Everful

Wholesale snowmen

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Snowmen

Find the perfect pieces: christmas supplies, halloween supplies and more

All products in snowmen

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Christmas Tree Hanging Ornaments Plush Fabric Felt Knitted Santa Snowman Reindeer Bear Festive Holiday Decor Home Party
Christmas Tree Hanging Ornaments Plush Fabric Felt Knitted Santa Snowman Reindeer Bear Festive Holiday Decor Home Party
like
Find Similar
Plush Santa Claus ornament with red hat and golden strap for Christmas tree decoration - Santa Claus Style
Christmas bear ornament made of felt fabric with red deer pattern hat and gold lanyard - Christmas Bear Style
Christmas reindeer plush ornament with green body, orange antlers, and red boots decoration - Reindeer Style
Christmas snowman ornament with Nordic knit hat, red boots and sparkling gems decoration - Christmas Snowman Style
Christmas Tree Hanging Ornaments Plush Fabric Felt Knitted Santa Snowman Reindeer Bear Festive Holiday Decor Home Party
$0.52
No MOQ
 · 
44 sold recently
Christmas Wooden Mini Train Ornament Locomotive Carriage Snowman Bear Festive Home Desktop Table Decoration Colorful Novelty
Christmas Wooden Mini Train Ornament Locomotive Carriage Snowman Bear Festive Home Desktop Table Decoration Colorful Novelty
like
Find Similar
Detailed view of handcrafted wooden Christmas train set with festive bear and snowman figures - Red
Close-up of white and gold wooden Christmas train with snowman and bear figurines - White
Detail view of a red and green wooden Christmas train with hand-painted holiday figurines - Green
Christmas Wooden Mini Train Ornament Locomotive Carriage Snowman Bear Festive Home Desktop Table Decoration Colorful Novelty
$1.96
No MOQ
 · 
94 sold recently
Christmas Hanging Ornaments Resin Tree Decorations Snowman Gingerbread Man Santa Sleigh Bell Vintage Style With Jute Rope
Christmas Hanging Ornaments Resin Tree Decorations Snowman Gingerbread Man Santa Sleigh Bell Vintage Style With Jute Rope
like
Find Similar
Hanging resin Christmas snowman ornament with red hat and green gift box, 8cm height - Snowman with Gift Box
Hanging resin Santa Claus ornament with gift box for Christmas tree decor, 8cm height - Santa Claus
Vintage white resin rocking horse Christmas ornament with red base and gift boxes decoration - Vintage Rocking Horse
Christmas resin red glove ornament with gold star and holly detail, 5cm size - Christmas Glove Style
+18
Christmas Hanging Ornaments Resin Tree Decorations Snowman Gingerbread Man Santa Sleigh Bell Vintage Style With Jute Rope
$0.85-1.10
No MOQ
 · 
42 sold recently
Christmas Cushion Covers Polyester Decorative Throw Pillow Cases For Home Sofa Winter Holiday Decor Santa Snowman Pattern
Christmas Cushion Covers Polyester Decorative Throw Pillow Cases For Home Sofa Winter Holiday Decor Santa Snowman Pattern
like
Find Similar
Set of four vintage Christmas pillow covers with Santa, tree, and berry motifs on beige fabric - 45*45cm (Insert Not Included) / Christmas Tree and Santa Series (JYM541 Series)
Set of four Christmas pillow covers with watercolor trees and snowflakes motifs - 45*45cm (Insert Not Included) / Black and White Grid Bow Series (JYM493 Series)
Set of 4 Christmas pillow covers with snowman and tree patterns in blue and beige - 45*45cm (Insert Not Included) / Blue and White Modern Christmas Series (JYM494 Serie)
Set of 4 Christmas pillow covers with reindeer, snowman, and plaid polyester patterns - 45*45cm (Insert Not Included) / Reindeer and Snowman Illustration Series (JYM347 Serie)
+52
Christmas Cushion Covers Polyester Decorative Throw Pillow Cases For Home Sofa Winter Holiday Decor Santa Snowman Pattern
$1.15-4.61
Mix MOQ : 2
Christmas Miniature Figurines Resin Santa Claus Snowman Elk Micro Landscape DIY Decoration Desktop Holiday Gift Cartoon
Christmas Miniature Figurines Resin Santa Claus Snowman Elk Micro Landscape DIY Decoration Desktop Holiday Gift Cartoon
like
Find Similar
Mini Christmas Santa Claus resin figurine for micro landscapes, height 3.7cm and width 3.3cm - Raising Hand Santa
Miniature Santa Claus figurine for DIY Christmas micro landscape decor, 3.8cm tall - Santa Claus Giving Gifts
Miniature brown wooden ladder with faux snow for Christmas DIY micro landscape decor - Snow Ladder
Miniature red and gold Christmas sleigh DIY ornament model, 3.6cm length and 2.3cm height - Single Sled
+8
Christmas Miniature Figurines Resin Santa Claus Snowman Elk Micro Landscape DIY Decoration Desktop Holiday Gift Cartoon
$0.14-0.45
Mix MOQ : 3
 · 
62 sold recently
Free Shipping
Christmas Tree Snowman Silicone Molds For Candle Making DIY Plaster Soap Resin Cake Chocolate Baking Flexible Novelty
Christmas Tree Snowman Silicone Molds For Candle Making DIY Plaster Soap Resin Cake Chocolate Baking Flexible Novelty
like
Find Similar
Snowman silicone mold for DIY candles and chocolates with detailed product dimensions - Snowman
Christmas Tree Snowman Silicone Molds For Candle Making DIY Plaster Soap Resin Cake Chocolate Baking Flexible Novelty
-13%
$1.86
No MOQ
 · 
23 views
Christmas Cotton Crew Socks Breathable Mid Calf Santa Reindeer Snowman Patterns Holiday Theme For Men And Women
Christmas Cotton Crew Socks Breathable Mid Calf Santa Reindeer Snowman Patterns Holiday Theme For Men And Women
like
Find Similar
Mismatched Christmas crew socks with Santa Claus, Reindeer and Merry Christmas patterns - One Size (35-43) / Black Sunglasses Santa (1109)
Green Christmas crew socks with red accents and festive Santa Claus scooter pattern - One Size (35-43) / Green Christmas Skateboarding (1110)
Christmas socks set featuring festive gnomes and holiday light patterns on gray and red - One Size (35-43) / Grey Christmas Gnomes (1111)
Christmas socks featuring masked Santa Claus and reindeer designs in red and black - One Size (35-43) / Red Masked Santa (1112)
+4
Christmas Cotton Crew Socks Breathable Mid Calf Santa Reindeer Snowman Patterns Holiday Theme For Men And Women
$1.44
No MOQ
 · 
1 reviews
Christmas Washi Tape Gold Foil Decorative Masking Tape DIY Journaling Scrapbooking Santa Reindeer Snowman Pattern Festive
Christmas Washi Tape Gold Foil Decorative Masking Tape DIY Journaling Scrapbooking Santa Reindeer Snowman Pattern Festive
like
Find Similar
Close-up of multicolored Christmas washi tape rolls with Santa and reindeer patterns - 16 Rolls Gold Stamping Set (YD-DS041)
