Everful

Wholesale snowmen

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Snowmen

Find the perfect pieces: christmas supplies, halloween supplies and more

All products in snowmen

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Christmas Hair Claw Clips Acrylic Santa Reindeer Patterns Festive Holiday Hair Accessories For Women Girls
Christmas Hair Claw Clips Acrylic Santa Reindeer Patterns Festive Holiday Hair Accessories For Women Girls
like
Find Similar
Sweet Christmas 11.5cm white acrylic hair claw clip with Santa and snowflake motifs - 1# White - Santa Claus (11.5cm)
11.5cm red Christmas hair claw clip featuring Santa on a green train acrylic design - 2# Red - Santa Train (11.5cm)
11.5cm Green Christmas hair claw clip with festive hat patterns on card packaging - 3# Green - Christmas Hat (11.5cm)
Brown 11.5cm Christmas shark hair claw clip with reindeer and snowman patterns - 4# Coffee - Snowman Elk (11.5cm)
+3
Christmas Hair Claw Clips Acrylic Santa Reindeer Patterns Festive Holiday Hair Accessories For Women Girls
$1.30
No MOQ
 · 
10 sold recently
Christmas Hair Clips For Girls Handmade Grosgrain Ribbon Bow Duckbill Barrettes Glitter Santa Reindeer Tree Holiday Party
Christmas Hair Clips For Girls Handmade Grosgrain Ribbon Bow Duckbill Barrettes Glitter Santa Reindeer Tree Holiday Party
like
Find Similar
Green ribbon bow hair clip with festive Christmas gift patterns and gold bell detail - Green Xmas Pattern + Glitter Bell / Green Xmas Pattern (10#)
Purple grosgrain ribbon bow hair clip with festive glittery Christmas gift box - Purple Bow + Gift Box / Purple (1#)
Green Christmas bow hair clip with golden glitter reindeer and snowflake patterns - Green Tree Pattern + Gold Elk / Green (2#)
Green ribbon Christmas bow hair clip with snowman pattern and silver glitter snowflake - Green Snowman Pattern + Silver Snowflake / Green (3#)
+11
Christmas Hair Clips For Girls Handmade Grosgrain Ribbon Bow Duckbill Barrettes Glitter Santa Reindeer Tree Holiday Party
$0.49
No MOQ
Festive Christmas Scrapbooking Paper Pad For DIY Crafts Scrapbook Card Making Acid Free Cardstock Assorted Patterns Holiday Decoration
Festive Christmas Scrapbooking Paper Pad For DIY Crafts Scrapbook Card Making Acid Free Cardstock Assorted Patterns Holiday Decoration
like
Find Similar
24 sheets of 6x6 inch Christmas patterned cardstock for DIY scrapbooking and crafts - Festive Christmas Themed Paper Pad (QT686)
Festive Christmas Scrapbooking Paper Pad For DIY Crafts Scrapbook Card Making Acid Free Cardstock Assorted Patterns Holiday Decoration
-5%
$1.70
Mix MOQ : 2
Santa Claus Nice List Certificate For Kids Reward Award Card Vintage Christmas Party Gift Personalizable Name Paper Card
Santa Claus Nice List Certificate For Kids Reward Award Card Vintage Christmas Party Gift Personalizable Name Paper Card
like
Find Similar
Set of 6 Christmas Nice List Certificates with festive Santa Claus and reindeer illustrations - Christmas Recognition Certificate (QT1662)
Santa Claus Nice List Certificate For Kids Reward Award Card Vintage Christmas Party Gift Personalizable Name Paper Card
$1.01
Mix MOQ : 2
Vintage Christmas Decoration Cards Retro Postcards For Wall Decor Winter Holiday Gift Message Cards With Round Stickers
Vintage Christmas Decoration Cards Retro Postcards For Wall Decor Winter Holiday Gift Message Cards With Round Stickers
like
Find Similar
Set of 30 vintage Christmas postcards and wall stickers for retro home holiday decoration - Retro Christmas Illustration Style (QT1603)
