow hair clip with white snowflakes and red dots on white background - Green Snowflake Polka Dot (2)
Christmas hair clip with festive tree print on white grosgrain ribbon for girls - White Red Green Christmas Tree Style (3)
Christmas hair clip with white grosgrain ribbon bow featuring gift box and dot prints - White Gift Box Polka Dot Style (4)
+8
Christmas Hair Bows Alligator Clips Grosgrain Ribbon Snowman Christmas Tree Print Holiday Headwear Accessories For Girls Kids
$0.23
Mix MOQ : 10
 · 
379 sold recently
Christmas Mini Figurines Resin Santa Snowman Reindeer Sleigh Train Micro Landscape Desktop Decoration DIY Fairy Garden
Christmas Mini Figurines Resin Santa Snowman Reindeer Sleigh Train Micro Landscape Desktop Decoration DIY Fairy Garden
like
Find Similar
Miniature golden Christmas bell ornament with a red bow tie in a snowy scene, size 2cm - Style 8 Bell
Miniature Santa Claus resin figurine in red and white colors measuring 3.7cm x 2.7cm - Santa Claus No. 7
Miniature Christmas snowman figurine with red hat and star, size 3cm by 2cm - Snowman No. 1
Miniature resin Christmas snowman figurine with red hat, dimensions 3cm height by 2cm width - Snowman No. 2
+22
Christmas Mini Figurines Resin Santa Snowman Reindeer Sleigh Train Micro Landscape Desktop Decoration DIY Fairy Garden
-4%
$0.12-1.02
No MOQ
 · 
43 sold recently
Christmas Silicone Bead Wristlet Keychain For Women Snowman Santa Claus Tassel Bracelet Holiday Party Gift Keychain Accessory
Christmas Silicone Bead Wristlet Keychain For Women Snowman Santa Claus Tassel Bracelet Holiday Party Gift Keychain Accessory
like
Find Similar
Detail of Christmas silicone bead wristlet keychain with snowman motif and red tassel - Snowflake Shape Beads with Red Tassel (Style 6)
Silicone bead Christmas bracelet keychain with snowman pendant and red tassel detail - Snowflake Pendant with Red Tassel (Style 8)
Christmas snowman silicone bead keychain bracelet with festive tassels and gold clasp - Snowman Figure with White Print Tassel (Style 9)
Detail of Christmas beaded keychain with snowman charm and white tassel on green grass - Snowman Pendant with White Tassel (Style 1)
+5
Christmas Silicone Bead Wristlet Keychain For Women Snowman Santa Claus Tassel Bracelet Holiday Party Gift Keychain Accessory
$3.54
Mix MOQ : 2
 · 
37 views
Free Shipping
Christmas Gift Bags Plastic Drawstring Ribbon Tie Festive Candy Packaging Snack Pouches Santa Snowman Pattern Holiday Party
Christmas Gift Bags Plastic Drawstring Ribbon Tie Festive Candy Packaging Snack Pouches Santa Snowman Pattern Holiday Party
like
Find Similar
Purple glossy Christmas gift bag with festive characters and a white ribbon bow - Small / Snowman Purple
Golden Christmas drawstring gift bag with snowflake texture and white ribbon bow - Medium / Laser Gold
White and gold Christmas drawstring gift bag with Merry Christmas reindeer print - Large / Elk Gold
Red Christmas drawstring gift bag featuring Santa Claus, reindeer and Merry Christmas text - Small / Christmas Red
+37
Christmas Gift Bags Plastic Drawstring Ribbon Tie Festive Candy Packaging Snack Pouches Santa Snowman Pattern Holiday Party
$0.14-8.01
No MOQ
Christmas Charms Alloy Enamel Pendants Santa Tree Snowman Reindeer For DIY Jewelry Making Bracelet Necklace Holiday Festive Decor
Christmas Charms Alloy Enamel Pendants Santa Tree Snowman Reindeer For DIY Jewelry Making Bracelet Necklace Holiday Festive Decor
like
Find Similar
Detailed view of alloy Christmas gift box charm with red enamel and green bow for DIY jewelry - Christmas Gift Box (Style 15)
Detail of two gold enamel reindeer charms for DIY Christmas jewelry and necklace making - Golden Reindeer (1)