Detailed view of Christmas washi tape set with red and green festive patterns and gold foil - 12 Rolls Gold Stamping Set (YD-DS032)
Detailed Christmas washi tape set with gold foil patterns in a festive gift box packaging - Boxed Set - Snowflake (YD-DS073)
Detailed boxed Christmas washi tape set with festive red and green foil gold patterns - Boxed Set - Gingerbread Man (YD-DS075)
+4
Christmas Washi Tape Gold Foil Decorative Masking Tape DIY Journaling Scrapbooking Santa Reindeer Snowman Pattern Festive
$2.82-5.31
No MOQ
 · 
16 sold recently
Double Sided Christmas Garden Flag Linen Polyester Outdoor Yard Banner Snowman Santa Claus Red Truck Holiday House Decor
Double Sided Christmas Garden Flag Linen Polyester Outdoor Yard Banner Snowman Santa Claus Red Truck Holiday House Decor
like
Find Similar
Christmas snowman garden flag with Let it Snow text and metal stake on green lawn - Snowman Let It Snow Style (HYQ63-1)
Christmas garden flag featuring a snowman with trees and handwritten Welcome message - Inferred Snowman Welcome Style (HYQ63-2)
Christmas snowman garden flag with plaid scarf and birds in front of a yellow house - Snowman And Bird Style (HYQ63-3)
Christmas garden flag with snowmen, cat and birds illustration on linen fabric texture - Three Snowmen And Cat Style (HYQ63-4)
+8
Double Sided Christmas Garden Flag Linen Polyester Outdoor Yard Banner Snowman Santa Claus Red Truck Holiday House Decor
$1.59
Mix MOQ : 2
 · 
34 sold recently
Christmas LED Lantern Snow Globe Ornament Retro Style Tabletop Decor Santa Snowman Micro Landscape Glowing Holiday Gift
Christmas LED Lantern Snow Globe Ornament Retro Style Tabletop Decor Santa Snowman Micro Landscape Glowing Holiday Gift
like
Find Similar
Vintage bronze Christmas lantern with Santa Claus and tree, glowing warm holiday ornament - Brushed Gold Santa Claus
Vintage bronze Christmas lantern with illuminated snowman scene on a wooden tray - Brushed Gold Snowman
Golden Christmas lantern ornament with miniature tree and warm LED lighting display - Brushed Gold Christmas Tree
Red Christmas telephone booth lantern with Santa Claus and sparkling snow scene inside - Red Telephone Booth Santa Claus
+17
Christmas LED Lantern Snow Globe Ornament Retro Style Tabletop Decor Santa Snowman Micro Landscape Glowing Holiday Gift
-5%
$1.92-6.84
No MOQ
 · 
68 sold recently
Christmas Brooches Pins Alloy Rhinestone Enamel Reindeer Snowman Xmas Tree Wreath Bell Boot Festive Holiday Jewelry For Women
Christmas Brooches Pins Alloy Rhinestone Enamel Reindeer Snowman Xmas Tree Wreath Bell Boot Festive Holiday Jewelry For Women
like
Find Similar
Festive Santa Claus riding a reindeer carousel brooch with gold plating and crystals - Reindeer and Santa
Detailed view of a gold reindeer head brooch with textured finish and rear pin fastener - Christmas Deer Head
Christmas stocking brooch in gold alloy with colorful enamel and sparkling rhinestones - Christmas Stocking
Detailed view of snowman Christmas brooch with red hat and sparkling rhinestones inlay - Christmas Snowman
+64
Christmas Brooches Pins Alloy Rhinestone Enamel Reindeer Snowman Xmas Tree Wreath Bell Boot Festive Holiday Jewelry For Women
-14%
$0.32-14.50
No MOQ
 · 
93 sold recently
Free Shipping
Christmas Wine Bottle Cover Knitted Mini Sweater And Hat Holiday Table Decor Santa Snowman Reindeer Cartoon Embroidery
Christmas Wine Bottle Cover Knitted Mini Sweater And Hat Holiday Table Decor Santa Snowman Reindeer Cartoon Embroidery
like
Find Similar
Detail of knitted Christmas wine bottle cover with Santa applique and mini hat decorations - Santa Claus
Detailed view of Christmas wine bottle cover with snowman embroidery and striped hat - Snowman
Christmas Wine Bottle Cover Knitted Mini Sweater And Hat Holiday Table Decor Santa Snowman Reindeer Cartoon Embroidery
$1.37
No MOQ
 · 
17 sold recently
Christmas Knitted Wine Bottle Cover Mini Sweater Reindeer Snowman Bell Patterns Festive Dining Table Party Decor Home
Christmas Knitted Wine Bottle Cover Mini Sweater Reindeer Snowman Bell Patterns Festive Dining Table Party Decor Home
like
Find Similar
Christmas knit wine bottle sweater with red bow and mini wreath holiday decor - Wreath Style
Knitted blue Christmas wine bottle sweater with snowman embroidery for holiday decor - Snowman
Knitted Christmas wine bottle cover featuring a reindeer pattern in festive red and green - Elk Style
Knitted Christmas wine bottle cover in green and red with festive berry embroidery - Style with Bells
Christmas Knitted Wine Bottle Cover Mini Sweater Reindeer Snowman Bell Patterns Festive Dining Table Party Decor Home
$2.02
Mix MOQ : 2
 · 
130 sold recently
Christmas Decorative Pillow Covers Linen Red White Square Cushion Case With Santa Snowman Christmas Tree For Home Sofa Bedroom Jewelry
Christmas Decorative Pillow Covers Linen Red White Square Cushion Case With Santa Snowman Christmas Tree For Home Sofa Bedroom Jewelry
like
Find Similar
Red Christmas Santa Claus throw pillow cover with vintage stripes and holly decorations - Vintage Santa Claus Style (YMD378-1)
Festive Christmas pillow case featuring a snowman with bird on a red and white striped backdrop - Hatted Snowman Style (YMD378-2)
Red Christmas pillow cover with Hello Winter text and minimalist holiday ornaments - Ymd378-3 / 45*45cm (No Insert)
Red Christmas pillowcase with white tree print and Sweet Christmas text on white background - Ymd378-4 / 45*45cm (No Insert)
NewChristmas Decorative Pillow Covers Linen Red White Square Cushion Case With Santa Snowman Christmas Tree For Home Sofa Bedroom Jewelry
$1.38
Mix MOQ : 2
 · 
12 views
Christmas Square Tinplate Metal Gift Packaging Boxes Embossed Festive Patterns Santa Snowman Candy Storage For Holiday Party
Christmas Square Tinplate Metal Gift Packaging Boxes Embossed Festive Patterns Santa Snowman Candy Storage For Holiday Party
like
Find Similar
Christmas tin box set with snowman and Santa patterns on a rustic wooden table surface - Christmas Square Tin Boxes (Pack of 12)
12-pack Christmas tin gift boxes featuring festive illustrations in a display case - Christmas Square Boxes (Pack of 12)
Christmas Square Tinplate Metal Gift Packaging Boxes Embossed Festive Patterns Santa Snowman Candy Storage For Holiday Party
$13.84
No MOQ
 · 
11 sold recently
Christmas Stockings Burlap Plaid 3D Cartoon Santa Snowman Reindeer Bear Xmas Gift Bag Hanging Decor Party Ornament
Christmas Stockings Burlap Plaid 3D Cartoon Santa Snowman Reindeer Bear Xmas Gift Bag Hanging Decor Party Ornament
like