Vintage Christmas Decoration Cards Retro Postcards For Wall Decor Winter Holiday Gift Message Cards With Round Stickers
$1.30
Mix MOQ : 2
Vintage Christmas Scrapbook Paper Music Score Pattern Decorative Material Paper For DIY Scrapbooking And Card Making
Vintage Christmas Scrapbook Paper Music Score Pattern Decorative Material Paper For DIY Scrapbooking And Card Making
like
Find Similar
Set of 30 vintage Christmas sheet music scrapbooking papers with Santa and snowman designs - Festive Elements Watercolor Illustration (QT1540-1)
30pcs vintage Christmas scrapbook paper set featuring 10 retro festive illustrations - Victorian Nostalgic Illustration (QT1540-2)
Vintage Christmas Scrapbook Paper Music Score Pattern Decorative Material Paper For DIY Scrapbooking And Card Making
$1.30
Mix MOQ : 2
Stretchable TPR Gorilla Squishy Toy Set Werewolf And Yeti And Gorilla Decompression Squeeze Toy For Stress Relief Office
Stretchable TPR Gorilla Squishy Toy Set Werewolf And Yeti And Gorilla Decompression Squeeze Toy For Stress Relief Office
like
Find Similar
Set of three colorful squishy gorilla stress toys with high-stretch TPR material - Gorilla And Werewolf And Yeti
Stretchable TPR Gorilla Squishy Toy Set Werewolf And Yeti And Gorilla Decompression Squeeze Toy For Stress Relief Office
-4%
$0.96
Mix MOQ : 2
 · 
66 sold recently
Top 10% Best Sellers
in Toys & Games
Children Christmas Plush Scarf Faux Fur Thick Warm Neck Warmer Cartoon Santa Claus Bear Doll Scarf With Pom-Poms Festive Gift
Children Christmas Plush Scarf Faux Fur Thick Warm Neck Warmer Cartoon Santa Claus Bear Doll Scarf With Pom-Poms Festive Gift
like
Find Similar
Plush Christmas scarf in beige with cute polar bear doll and green pom-poms for kids - Red Rope Snowflake Bear - Off-White
Detail of soft plush Christmas scarf for kids featuring a cute Santa Claus patch and green pompoms - Red Snowman - Off-White
Detail of green plush kids Christmas scarf with Santa Claus applique and red pom-poms - Red Snowman - Dark Green
Detailed close-up of pink plush scarf with green pom poms and Santa Claus patch - Red Snowman - Pink
+10
Children Christmas Plush Scarf Faux Fur Thick Warm Neck Warmer Cartoon Santa Claus Bear Doll Scarf With Pom-Poms Festive Gift
$2.02
Mix MOQ : 2
Women Canvas Tote Bag Strawberry Vegetable Print Large Capacity Shoulder Bag Reusable Eco Friendly Shopping Bag Handbag
Women Canvas Tote Bag Strawberry Vegetable Print Large Capacity Shoulder Bag Reusable Eco Friendly Shopping Bag Handbag
like
Find Similar
Off-white canvas tote bag featuring a cute festive bear and Christmas tree print - C10 Christmas Decorating Bear
Cream canvas tote bag with winter bear and reindeer illustration print - C11 Christmas Bear and Deer
Off-white canvas tote bag featuring a Christmas snowman and cabin illustration - C13 Christmas Snowman Globe
Off-white canvas tote bag featuring red tomato and green pepper botanical print - C14 Tomato Illustration
+14
Women Canvas Tote Bag Strawberry Vegetable Print Large Capacity Shoulder Bag Reusable Eco Friendly Shopping Bag Handbag
-4%
$2.44
No MOQ
 · 
42 views
Creative Christmas Santa Claus Snowflake Star Wall Stickers Removable PVC Festive Wall Decals For Kids Room Home Decor
Creative Christmas Santa Claus Snowflake Star Wall Stickers Removable PVC Festive Wall Decals For Kids Room Home Decor
like
Find Similar
Removable Santa and snowman Christmas wall stickers for home decor 40x32cm size - Santa Claus Snowflake Set (TJ003)
NewCreative Christmas Santa Claus Snowflake Star Wall Stickers Removable PVC Festive Wall Decals For Kids Room Home Decor