Detailed macro of festive elk charms with colorful oil drip enamel and gold metal finish - Elk Head (2)
Detail of cartoon reindeer enamel charms with red scarf for DIY jewelry making - Colorful Elk (3)
+37
Christmas Charms Alloy Enamel Pendants Santa Tree Snowman Reindeer For DIY Jewelry Making Bracelet Necklace Holiday Festive Decor
$0.04-0.07
Mix MOQ : 10
 · 
12 views
Christmas Headband Reindeer Antler Sequin Snowman Santa Party Decoration Accessory For Kids Adults
Christmas Headband Reindeer Antler Sequin Snowman Santa Party Decoration Accessory For Kids Adults
like
Find Similar
Detail of red Christmas headband featuring spring-mounted socks with white snowflakes - TK45 Small Boots
Detail of Christmas headband with plush red Santa Claus hats and white polka dots décor - TK42-1 Polka Dot Santa
Christmas headband with green sequin trees and white feathers on a red frame - TK37 Feather Green Twin Trees
Detail of Christmas headband with green glitter trees on silver springs and red velvet band - TK38 Round Sequin Green Twin Trees
+23
Christmas Headband Reindeer Antler Sequin Snowman Santa Party Decoration Accessory For Kids Adults
$0.56-0.84
Mix MOQ : 2
 · 
24 sold recently
LED String Lights Transparent Christmas Bulb Miniature Santa Snowman Tree Landscape Holiday Party Home Decor
LED String Lights Transparent Christmas Bulb Miniature Santa Snowman Tree Landscape Holiday Party Home Decor
like
Find Similar
Christmas LED string lights with Santa and snowman figurines in decorative bulbs - Christmas Mixed Style 1.5M 10LEDs Battery Powered
Christmas LED string lights with miniature snow-covered trees inside clear bulbs - Christmas Tree Style 1.5M 10LEDs Battery Powered
+16
LED String Lights Transparent Christmas Bulb Miniature Santa Snowman Tree Landscape Holiday Party Home Decor
$2.82-14.06
No MOQ
Christmas Gift Bags Red Velvet Drawstring Candy Pouches Cartoon Santa Snowman Pattern For Holiday Party Favors Decoration
Christmas Gift Bags Red Velvet Drawstring Candy Pouches Cartoon Santa Snowman Pattern For Holiday Party Favors Decoration
like
Find Similar
Red velvet Christmas drawstring gift bag with Santa Claus cartoon and snowflakes - 20*30cm / Santa Claus
Red velvet Christmas drawstring gift bag with Santa Claus and snowflakes print - 20*30cm / Classic Santa Claus
Red velvet Christmas drawstring gift bag with merry Christmas text and tree pattern - 20*30cm / Christmas Tree
Red velvet Christmas drawstring bag featuring gingerbread man embroidery and snowflakes - 20*30cm / Gingerbread Man
+11
Christmas Gift Bags Red Velvet Drawstring Candy Pouches Cartoon Santa Snowman Pattern For Holiday Party Favors Decoration
$0.24-0.58
Mix MOQ : 2
 · 
49 sold recently
Christmas Placemats Linen Polyester Blend Waterproof Heat Resistant Holiday Dining Table Decor Reindeer Snowman Gnomes Print
Christmas Placemats Linen Polyester Blend Waterproof Heat Resistant Holiday Dining Table Decor Reindeer Snowman Gnomes Print
like
Find Similar
Christmas placemat with cartoon reindeer pattern and striped border on green table - Waterproof Linen / CD30-1
Christmas placemat with cute reindeer design and festive decorations on green background - Waterproof Linen / CD30-2
Christmas placemat with snowman and reindeer on black and white buffalo plaid fabric - Waterproof Linen / CD30-3
Close-up of a Christmas placemat with buffalo plaid and Santa Claus illustration fabric - Waterproof Linen / CD30-4
+38
Christmas Placemats Linen Polyester Blend Waterproof Heat Resistant Holiday Dining Table Decor Reindeer Snowman Gnomes Print
$1.01-1.38
Mix MOQ : 2