Find Similar
Beige linen Christmas stocking featuring a 3D plush snowman and festive plaid cuff decoration - Snowman Style Original Linen (E-W30)
Light blue Christmas stocking with plaid trim and 3D teddy bear applique detail - Bear Style Blue (E-W32)
Plaid burlap Christmas stocking featuring a 3D Santa Claus figure and hanging loop - Santa Style Red (E-W29)
Green burlap Christmas stocking with 3D cartoon reindeer and red-green plaid cuff - Reindeer Style Fruit Green (E-W31)
NewChristmas Stockings Burlap Plaid 3D Cartoon Santa Snowman Reindeer Bear Xmas Gift Bag Hanging Decor Party Ornament
-4%
$1.92
Mix MOQ : 2
 · 
10 views
Christmas Music Box Resin Glowing Ornament Rotating Train LED Light Festive Desktop Decor Holiday Gift Santa Snowman
Christmas Music Box Resin Glowing Ornament Rotating Train LED Light Festive Desktop Decor Holiday Gift Santa Snowman
like
Find Similar
Macro shot of snowman figurine with built-in glowing miniature village LED Christmas scene - Snowman Train Style
Detail of Santa Claus music box with glowing LED scene and festive resin craftsmanship - Santa Claus Train Style
Close-up of LED glowing gingerbread house Christmas ornament with sugar-like textures - Gingerbread Man Train Style
Detail of Christmas tree resin box with LED lights, mini train and snow-effect base - Christmas Tree Train Style
+33
Christmas Music Box Resin Glowing Ornament Rotating Train LED Light Festive Desktop Decor Holiday Gift Santa Snowman
-5%
$10.07-27.65
No MOQ
 · 
1 reviews
Christmas Socks Coral Fleece Thickened Warm Thermal Indoor Floor Home Sleeping Socks Women Cute Cartoon Santa Snowman Gift
Christmas Socks Coral Fleece Thickened Warm Thermal Indoor Floor Home Sleeping Socks Women Cute Cartoon Santa Snowman Gift
like
Find Similar
Green coral fleece Christmas socks featuring Santa Claus embroidery for winter warmth - Star Santa Claus
Brown coral fleece Christmas socks with Santa and tree patterns in warm festive setting - Brown Santa
Plush Christmas coral fleece socks in red with green tree pattern for winter warmth - Bowknot Christmas Tree
Red coral fleece Christmas socks featuring a cute white snowman pattern and soft texture - Snowflake Snowman
+7
Christmas Socks Coral Fleece Thickened Warm Thermal Indoor Floor Home Sleeping Socks Women Cute Cartoon Santa Snowman Gift
$1.12
Mix MOQ : 3
 · 
1 reviews
Handmade Christmas Doll Hanging Ornaments Felt Wood Gnome Snowman Star Shape Festive Tree Decoration Nordic Style
Handmade Christmas Doll Hanging Ornaments Felt Wood Gnome Snowman Star Shape Festive Tree Decoration Nordic Style
like
Find Similar
Handmade wooden Christmas doll pendant with red felt body and white braided hair - Red Felt Heart Girl (A1)
Handmade Christmas doll ornament with grey knit hat, black felt dress, and white braids - Grey Hat Black Skirt Heart Doll (A3)
Handmade grey felt Christmas doll ornament with red heart and white braided hair - Grey Knit Red Heart White Braids Doll (A4)
Handmade pink knitted girl doll ornament with wooden head and heart detail for Christmas - Pink Knit Red Heart Dress Doll (A5)
+31
Handmade Christmas Doll Hanging Ornaments Felt Wood Gnome Snowman Star Shape Festive Tree Decoration Nordic Style
$0.72
Mix MOQ : 2
 · 
50 sold recently
Christmas Earring Silicone Molds DIY Resin Casting Jewelry Tools Snowflake Santa Claus Snowman Gingerbread Man Patterns
Christmas Earring Silicone Molds DIY Resin Casting Jewelry Tools Snowflake Santa Claus Snowman Gingerbread Man Patterns
like
Find Similar
Christmas silicone earring mold with snowman and tree shapes for resin jewelry making - Christmas Earring Mold ED#272
Silicone mold for Christmas earrings featuring snowman and reindeer shapes, 12.9x11.9cm - Christmas Earring Mold ED#273
Christmas Earring Silicone Molds DIY Resin Casting Jewelry Tools Snowflake Santa Claus Snowman Gingerbread Man Patterns
-8%
$1.05
Mix MOQ : 2
 · 
21 views
Christmas Tree Silicone Mold DIY Scented Candle Soap Plaster Resin Crafting Santa Claus Snowman Gingerbread Man Shapes
Christmas Tree Silicone Mold DIY Scented Candle Soap Plaster Resin Crafting Santa Claus Snowman Gingerbread Man Shapes
like
Find Similar
3D spiral Christmas tree silicone mold for candles and soap with detailed dimensions - Mirror Style Spiral Leaf Tree / Milky White
3D Christmas tree silicone mold with support frame for DIY candles and soap 12.5cm - Mirror Style Needle Leaf Tree / Milky White
White silicone Christmas tree mold for DIY scented candles and handmade soap crafts - Mirror Style - Simple Small / Milky White
Translucent white 3D Santa Claus silicone mold for DIY Christmas candles and soaps - Mirror Style - Santa Claus / Milky White
+35
Christmas Tree Silicone Mold DIY Scented Candle Soap Plaster Resin Crafting Santa Claus Snowman Gingerbread Man Shapes
$1.41-12.94
Mix MOQ : 2
 · 
40 views
Christmas Cartoon Drop Earrings Resin 3D Santa Claus Snowman Tree Bell Penguin Festival Holiday Party Jewelry For Women
Christmas Cartoon Drop Earrings Resin 3D Santa Claus Snowman Tree Bell Penguin Festival Holiday Party Jewelry For Women
like
Find Similar
Cute green Christmas bell earrings with red bow detail on a clean textured background - Christmas Bell
Detailed macro view of cute resin penguin Christmas earrings with metal hooks - Penguin with Hat
Cute cartoon resin Christmas tree hook earrings with festive colorful decorations - Christmas Tree
Close-up of cute cartoon Santa Claus resin earrings with festive red and white details - Santa Claus
Christmas Cartoon Drop Earrings Resin 3D Santa Claus Snowman Tree Bell Penguin Festival Holiday Party Jewelry For Women
$0.39
Mix MOQ : 2
 · 
196 sold recently
Christmas Stockings Hanging Ornaments Plush Burlap Sequin Santa Snowman Reindeer Tree Decoration Gift Bags Holiday Home Decor
Christmas Stockings Hanging Ornaments Plush Burlap Sequin Santa Snowman Reindeer Tree Decoration Gift Bags Holiday Home Decor
like
Find Similar
Pink velvet Christmas stocking with reindeer design and white faux fur trim, 17cm height - Pink Reindeer
Christmas stocking with reindeer doll and white faux fur trim on a red knit base - Candy Color Reindeer
Blue glitter Christmas stocking with snowman applique and white faux fur trim 17cm - Candy Color Snowman
Reindeer Christmas stocking in tan fabric with plush cuff and a festive hanging loop - Brown Reindeer
+11
Christmas Stockings Hanging Ornaments Plush Burlap Sequin Santa Snowman Reindeer Tree Decoration Gift Bags Holiday Home Decor
-5%
$0.52-1.43
No MOQ
 · 