$1.33
Mix MOQ : 5
Creative Cartoon Animal Number Enamel Brooches Zinc Alloy Dripping Oil Pins For Clothing Bag Decoration Unisex Fashion Jewelry
Creative Cartoon Animal Number Enamel Brooches Zinc Alloy Dripping Oil Pins For Clothing Bag Decoration Unisex Fashion Jewelry
like
Find Similar
Cute brown sloth enamel pin with black metal butterfly clasp for clothes and bags - Number 3 Sloth / Brown Sloth (C2573-3)
Cute green enamel number 2 brooch with small red scarf detail and metal butterfly pin clutch - Number 2 Snake / Green Snake (C2573-2)
Cartoon animal enamel pin in orange-brown color with cute capybara head and number design - Number 7 Capybara / Brown Capybara (C2573-7)
Pink cartoon animal enamel pin with blue bow and butterfly back closure for girls - Number 1 Rabbit / Pink Rabbit (C2573-1)
+6
Creative Cartoon Animal Number Enamel Brooches Zinc Alloy Dripping Oil Pins For Clothing Bag Decoration Unisex Fashion Jewelry
-7%
$0.37
No MOQ
Free Shipping
Kids Crossbody Bag Cartoon Printed Polyester Small Shoulder Messenger Pouch Adjustable Strap Casual Student
Kids Crossbody Bag Cartoon Printed Polyester Small Shoulder Messenger Pouch Adjustable Strap Casual Student
like
Find Similar
Blue crossbody bag featuring a space panda cartoon print with adjustable black strap - Blue Space Panda
Adjustable crossbody bag for students featuring cartoon winter patterns and blue motifs - White Winter Snowman
Black school crossbody bag with skull and mushroom print and adjustable strap - Black Skull Mushroom
Colorful cartoon cat and mouse pattern shoulder bag for students on white background - Colorful Cat and Mouse
+6
Kids Crossbody Bag Cartoon Printed Polyester Small Shoulder Messenger Pouch Adjustable Strap Casual Student
$6.05
No MOQ
 · 
13 views
Waterproof PVC Wall Stickers Removable Christmas Flower Decorative Decals For Toilet Fridge Cabinet Home Decor
Waterproof PVC Wall Stickers Removable Christmas Flower Decorative Decals For Toilet Fridge Cabinet Home Decor
like
Find Similar
Watercolor flower wall sticker set with 30cm x 20cm layout for home decoration - Pink Orange Watercolor Floral (Y1537)
Detail of floral wall decals featuring purple hydrangeas and ribbon, 30cm by 20cm - Purple Blue Hydrangea (Y1538)
Detailed view of floral wall stickers with vintage green and orange blossoms, 30x20cm size - Vintage Green Orange Floral (Y1539)
Christmas wall stickers with pine branches and golden balls in 30cm by 20cm layout - Y1540（20*30cm）
+12
NewWaterproof PVC Wall Stickers Removable Christmas Flower Decorative Decals For Toilet Fridge Cabinet Home Decor
$0.69
Mix MOQ : 2
Waterproof Nylon Fanny Pack With Earphone Hole Multi Pocket Adjustable Strap For Outdoor Sports Running Hiking Traveling Unisex
Waterproof Nylon Fanny Pack With Earphone Hole Multi Pocket Adjustable Strap For Outdoor Sports Running Hiking Traveling Unisex
like
Find Similar
Waterproof black nylon waist bag with multiple pockets and passport storage - Black
Grey nylon outdoor waist bag with multiple functional compartments and zip pockets - Light Gray
Waterproof navy blue waist bag shown with passport and phone to display large capacity - Dark Blue
Waterproof Nylon Fanny Pack With Earphone Hole Multi Pocket Adjustable Strap For Outdoor Sports Running Hiking Traveling Unisex
-4%
$4.38
Mix MOQ : 3
Christmas Pendant Necklace Stainless Steel 18K Gold Plated Santa Owl Snowflake Elk Holiday Jewelry For Women
Christmas Pendant Necklace Stainless Steel 18K Gold Plated Santa Owl Snowflake Elk Holiday Jewelry For Women
like