Christmas Gift Bag Drawstring Candy Pouch Linen Felt Santa Snowman Reindeer Holiday Party Decoration Handheld Tote
Christmas Gift Bag Drawstring Candy Pouch Linen Felt Santa Snowman Reindeer Holiday Party Decoration Handheld Tote
like
Find Similar
Green non-woven Christmas gift bag with 3D reindeer and Christmas tree decoration - Small Striped Handle Reindeer
Red velvet Christmas drawstring gift bag with 3D Santa Claus doll and snowflakes - 20*23CM / Red Santa Drawstring Bag
Red Christmas drawstring gift bag with 3D polar bear doll and white snowflake prints - 20*23CM / Red Polar Bear Drawstring Bag
Christmas gift bag with Santa Claus motif, red drawstring handle, and golden bow decoration - 20*23CM / Snowflake Handle Santa
+20
Christmas Gift Bag Drawstring Candy Pouch Linen Felt Santa Snowman Reindeer Holiday Party Decoration Handheld Tote
-5%
$0.77-1.37
No MOQ
 · 
36 sold recently
Christmas Cushion Cover Peach Skin Fabric Snowman Santa Reindeer Winter Home Decor Square Pillowcase
Christmas Cushion Cover Peach Skin Fabric Snowman Santa Reindeer Winter Home Decor Square Pillowcase
like
Find Similar
Christmas peach skin pillowcase with Santa and gift sock illustration on white base - 18x18 Inch / Santa and Large Stocking Style (1)
Merry Christmas peach skin pillow featuring Santa Claus and winter holly design - 18x18 Inch / Santa and Holly Tree Style (2)
Christmas snowman and festive pine tree printed square pillow cover in peach skin fabric - 18x18 Inch / Snowman and Christmas Tree Illustration Style (3)
Christmas peach skin pillow cover with hand-drawn festive icons on white background - 18x18 Inch / Christmas Element Grid Collection Style (4)
+36
Christmas Cushion Cover Peach Skin Fabric Snowman Santa Reindeer Winter Home Decor Square Pillowcase
$1.09
No MOQ
Christmas Pet Knitted Scarf Bandana Hand Crocheted Adjustable Dog Cat Collar Bib Cartoon Santa Snowman Reindeer Holiday
Christmas Pet Knitted Scarf Bandana Hand Crocheted Adjustable Dog Cat Collar Bib Cartoon Santa Snowman Reindeer Holiday
like
Find Similar
Christmas snowman pet collar handmade red knitted scarf for cats and small dogs - XS (1-2kg) / Snowman
Handmade red knitted Christmas cat scarf with 3D Santa Claus patch and snowflake detail - XS (1-2kg) / Santa Claus
Knitted Christmas pet collar featuring a plush reindeer design with white snowflake patterns - XS (1-2kg) / Elk
Christmas pet collar with red knitted scarf and yellow glove charm for small dogs and cats - XS (1-2kg) / Christmas Sock
+36
Christmas Pet Knitted Scarf Bandana Hand Crocheted Adjustable Dog Cat Collar Bib Cartoon Santa Snowman Reindeer Holiday
$1.70
No MOQ
Free Shipping
Christmas Stud Earrings Resin Alloy Cartoon Santa Claus Reindeer Snowman Tree Bell Candy Cane Holiday Festive Jewelry For Women
Christmas Stud Earrings Resin Alloy Cartoon Santa Claus Reindeer Snowman Tree Bell Candy Cane Holiday Festive Jewelry For Women
like
Find Similar
Detail of Christmas candy cane earrings with pink flowers on a green base - Green Candy Cane
Close-up of handmade Santa Claus resin earrings on a decorative white porcelain plate - White Santa Claus
Christmas candy cane stud earrings with red and white stripes and green holly leaf detail - Red Candy Cane
Handcrafted Christmas snowman earrings with festive red background for holiday accessories - White Snowman
+10
Christmas Stud Earrings Resin Alloy Cartoon Santa Claus Reindeer Snowman Tree Bell Candy Cane Holiday Festive Jewelry For Women
$0.47
No MOQ
 · 
283 sold recently
Free Shipping
Christmas Crystal Ball Music Box Resin Glass Luminous LED Light Automatic Snowfall Santa Claus Snowman Festive Decor Gift