10 sold recently
Free Shipping
Christmas Ball Ornaments Handmade Wool Felt Snowflake Gingerbread Man Snowman Patterns For Holiday Tree Decor Divider Boxed
Christmas Ball Ornaments Handmade Wool Felt Snowflake Gingerbread Man Snowman Patterns For Holiday Tree Decor Divider Boxed
like
Find Similar
Set of 6 red wool felt Christmas balls with white snowflake and tree patterns in a box - Style C Red Nordic Style 5cm Set of 6
Set of 3cm Christmas wool felt balls in red and green, presented in a craft gift box - Style H Colorful Five Colors 3cm Set of 36
Set of 6 Christmas wool felt decorative balls with snowflake patterns in a gift box - Style A Classic Pattern 5cm Set of 6
6pcs Christmas wool felt balls with snowflake and tree patterns in 5cm gift box set - Style B White Holiday Elements 5cm Set of 6
+4
Christmas Ball Ornaments Handmade Wool Felt Snowflake Gingerbread Man Snowman Patterns For Holiday Tree Decor Divider Boxed
$6.34-6.92
No MOQ
 · 
10 sold recently
Free Shipping
Christmas Enamel Alloy Pendants Charms DIY Jewelry Making Bracelet Necklace Santa Claus Reindeer Snowman Snowflake Decor
Christmas Enamel Alloy Pendants Charms DIY Jewelry Making Bracelet Necklace Santa Claus Reindeer Snowman Snowflake Decor
like
Find Similar
Set of 30 Christmas enamel charms featuring Santa, reindeer, and snowflakes for DIY jewelry - Mixed 30Pcs Christmas Enamel Charms
Christmas tree charm pendant in gold alloy with red and green enamel for DIY jewelry - Christmas Tree 12x19mm
Christmas bell charm in red and green enamel with golden finish for DIY jewelry - Bell 13x13mm
Christmas stocking charm in white enamel with candy cane and gold heart pendant - Christmas Sock 10x19mm
+28
Christmas Enamel Alloy Pendants Charms DIY Jewelry Making Bracelet Necklace Santa Claus Reindeer Snowman Snowflake Decor
$0.05-2.46
Mix MOQ : 2
 · 
64 sold recently
Free Shipping
Christmas Ugly Sweater Acrylic Earrings With Glitter Reindeer Santa Snowman Holiday Party Jewelry For Women Girls
Christmas Ugly Sweater Acrylic Earrings With Glitter Reindeer Santa Snowman Holiday Party Jewelry For Women Girls
like
Find Similar
Close-up of green glitter snowman earrings displayed in a festive gift box with pine cones - Green Glitter Sweater Shape / Green Snowman
Detail of Christmas reindeer sweater earrings with red glitter finish on velvet gift box - Red Glitter Sweater Shape / Red Reindeer
Close-up of festive red glitter acrylic earrings in a Christmas sweater shape with snowflakes - Red Glitter Sweater Shape / Red Ugly Sweater
Close-up of green sweater shaped acrylic Christmas earrings with Santa Claus pattern - Green Glitter Sweater Shape / Green Santa
Christmas Ugly Sweater Acrylic Earrings With Glitter Reindeer Santa Snowman Holiday Party Jewelry For Women Girls
-4%
$0.62
No MOQ
 · 
91 sold recently
Free Shipping
Christmas Headbands Elf Hat Santa Legs Snowman Pattern Plush Sequin Cloth Plastic Festive Hair Accessories Holiday Party Decor
Christmas Headbands Elf Hat Santa Legs Snowman Pattern Plush Sequin Cloth Plastic Festive Hair Accessories Holiday Party Decor
like
Find Similar
Christmas elf hat headband with red and green felt details and striped legs for party decor - Elf Hat with Long Legs
Christmas party headband featuring Santa upside down legs with red pants and black boots - Upside Down Santa Legs
Christmas elf leg headband with red felt belt buckle and striped legs for holiday party - Red Elf Skirt
Christmas elf boots headband with red base and green stripe socks party accessory - Green Elf Skirt
+3
Christmas Headbands Elf Hat Santa Legs Snowman Pattern Plush Sequin Cloth Plastic Festive Hair Accessories Holiday Party Decor
-5%
$1.04-1.16
No MOQ
 · 
47 sold recently
Christmas Wired Edge Ribbon Linen Velvet Plaid Snowman Snowflake For DIY Bows Gift Wrapping Tree Decoration Festive Holiday
Christmas Wired Edge Ribbon Linen Velvet Plaid Snowman Snowflake For DIY Bows Gift Wrapping Tree Decoration Festive Holiday
like
Find Similar
Classic black and white plaid Christmas ribbon roll with wired edges, 63mm wide and 10Y long - Black White Grid / 63MM*9M
Red velvet wired ribbon 63mm wide for Christmas gift wrapping and tree decor - Red Solid Fine Linen / 63MM*9M
Pink glitter wired ribbon with red metallic edges for Christmas gift wrapping, 38mm x 10Y - Pink Glitter Ribbon / 38MM*9M
38mm red glitter wired ribbon for Christmas gift wrapping, 10 yards roll length - Red Glitter Ribbon / 38MM*9M
+20
Christmas Wired Edge Ribbon Linen Velvet Plaid Snowman Snowflake For DIY Bows Gift Wrapping Tree Decoration Festive Holiday
-12%
$1.45-3.78
No MOQ
 · 
342 sold recently
Christmas Balloon Decoration Foil And Latex Santa Claus Reindeer Snowman Candy Cane For Holiday Party Supplies
Christmas Balloon Decoration Foil And Latex Santa Claus Reindeer Snowman Candy Cane For Holiday Party Supplies
like
Find Similar
Christmas balloon set with penguin foil balloon, red star, and festive latex balloons - Christmas Penguin Style
Christmas reindeer balloon set with red star and latex balloons for holiday decoration - Black Reindeer Head
Christmas balloon set with Santa, candy canes, snowflakes and Merry Christmas reindeer - Reindeer Head
Christmas balloon set featuring Santa Claus, reindeer, snowflakes, and candy canes - Reindeer and Santa
+24
Christmas Balloon Decoration Foil And Latex Santa Claus Reindeer Snowman Candy Cane For Holiday Party Supplies
-5%
$1.73-2.33
No MOQ
 · 
15 views
Christmas Wine Bottle Cover Knitted Acrylic Mini Sweater And Matching Hat Snowman Snowflake Pattern Holiday Table Decor
Christmas Wine Bottle Cover Knitted Acrylic Mini Sweater And Matching Hat Snowman Snowflake Pattern Holiday Table Decor
like
Find Similar
Christmas snowman wine bottle cover with red knit sweater and mini hat decoration - Christmas Snowflake Style
Knitted Christmas wine bottle sweater cover with truck pattern and mini hat decoration - Christmas Car Style
Knitted Christmas wine bottle sweater with green JOY pattern and mini woolen hat - Christmas Wreath Style
Christmas snowman knitted wine bottle cover set with mini hat for holiday decor - Christmas Snowman Style
Christmas Wine Bottle Cover Knitted Acrylic Mini Sweater And Matching Hat Snowman Snowflake Pattern Holiday Table Decor
$2.31
Mix MOQ : 2
 · 
1 reviews
Free Shipping
Christmas Wooden Train Ornament Painted Mini Tabletop Decoration Santa Claus Snowman Gingerbread Man Classic Holiday Decor
Christmas Wooden Train Ornament Painted Mini Tabletop Decoration Santa Claus Snowman Gingerbread Man Classic Holiday Decor