Find Similar
Detail of 18K gold stainless steel necklace with Christmas tree pendant and star charms - Christmas Tree
Close-up of golden reindeer pendant necklace on white display card held by hand - Elk
Detailed view of 18K gold owl pendant necklace with intricate hollow out design - Owl
Detail of a gold-plated snowflake pendant necklace held against a white card background - Snowflake
+5
Christmas Pendant Necklace Stainless Steel 18K Gold Plated Santa Owl Snowflake Elk Holiday Jewelry For Women
$1.31
No MOQ
 · 
113 sold recently
Free Shipping
Smile Smiling Face Mouth Magnetic Couple Will Hold Hands Socks Black And White Tube Socks Trend Girlfriends Cute Stockings
Smile Smiling Face Mouth Magnetic Couple Will Hold Hands Socks Black And White Tube Socks Trend Girlfriends Cute Stockings
like
Find Similar
Cartoon magnetic hand-holding socks in white green blue yellow and light blue colors - Gradient 3D Style / Gradient White
Creative black magnetic holding hands mid-calf socks with cute 3D cartoon eye design - 3D Decorative Style / 3D Black
White cotton crew socks featuring cute 3D plush arms and small eye decorations - 3D Decorative Style / 3D White
White magnetic holding hands socks featuring 3D cartoon arms with cute emoji - 3D Smiley Style / 3D Smiley White
+18
Smile Smiling Face Mouth Magnetic Couple Will Hold Hands Socks Black And White Tube Socks Trend Girlfriends Cute Stockings
$0.68-1.50
No MOQ
 · 
36 sold recently
Christmas Wooden Teardrop Earrings Santa Claus Tree Printed Drop Earrings For Women Festival Jewelry Merry Christmas
Christmas Wooden Teardrop Earrings Santa Claus Tree Printed Drop Earrings For Women Festival Jewelry Merry Christmas
like
Find Similar
Christmas teardrop wooden earrings with wreath print and Merry Christmas text - Christmas Wreath (1)
Waterdrop wooden earrings with Merry Christmas to you print and holly berry patterns - Christmas Holly Berries (2)
Detail of wooden teardrop earrings with a Christmas tree design and Happy Holidays text - 圣诞树Happy Holidays(3)
Detailed view of teardrop wood earrings featuring a festive Christmas tree and gifts - Christmas Tree and Gift Box (4)
+6
Christmas Wooden Teardrop Earrings Santa Claus Tree Printed Drop Earrings For Women Festival Jewelry Merry Christmas
$0.49
Mix MOQ : 2
Free Shipping
LED Christmas Hat And Scarf Light Up Acrylic Knitted Beanie Xmas Holiday Party Accessories For Adults Kids
LED Christmas Hat And Scarf Light Up Acrylic Knitted Beanie Xmas Holiday Party Accessories For Adults Kids
like
Find Similar
Winter knit Christmas hat in dark blue with a smoking dog pattern and glowing LED lights - Hat Only / Single Hat Style 4
Red Christmas knit beanie featuring reindeer patterns and Oh Deer embroidery with pom pom - Hat Only / Single Hat Style 1
LED Christmas beanie with snowman pattern, red and black pompom, and light-up switch - Hat Only / Single Hat Style 2
Red and white Christmas reindeer knit hat with Ho Ho Ho slogan and pom pom topper - Hat Only / Single Hat Style 3
+93
LED Christmas Hat And Scarf Light Up Acrylic Knitted Beanie Xmas Holiday Party Accessories For Adults Kids
$2.45
No MOQ
 · 
15 views
Christmas Kids Sherpa Fleece Scarf Winter Warm Neck Warmer For Boys And Girls Cross Wrap With Cartoon Holiday Characters
Christmas Kids Sherpa Fleece Scarf Winter Warm Neck Warmer For Boys And Girls Cross Wrap With Cartoon Holiday Characters
like
Find Similar
Pink plush Christmas scarf for kids featuring a snowman and pom-pom on a wooden hanger - One Size / Snowman Pinkish Red