Christmas Crystal Ball Music Box Resin Glass Luminous LED Light Automatic Snowfall Santa Claus Snowman Festive Decor Gift
like
Find Similar
Detail of Christmas crystal ball music box with Santa and red house base design - 2022-3 Bear with Cart / 80# Light + Music
Detailed view of Santa Claus and Christmas tree inside a festive glass snow globe - 2041-3 Climbing to Catch Stars / 80# Light + Music
Detail view of a Christmas crystal ball music box featuring Santa Claus and a gift bag base - 2136Y Deer / 80# Light + Music
Close-up of Christmas crystal ball featuring Santa Claus and snowman with red base - 2021-3 Snowman / 80# Light + Music
+13
Christmas Crystal Ball Music Box Resin Glass Luminous LED Light Automatic Snowfall Santa Claus Snowman Festive Decor Gift
$4.87-8.62
Mix MOQ : 2
 · 
10 views
Miniature Christmas Dollhouse Decoration Resin Plastic Gingerbread Man Snowman Reindeer Wreath Tiny Festive Micro Landscape Ornaments
Miniature Christmas Dollhouse Decoration Resin Plastic Gingerbread Man Snowman Reindeer Wreath Tiny Festive Micro Landscape Ornaments
like
Find Similar
Detailed size chart for miniature Christmas resin figures including trees and snowmen - 20-Piece Christmas Set (Boxed)
Christmas dollhouse miniatures set with snowman gingerbread man and reindeer figurines - 22-Piece Christmas Set A (Boxed)
Miniature dollhouse Christmas ornaments set with gingerbread man, snowman and wreath - 22-Piece Christmas Set B (Boxed)
Miniature Christmas Dollhouse Decoration Resin Plastic Gingerbread Man Snowman Reindeer Wreath Tiny Festive Micro Landscape Ornaments
-5%
$7.88
Mix MOQ : 2
 · 
18 views
Free Shipping
Macaron Pink Christmas Tree Hanging Ornaments Foam Dessert Candy Donut Cupcake Snowman Glitter Xmas Decor Party Home
Macaron Pink Christmas Tree Hanging Ornaments Foam Dessert Candy Donut Cupcake Snowman Glitter Xmas Decor Party Home
like
Find Similar
Blue waffle texture Christmas candy cane ornament with white snow decor and tassels - Blue Candy Cane
Pink macaron candy cane Christmas tree ornament with white snow topping and colorful beads - Pink Candy Cane
Pink macaron ice cream cone Christmas tree ornament with glitter and blue ribbon - Blue Ice Cream
Pink ribbon light blue cartoon house candy Christmas tree ornament 13x11cm decor - Blue Christmas House
+16
Macaron Pink Christmas Tree Hanging Ornaments Foam Dessert Candy Donut Cupcake Snowman Glitter Xmas Decor Party Home
$1.44-5.42
No MOQ
Free Shipping
Christmas Snowman Glass Cup Red Printed Festive Cartoon Milk Coffee Water Mug Soda Lime Glass Clear Drinking Vessel
Christmas Snowman Glass Cup Red Printed Festive Cartoon Milk Coffee Water Mug Soda Lime Glass Clear Drinking Vessel
like
Find Similar
Transparent Christmas snowman glass cup with red merry Christmas print for milk - 350ml / Short Version
Christmas snowman glass cup with red festive prints of trees and merry christmas text - 350ml / Large Version
Christmas Snowman Glass Cup Red Printed Festive Cartoon Milk Coffee Water Mug Soda Lime Glass Clear Drinking Vessel
$1.73
No MOQ
Christmas LED Lantern Retro Telephone Booth Santa Snowman Ornament Mini Hanging Night Light Desktop Holiday Decor Gift
Christmas LED Lantern Retro Telephone Booth Santa Snowman Ornament Mini Hanging Night Light Desktop Holiday Decor Gift
like
Find Similar
White LED Christmas lantern with snowman motifs and warm lighting 14.5cm tall - Small White Cartoon Snowman
Red LED Christmas lantern with Santa Claus and reindeer graphics on a 13cm height frame - Small Red Cartoon Santa
White Christmas LED lantern featuring snowman design, 13cm tall festive decor piece - Square White Snowman