like
Find Similar
Detailed view of red wooden Christmas train set with festive bear and snowman figurines - Red (5 sections)
Side view of white and gold wooden Christmas train with snowman and bear figures - White
White wooden Christmas train ornament set with gold snowflakes and festive box packaging - White Gold
Red Christmas wooden train set with snowman and bear figurines for holiday decor - Red Movable Wheels
+17
Christmas Wooden Train Ornament Painted Mini Tabletop Decoration Santa Claus Snowman Gingerbread Man Classic Holiday Decor
-5%
$1.53-2.88
No MOQ
 · 
16 sold recently
Christmas Snow Globe Lantern LED Lighted Water Lantern Vintage Bronze Style Santa Claus Snowman Desktop Holiday Decor
Christmas Snow Globe Lantern LED Lighted Water Lantern Vintage Bronze Style Santa Claus Snowman Desktop Holiday Decor
like
Find Similar
Retro bronze Christmas snow globe lantern with red truck and festive glitter light - Car & Tree
Christmas lantern with Santa Claus figurine and sparkling snow in antique bronze finish - Sitting Santa Claus
Bronze Christmas lantern with Santa Claus figurine and sparkling snow globe effect - Backpack Santa
Vintage bronze Santa sleigh lantern with swirling silver glitter snow effect - Santa in Car
+1
Christmas Snow Globe Lantern LED Lighted Water Lantern Vintage Bronze Style Santa Claus Snowman Desktop Holiday Decor
$3.89
Mix MOQ : 2
 · 
16 views
Christmas Angel Snowman Ornaments Plush Fabric Hanging Pendants For Christmas Tree Decorations Cute Nordic Style Doll Decor
Christmas Angel Snowman Ornaments Plush Fabric Hanging Pendants For Christmas Tree Decorations Cute Nordic Style Doll Decor
like
Find Similar
Brown plush Christmas angel doll hanging on pine branch with wooden bead details - No.1 (Brown Angel)
Pink plush angel Christmas ornament with tall pointed hat and gold wings for tree decor - No.2 (Pink Angel)
White plush Christmas angel doll hanging ornament with silver glitter wings, 23cm height - No.3 (White Angel)
Plush Christmas angel ornament with gold wings and lace hanging on a tree 17x9cm - No.4 (Khaki Angel)
+9
Christmas Angel Snowman Ornaments Plush Fabric Hanging Pendants For Christmas Tree Decorations Cute Nordic Style Doll Decor
$1.79-2.31
No MOQ
 · 
71 sold recently
Free Shipping
Christmas Washi Tape Winter Snowflakes Santa Snowman Pattern Washi Paper Decorative Tape For Scrapbooking Journaling DIY
Christmas Washi Tape Winter Snowflakes Santa Snowman Pattern Washi Paper Decorative Tape For Scrapbooking Journaling DIY
like
Find Similar
Deep blue Christmas washi tape with white snowman patterns for festive DIY scrapbooking - SD-13 Blue Snowman & Snowflake
Christmas washi tape with green background featuring Santa Claus and HO HO HO pattern - SD-14 Green Santa Claus
Christmas washi tape featuring Santa Claus and snowman patterns on light blue background - SD-15 Light Blue Santa & Snowman
Blue Christmas washi tape with white snowflake patterns for DIY journaling and crafts - SD-16 Dark Blue Snowflake
+5
Christmas Washi Tape Winter Snowflakes Santa Snowman Pattern Washi Paper Decorative Tape For Scrapbooking Journaling DIY
-4%
$0.47
No MOQ
 · 
61 views
Women Christmas Fuzzy Socks Thick Warm Coral Fleece Winter Floor Socks Cute Cartoon Santa Claus Snowman Reindeer Decor
Women Christmas Fuzzy Socks Thick Warm Coral Fleece Winter Floor Socks Cute Cartoon Santa Claus Snowman Reindeer Decor
like
Find Similar
Blue and white coral fleece Christmas sock with a cute snowman pattern for women - One Size / Blue Snowman
Red Christmas coral fleece sock with green tree patterns on soft beige background - One Size / Embroidered Christmas Tree
Soft white coral fleece Christmas sock with festive red and green polka dots - One Size / Red Green Big Polka Dots
Christmas coral fleece sock with reindeer embroidery and red white stripes - One Size / Embroidered Reindeer
+15
Women Christmas Fuzzy Socks Thick Warm Coral Fleece Winter Floor Socks Cute Cartoon Santa Claus Snowman Reindeer Decor
$1.07
Mix MOQ : 5
 · 
83 sold recently
Christmas Magnetic Bookmarks Cartoon Santa Snowman Pattern Paper Magnet Page Markers For Students Office Reading
Christmas Magnetic Bookmarks Cartoon Santa Snowman Pattern Paper Magnet Page Markers For Students Office Reading
like
Find Similar
Christmas bear magnetic bookmark with blue background and festive Merry Christmas motif - Christmas Gift
Cute brown Christmas Angel magnetic bookmark with festive illustrations in OPP packaging - Christmas Angel
Green Christmas magnetic bookmark with cute bear and sock design, 2.5x6cm size - Christmas Sock
Deep red magnetic bookmark with cartoon snowman and elk girl patterns in 2.5x6cm size - Snowman
Christmas Magnetic Bookmarks Cartoon Santa Snowman Pattern Paper Magnet Page Markers For Students Office Reading
$0.10
Mix MOQ : 2
 · 
845 sold recently
3D Pop Up Christmas Greeting Card Paper Cartoon Santa Reindeer Snowman Holiday Blessing Card With Envelope
3D Pop Up Christmas Greeting Card Paper Cartoon Santa Reindeer Snowman Holiday Blessing Card With Envelope
like
Find Similar
3D Christmas card set with snowman design, blue pop-up card and red envelope - Magic Snowman (With Red Envelope)
3D pop-up Christmas card featuring Santa Claus and gift box with a red envelope - Bell Santa Claus (With Red Envelope)
3D reindeer pop-up Christmas card with cute red envelope and writing lines for gifts - Crystal Ball Reindeer (With Red Envelope)
3D Christmas card with cute fox and cupcake, yellow pop-up design with red envelope - Cake Fox (With Red Envelope)
+2
3D Pop Up Christmas Greeting Card Paper Cartoon Santa Reindeer Snowman Holiday Blessing Card With Envelope
$0.22
Mix MOQ : 12
 · 
36 sold recently
Christmas Retro TV Snow Globe With LED Light Music Water Spinning Glitter Santa Claus Snowman Ornament Holiday Decor
Christmas Retro TV Snow Globe With LED Light Music Water Spinning Glitter Santa Claus Snowman Ornament Holiday Decor
like
Find Similar
Vintage bronze musical Christmas lantern snow globe with Santa Claus and warm lighting - Santa Holding Bear (8*8*15cm 460g)
Vintage bronze musical Christmas lantern with Santa riding a reindeer and swirling glitter - Santa Riding Reindeer (8*8*15cm 460g)
Vintage bronze musical Christmas lantern with snowman and reindeer scene inside - Snowman Style (8*8*15cm 460g)
Vintage bronze USB Christmas lantern with a lighted snow globe and festive pine tree decor - Christmas Tree Style (8*8*15cm 460g)
+30
Christmas Retro TV Snow Globe With LED Light Music Water Spinning Glitter Santa Claus Snowman Ornament Holiday Decor
$7.78-18.73
No MOQ
 · 
35 views
Christmas Wine Bottle Covers Knitted Gnome Santa Snowman Reindeer Table Decor Holiday Party Supplies Festive Ornament
Christmas Wine Bottle Covers Knitted Gnome Santa Snowman Reindeer Table Decor Holiday Party Supplies Festive Ornament
like
Find Similar
Christmas gnome wine bottle cover with red knitted snowflake hat and white faux fur beard - Forest Gnome Cover A-Snowflake
Christmas gnome wine bottle cover with red knitted tall hat and white faux fur beard - Forest Gnome Cover B
Gnome wine bottle cover with grey knit hat and white beard for Christmas table decoration - Forest Gnome Cover C-Grey
Christmas gnome wine bottle cover with red striped knit hat and white faux beard - Forest Gnome Cover D-Stripe
+23
Christmas Wine Bottle Covers Knitted Gnome Santa Snowman Reindeer Table Decor Holiday Party Supplies Festive Ornament
-25%
$0.52-2.02
No MOQ
 · 
562 sold recently
Christmas Resin Charms Flatback DIY Jewelry Making Accessories Snowman Reindeer Snowflake For Hair Clips Phone Case Decor
Christmas Resin Charms Flatback DIY Jewelry Making Accessories Snowman Reindeer Snowflake For Hair Clips Phone Case Decor
like
Find Similar
DIY Christmas snowman resin charm for hair clips, red hat blue scarf, 15x25mm size - Snowman
DIY Christmas stocking resin charm in red and white colors, sized 16x21mm and 1.3g - Red and White Enamel Christmas Sock
Christmas tree resin accessory in green with colorful dots and top star, 18x24mm size - Christmas Tree
Blue glitter snowflake resin charm for DIY hair clips, dimensions 21mm by 24mm size - Christmas Snow
+1
Christmas Resin Charms Flatback DIY Jewelry Making Accessories Snowman Reindeer Snowflake For Hair Clips Phone Case Decor
$0.07-0.13
Mix MOQ : 10
 · 
100 sold recently
Free Shipping
Cartoon Christmas Socks Gift Box With Santa Claus Snowman Reindeer Pattern Cotton Blend Holiday Winter Socks For Men Women
Cartoon Christmas Socks Gift Box With Santa Claus Snowman Reindeer Pattern Cotton Blend Holiday Winter Socks For Men Women
like
Find Similar
Christmas 4-pair cotton sock gift set with festive box and matching green carry bag - One Size / Christmas Mixed Patterns 1(277+284+278+283)
Christmas gift set with 4 pairs of cotton socks featuring Santa and snowman patterns - One Size / Christmas Mixed Patterns 2(211+276+280+279)
4-pair Christmas socks gift set with Santa and snowman patterns in festive green box - One Size / Christmas Mixed Patterns 3(216+210+209+279)
Green Christmas gift box set with 4 pairs of cotton socks featuring Santa and reindeer - One Size / Christmas Mixed Patterns 4(217+209+281+212)
+2
Cartoon Christmas Socks Gift Box With Santa Claus Snowman Reindeer Pattern Cotton Blend Holiday Winter Socks For Men Women
$6.34
No MOQ
 · 
16 views
Christmas Snowman Dolls Blue White Knit Fabric Plush Ornaments Standing Skiing Figurines Home Desktop Decor Holiday Winter
Christmas Snowman Dolls Blue White Knit Fabric Plush Ornaments Standing Skiing Figurines Home Desktop Decor Holiday Winter
like
Find Similar
Plush 28cm snowman doll in blue knit hat with skis and poles for Christmas decor - Skiing Style-Blue Plaid Knit Hat (B)
Blue knitted Christmas snowman plush doll with 33cm height marker and winter scarf - Long Leg Style-Blue Plaid Knit Hat (A)
Blue plaid snowman Christmas doll decoration with knitted hat and scarf, 33cm height - Long Leg Style-Grey Blue Argyle Knit Hat (B)
Blue plaid fabric skiing snowman doll with 20cm height indicator for Christmas decor - Mini Style-Blue Plaid Scarf (A)
+2
Christmas Snowman Dolls Blue White Knit Fabric Plush Ornaments Standing Skiing Figurines Home Desktop Decor Holiday Winter
-5%
$2.46-6.57
Mix MOQ : 2
 · 
1 reviews
Christmas Snow Globe Glowing Desktop Ornament Resin Glass Santa Claus Snowman Snowflake Decoration Holiday Gift Decoration
Christmas Snow Globe Glowing Desktop Ornament Resin Glass Santa Claus Snowman Snowflake Decoration Holiday Gift Decoration
like
Find Similar
Set of 4 glowing Christmas snow globes with Santa and snowman on red gift box background - Santa Claus (4.5cm)
Set of four Christmas glowing crystal balls with Santa, Snowman, and Reindeer figurines - Christmas Chimney (4.5cm)
Set of four Santa Claus crystal snow globes with glowing LED lights for Christmas decor - Christmas Hat (4.5cm)
Luminous Santa Claus and snowman crystal ball ornaments on red sleigh base - Christmas Sleigh (4.5cm)
+29
Christmas Snow Globe Glowing Desktop Ornament Resin Glass Santa Claus Snowman Snowflake Decoration Holiday Gift Decoration
$1.61-23.86
Mix MOQ : 2
 · 
14 sold recently
Christmas Stud Earrings Santa Reindeer Snowman Enamel Alloy Cartoon Jewelry For Women With 925 Sterling Silver Earring Post
Christmas Stud Earrings Santa Reindeer Snowman Enamel Alloy Cartoon Jewelry For Women With 925 Sterling Silver Earring Post
like
Find Similar
Detail of cute red Santa Claus earrings with colorful drip oil finish on display card - Santa Claus B - S925 Silver Needle
Detailed macro view of a cute white snowman earring with a red hat and scarf on a display card - Snowman - Stud
Detail of cute layered Christmas tree earrings with colorful enamel on a white tray - Christmas Tree - Stud
Close-up of reindeer stud earrings with red nose and brown antlers on a gift card - Reindeer - Stud
+23
Christmas Stud Earrings Santa Reindeer Snowman Enamel Alloy Cartoon Jewelry For Women With 925 Sterling Silver Earring Post
$0.44-0.52
No MOQ
 · 
217 sold recently
Free Shipping
Christmas Temporary Tattoo Stickers Waterproof Face Body Santa Reindeer Snowman Cartoon Watercolor Party Favors For Kids
Christmas Temporary Tattoo Stickers Waterproof Face Body Santa Reindeer Snowman Cartoon Watercolor Party Favors For Kids
like
Find Similar
Detailed set of 10 watercolor Christmas temporary tattoos featuring Santa and reindeer designs - CM Watercolor Christmas
Set of 10 colorful cartoon Christmas temporary tattoos for kids party face decoration - CE Cartoon Christmas
Cartoon Christmas temporary tattoo stickers set with Santa and reindeer for kids parties - DB Christmas
Christmas Temporary Tattoo Stickers Waterproof Face Body Santa Reindeer Snowman Cartoon Watercolor Party Favors For Kids
$0.09
Mix MOQ : 10
 · 
450 sold recently
9Pcs Christmas Cute Resin Cabochons For DIY Hair Clip Phone Case Making Santa Claus Snowman Reindeer Christmas Tree Bell Flatback Patches