Vintage gold bronze LED angel lantern ornament with glowing musical motif 13cm - Square Golden Angel
+8
Christmas LED Lantern Retro Telephone Booth Santa Snowman Ornament Mini Hanging Night Light Desktop Holiday Decor Gift
$0.29-0.58
Mix MOQ : 2
 · 
20 views
Christmas Miniature Coffee Cup Charms Resin DIY Craft Decor Latte Art Gingerbread Man Snowman Dollhouse Accessories Festive
Christmas Miniature Coffee Cup Charms Resin DIY Craft Decor Latte Art Gingerbread Man Snowman Dollhouse Accessories Festive
like
Find Similar
Miniature resin coffee cups and tiny pastries set in a cozy warm bakery scene - Mixed Christmas Coffee Cups
Christmas Miniature Coffee Cup Charms Resin DIY Craft Decor Latte Art Gingerbread Man Snowman Dollhouse Accessories Festive
$0.09
Mix MOQ : 10
 · 
34 views
Christmas Snow Globe LED Lighted Glitter Water Lantern Santa Claus Snowman Micro Landscape Retro Desktop Ornament
Christmas Snow Globe LED Lighted Glitter Water Lantern Santa Claus Snowman Micro Landscape Retro Desktop Ornament
like
Find Similar
Retro red 30cm Christmas lantern snow globe with snowman and festive LED lighting - Large Classic Red Snowman & Tree
Vintage bronze Christmas train snow globe with snowman and glitter, 15cm tabletop lamp - Bronze Train Christmas Snowman Broom
Vintage bronze musical Christmas lantern with elk and tree scene for tabletop decor - Small Classic Tag Reindeer
25cm white Christmas lantern with snowman family scene and flowing golden glitter - Small White Three Snowmen
+22
Christmas Snow Globe LED Lighted Glitter Water Lantern Santa Claus Snowman Micro Landscape Retro Desktop Ornament
$28.24-31.12
No MOQ
 · 
19 views
Glowing LED Spring Wand Toy Plastic Metal Halloween Christmas Party Favor Cartoon Pumpkin Snowman Handheld Flash Stick
Glowing LED Spring Wand Toy Plastic Metal Halloween Christmas Party Favor Cartoon Pumpkin Snowman Handheld Flash Stick
like
Find Similar
Glowing Halloween pumpkin magic wand with wizard hat and flexible metal spring on black background - Wizard Spring Stick
Halloween glowing wand featuring dual pumpkin heads with red LED light and spring neck - Double Head Pumpkin Spring Stick
Halloween glowing pumpkin spring wand with colorful LED light and classic smiling face - Single Head Pumpkin Spring Stick
Halloween glowing skull hand wand toy with colorful LED light and red handle - Skeleton Spring Stick
Glowing LED Spring Wand Toy Plastic Metal Halloween Christmas Party Favor Cartoon Pumpkin Snowman Handheld Flash Stick
$0.40
No MOQ
 · 
38 views
Christmas Enamel Stainless Steel Charms For DIY Jewelry Making Pendants Santa Claus Reindeer Snowman Tree Gold Plated
Christmas Enamel Stainless Steel Charms For DIY Jewelry Making Pendants Santa Claus Reindeer Snowman Tree Gold Plated
like
Find Similar
Gold stainless steel Santa Claus pendant with red and white enamel for DIY jewelry - Santa Claus (G1)
Christmas tree enamel stainless steel pendant charm with golden star for DIY jewelry - Christmas Tree (G2)
Stainless steel Santa Claus enamel charm for jewelry making with dimensions 14x10mm - Santa Claus (G3)
Enamel gingerbread man pendant in stainless steel with precise size measurements - Gingerbread Man (G4)
+23
Christmas Enamel Stainless Steel Charms For DIY Jewelry Making Pendants Santa Claus Reindeer Snowman Tree Gold Plated
$1.02
Mix MOQ : 2
 · 
12 views
Free Shipping
Go to

More in party supplies

Explore more in snowmen

holidaypartyhangingdesktopmakinghandshapeswindowballpointbracelet necklace
diyresinmankidswarmsteelgirlsmetalphoneunisex

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access