9Pcs Christmas Cute Resin Cabochons For DIY Hair Clip Phone Case Making Santa Claus Snowman Reindeer Christmas Tree Bell Flatback Patches
like
Find Similar
Detailed view of resin Christmas gift box DIY charms with red bow for festive crafts - Gift Box
Macro view of Christmas green bell resin charms with red bows for DIY handmade crafts - Bell
Detail of a pink bunny in a red Christmas stocking resin charm for DIY crafts - Christmas Sock
Close-up of red resin Christmas glove charm for DIY hair clips and crafts - Christmas Red Glove
+4
9Pcs Christmas Cute Resin Cabochons For DIY Hair Clip Phone Case Making Santa Claus Snowman Reindeer Christmas Tree Bell Flatback Patches
-9%
$0.09
No MOQ
 · 
850 sold recently
Christmas Charms Zinc Alloy Enamel Pendants For DIY Jewelry Making Santa Claus Elk Tree Snowman Festive Decoration
Christmas Charms Zinc Alloy Enamel Pendants For DIY Jewelry Making Santa Claus Elk Tree Snowman Festive Decoration
like
Find Similar
20pcs Christmas alloy enamel charms set featuring Santa, reindeer, and tree for DIY jewelry - Mixed 20pcs New Enamel Christmas Set
Christmas reindeer alloy charm with white face and red antlers shown on scale - Christmas Reindeer 17x14mm
Christmas Santa Claus alloy enamel charm pendant in red and white with measurement scale - Santa Claus 24x15mm
Christmas reindeer metal charm with white enamel detail and silver plating for DIY jewelry - Christmas Reindeer 23x18mm
+18
Christmas Charms Zinc Alloy Enamel Pendants For DIY Jewelry Making Santa Claus Elk Tree Snowman Festive Decoration
$0.07-2.50
Mix MOQ : 2
 · 
144 sold recently
Free Shipping
Christmas Miniature Resin Ornaments Santa Claus Snowman Train Tree Micro Landscape Desktop Decor Festive Figurine Accessory
Christmas Miniature Resin Ornaments Santa Claus Snowman Train Tree Micro Landscape Desktop Decor Festive Figurine Accessory
like
Find Similar
Miniature Santa Claus resin figurine in red and white colors measuring 3.7cm x 2.7cm - Santa Claus No. 7
Miniature Christmas Santa Claus resin figurine standing in snow, size 3.3cm by 2cm - Santa Claus No. 8
Miniature Santa Claus resin figurine for Christmas decor measuring 3cm by 2.2cm - Santa Claus No. 9
Miniature sleeping Santa Claus figurine in red suit on white snow scene, 3.7x2.4cm size - Santa Claus No. 10
+19
Christmas Miniature Resin Ornaments Santa Claus Snowman Train Tree Micro Landscape Desktop Decor Festive Figurine Accessory
$0.09-0.46
Mix MOQ : 3
 · 
20 sold recently
Cute Christmas Miniature Figurines Resin Desktop Ornaments Santa Claus Snowman Reindeer Animal Festive Holiday Gift Decor
Cute Christmas Miniature Figurines Resin Desktop Ornaments Santa Claus Snowman Reindeer Animal Festive Holiday Gift Decor
like
Find Similar
Christmas cow resin figurine wearing red santa hat and socks on snowy background - Calf (Kraft Box)
Miniature resin Christmas sheep figurine with red hat and blue bow gift for kids - Sheep (Kraft Box)
Miniature resin Christmas snowman figurine with red hat and scarf, size 5x3cm - Snowman (Kraft Box)
Miniature resin hedgehog with Santa hat and teal cup, cute 5.5cm Christmas desktop decor - Hedgehog (Kraft Box)
+18
Cute Christmas Miniature Figurines Resin Desktop Ornaments Santa Claus Snowman Reindeer Animal Festive Holiday Gift Decor
-5%
$0.82-5.15
No MOQ
 · 
20 views
Christmas Wooden Round Door Sign Welcome Merry Christmas Snowman Santa Plaque Hanging For Home Wall Holiday Party Decor
Christmas Wooden Round Door Sign Welcome Merry Christmas Snowman Santa Plaque Hanging For Home Wall Holiday Party Decor
like
Find Similar
Round wooden snowman Christmas door sign, 7.87 inch diameter with Merry Christmas text - Wooden Christmas Sign Snowman Merry Christmas
Christmas snowman wooden welcome sign with paw print, pine cones and berries, 20cm round - Wooden Christmas Sign Plaid Paw Print
Christmas round wooden Jesus plaque with golden bow and pine needles for door decor - Wooden Christmas Sign Red Christmas Ball
20cm round Christmas door sign featuring purple Santa and Reindeer on white background - Wooden Christmas Sign Purple Santa and Deer
+12
Christmas Wooden Round Door Sign Welcome Merry Christmas Snowman Santa Plaque Hanging For Home Wall Holiday Party Decor
-4%
$0.77
No MOQ
 · 
18 views
Mini Christmas Santa Claus Keychain Cartoon Snowman Reindeer Bear PVC Soft Rubber Keyring Ornament Holiday Party Favor Gift
Mini Christmas Santa Claus Keychain Cartoon Snowman Reindeer Bear PVC Soft Rubber Keyring Ornament Holiday Party Favor Gift
like
Find Similar
Close-up of a mini Santa Claus keychain held in hand showing soft PVC detail - Santa Claus Style A
Detailed close-up of a mini 2.5cm Santa Claus keychain charm held in hand - Santa Claus Style B
Detailed close-up of a 2.5cm mini snowman keychain with Santa hat and green gift box - Christmas Snowman Style
Detailed view of a 2.5cm mini Santa Claus keychain made of soft PVC with metal ring - Santa Claus Style C
+4
Mini Christmas Santa Claus Keychain Cartoon Snowman Reindeer Bear PVC Soft Rubber Keyring Ornament Holiday Party Favor Gift
-12%
$0.07
No MOQ
 · 
1K+ sold recently
Christmas Temporary Tattoos For Kids Waterproof Cartoon Santa Claus Snowman Reindeer Pattern Holiday Party Favor Gift
Christmas Temporary Tattoos For Kids Waterproof Cartoon Santa Claus Snowman Reindeer Pattern Holiday Party Favor Gift
like
Find Similar
Christmas temporary cartoon tattoo stickers featuring Santa, snowman, and reindeer designs - Christmas SR Series (SR-01-10)
Christmas temporary tattoos for kids with colorful Santa and reindeer cartoon designs - Christmas SM Series (SM-01-10)
Kids Christmas temporary tattoos set featuring Santa and Reindeer designs in 10 styles - Christmas K Series (K-01-10)
Christmas Temporary Tattoos For Kids Waterproof Cartoon Santa Claus Snowman Reindeer Pattern Holiday Party Favor Gift
$0.10
Mix MOQ : 10
Christmas Lantern Silicone Mold DIY Resin Epoxy Plaster Candlestick Night Light Gingerbread Man Snowman Deer
Christmas Lantern Silicone Mold DIY Resin Epoxy Plaster Candlestick Night Light Gingerbread Man Snowman Deer
like
Find Similar
Christmas lantern silicone mold for resin castle candle holder with sizing details - Wind Lantern Top Cover-A
Square base silicone mold for Christmas lantern with precise dimension markings - Wind Lantern Base-B
Christmas angel lantern silicone mold for DIY resin casting with star and tree patterns - Wind Lantern Angel Wall-C
Christmas gingerbread man and tree silicone mold with detailed size dimensions - Wind Lantern Gingerbread Man Wall-D
+4
Christmas Lantern Silicone Mold DIY Resin Epoxy Plaster Candlestick Night Light Gingerbread Man Snowman Deer
-5%
$1.15-2.05
Mix MOQ : 5
Christmas Placemats Cotton Linen Waterproof Heat Resistant Table Decoration Snowman Reindeer Tree Nativity Print
Christmas Placemats Cotton Linen Waterproof Heat Resistant Table Decoration Snowman Reindeer Tree Nativity Print
like
Find Similar
Christmas snowman and cardinal bird heat resistant dining placemat with Let It Snow text - 32x21cm Cotton Linen / Red Snowman Red Bird
Christmas cotton linen placemat featuring artistic red and black patterned holiday trees - 32x21cm Cotton Linen / Artistic Five Christmas Trees
Close-up of red Christmas placemat with white reindeer and HO HO HO text detail - 32x21cm Cotton Linen / Red Background White Reindeer
Christmas snowman placemat with Let It Snow illustration and red canvas texture - 32x21cm Cotton Linen / Red Background Double Snowmen
+32
Christmas Placemats Cotton Linen Waterproof Heat Resistant Table Decoration Snowman Reindeer Tree Nativity Print
-5%
$0.93-1.37
Mix MOQ : 2
Christmas Wine Bottle Covers Burlap Bags Santa Snowman Reindeer Applique Holiday Table Decor Party Gifts Festive Ornaments
Christmas Wine Bottle Covers Burlap Bags Santa Snowman Reindeer Applique Holiday Table Decor Party Gifts Festive Ornaments
like
Find Similar
Linen Christmas wine bottle bag featuring a 3D reindeer design with red plaid accents - Beige Reindeer
Red linen Christmas wine bottle cover featuring snowman embroidery with snowflake patterns - Red Snowman
Christmas burlap wine bottle bag featuring a 3D Santa Claus design with green base - Green Santa
Christmas snowman wine bottle bag in burlap with knit hat and wooden button detail - Beige Snowman
Christmas Wine Bottle Covers Burlap Bags Santa Snowman Reindeer Applique Holiday Table Decor Party Gifts Festive Ornaments
-4%
$0.99
Mix MOQ : 2
 · 
40 sold recently
Christmas Wind Lantern LED Night Light Decorative Lamp Santa Snowman Reindeer Patterns Battery Operated Xmas Desktop Hanging Ornament
Christmas Wind Lantern LED Night Light Decorative Lamp Santa Snowman Reindeer Patterns Battery Operated Xmas Desktop Hanging Ornament
like
Find Similar
White Christmas lantern with reindeer forest scene on snowy background - Small White Deer
Red Christmas lantern with Santa Claus illustration and warm LED light decoration - Small Red Santa
White Christmas lantern with snowman and tree motifs on a snowy decorative surface - Small White Snowman
Vintage bronze Christmas lantern featuring Santa Claus scene with warm LED glow - Small Grit Gold Santa
+17
Christmas Wind Lantern LED Night Light Decorative Lamp Santa Snowman Reindeer Patterns Battery Operated Xmas Desktop Hanging Ornament
-4%
$0.69-2.06
Mix MOQ : 2
 · 
13 sold recently
Zinc Alloy Christmas Keychain Santa Claus Snowman Christmas Tree Metal Bag Hanging Ornament With Rhinestone Artificial Pearl
Zinc Alloy Christmas Keychain Santa Claus Snowman Christmas Tree Metal Bag Hanging Ornament With Rhinestone Artificial Pearl
like
Find Similar
Detail of Santa Claus keychain with red enamel finish and sparkling crystal beard stones - Santa Claus A Style (Silver) (D2853)
Golden Christmas tree keychain with colorful rhinestones and pearls on a white background - Christmas Tree (Gold) (D2846)
Close-up of metal Christmas tree keychain with green rhinestones and pearls - Christmas Tree (Silver) (D2854)
Detail of Christmas bell keychain with green leaves, red flowers, and crystal accents - Bell (Gold) (D2848)
+12
Zinc Alloy Christmas Keychain Santa Claus Snowman Christmas Tree Metal Bag Hanging Ornament With Rhinestone Artificial Pearl
-9%
$0.92-1.21
No MOQ
 · 
144 sold recently
Christmas Party Decorative Glasses Frames Glitter Santa Reindeer Snowman Tree Novelty Eyewear For Kids Adults Festive
Christmas Party Decorative Glasses Frames Glitter Santa Reindeer Snowman Tree Novelty Eyewear For Kids Adults Festive
like
Find Similar
Christmas party glasses with Xmas tree design and size details for holiday decoration - Xmas Green Tree Style
Christmas party glasses with red glitter Santa hat design and snowflake details - Christmas Hat Style
Christmas party glasses with green glitter wreath frame and red bows decoration - Bowknot Style
Christmas party glasses with red glitter frames and Santa Claus decor for holiday photos - Santa Claus
+66
Christmas Party Decorative Glasses Frames Glitter Santa Reindeer Snowman Tree Novelty Eyewear For Kids Adults Festive
$0.32-0.65
Mix MOQ : 2
 · 
48 sold recently
Christmas Wooden Hanging Tags Snowman Wood Beads Plaid Bow Blank Ornaments Christmas Tree Decor DIY Rustic
Christmas Wooden Hanging Tags Snowman Wood Beads Plaid Bow Blank Ornaments Christmas Tree Decor DIY Rustic
like
Find Similar
Set of 8 wooden Christmas stocking tags with snowmen, plaid bows, and hanging beads - 8-Piece Set (Mixed Styles)
Wooden snowman ornament with red hat and plaid bow on rustic dark wood background - Red Snowman Tag
Detailed view of a snowman wood bead ornament with a rustic plaid bow for Christmas tree - Black Snowman Tag
Christmas stocking tag with red plaid beads and ribbon on rustic wooden background - Red Beads Tag
+1
Christmas Wooden Hanging Tags Snowman Wood Beads Plaid Bow Blank Ornaments Christmas Tree Decor DIY Rustic
$0.37-3.17
No MOQ
 · 
10 sold recently
Solar Garden Stake Lights Outdoor Landscape Decoration Mushroom Snowman Flamingo Cactus Pumpkin Waterproof Pathway Decor Lawn Patio
Solar Garden Stake Lights Outdoor Landscape Decoration Mushroom Snowman Flamingo Cactus Pumpkin Waterproof Pathway Decor Lawn Patio
like
Find Similar
Solar powered lawn light with red glowing dinosaur egg design and ground stake - Easter Egg Stake (Red)
Solar dinosaur egg garden light with yellow crackle effect for outdoor landscape decor - Easter Egg Stake (Yellow)
Solar powered garden stake light with green crackle glass egg design in day and night views - Easter Egg Stake (Green)
Solar powered garden stake light with blue cracked egg design for outdoor lighting - Easter Egg Stake (Blue)
+51
Solar Garden Stake Lights Outdoor Landscape Decoration Mushroom Snowman Flamingo Cactus Pumpkin Waterproof Pathway Decor Lawn Patio
-12%
$2.23-10.06
No MOQ
 · 
45 views
Go to

More in party supplies

Explore more in snowmen

holidaypartyhangingdesktopmakinghandshapeswindowballpointbracelet necklace
diyresinmankidswarmsteelgirlsmetalphoneunisex

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access