White faux fur kids Christmas scarf with candy cane detail on wooden hanger - One Size / Candy Off-white
Green lamb wool scarf for children with a cute 3D Santa Claus figure decoration - One Size / Santa Fruit Green
Kids warm sherpa fleece scarf in cream white with festive Christmas gift embroidery - One Size / Christmas Gift Khaki
+2
Christmas Kids Sherpa Fleece Scarf Winter Warm Neck Warmer For Boys And Girls Cross Wrap With Cartoon Holiday Characters
$1.44
Mix MOQ : 2
Christmas Series Alloy Rhinestone Keychain Cartoon Santa Claus Christmas Tree Bell Bag Pendant With Tassel Decoration Accessory
Christmas Series Alloy Rhinestone Keychain Cartoon Santa Claus Christmas Tree Bell Bag Pendant With Tassel Decoration Accessory
like
Find Similar
Sparkling Christmas stocking keychain with red green rhinestones and a red tassel - Red and White Enamel Christmas Sock
Detail view of a sparkling rhinestone Santa candy cane keychain with a red tassel and bell - Christmas Candy Cane
Detail of Christmas keychain with red rhinestone bow, bell and tassel on white background - Christmas Bell
Green Christmas tree rhinestone keychain with festive bell and matching green tassel - Christmas Tree
+27
Christmas Series Alloy Rhinestone Keychain Cartoon Santa Claus Christmas Tree Bell Bag Pendant With Tassel Decoration Accessory
-9%
$1.44
Mix MOQ : 6
 · 
68 sold recently
Christmas Cartoon Pattern Knit Beanie Hat For Men Women Winter Warm Acrylic Printed Beanie Festive Santa Reindeer Cold Weather Hat
Christmas Cartoon Pattern Knit Beanie Hat For Men Women Winter Warm Acrylic Printed Beanie Festive Santa Reindeer Cold Weather Hat
like
Find Similar
Detail of Christmas white knit hat with festive hand illustration and holiday greetings - White-Style A
Detailed close-up of white knitted Christmas beanie with festive cartoon print and text - White-Style B
White Christmas knitted beanie hat with Santa cartoon and Merry Christmas print - White-Style C
Detail of white knitted Christmas beanie with festive wreath and reindeer print - White-Style D
+26
Christmas Cartoon Pattern Knit Beanie Hat For Men Women Winter Warm Acrylic Printed Beanie Festive Santa Reindeer Cold Weather Hat
$2.28
Mix MOQ : 2
 · 
16 views
Christmas Knitted Beanie Hat For Adults Winter Warm Acrylic Woolen Hat With Pom Pom Reindeer Santa Claus Pattern Holiday Party Hat
Christmas Knitted Beanie Hat For Adults Winter Warm Acrylic Woolen Hat With Pom Pom Reindeer Santa Claus Pattern Holiday Party Hat
like
Find Similar
Detail of Christmas knitted beanie featuring festive reindeer and snowflake patterns - One Size / White
Christmas knit beanie with pom-pom featuring festive holiday patterns and HO HO HO text - One Size / Rainbow
Christmas knit beanie featuring a reindeer pattern and Let It Snow text with a red pompom - One Size / Multicolor
Winter knitted Christmas beanie in black and red with Santa Claus and reindeer patterns - One Size / Black
Christmas Knitted Beanie Hat For Adults Winter Warm Acrylic Woolen Hat With Pom Pom Reindeer Santa Claus Pattern Holiday Party Hat
-4%
$2.88
No MOQ
Christmas Kids Plush Scarf Soft Warm Neck Warmer Cartoon Deer Bear Decor Pom Pom Scarf For Toddler Winter Holiday Accessories
Christmas Kids Plush Scarf Soft Warm Neck Warmer Cartoon Deer Bear Decor Pom Pom Scarf For Toddler Winter Holiday Accessories
like
Find Similar
Green plush kids scarf featuring a snowman character and red pompom details - Snowman / Green
Christmas Kids Plush Scarf Soft Warm Neck Warmer Cartoon Deer Bear Decor Pom Pom Scarf For Toddler Winter Holiday Accessories
$1.44
Mix MOQ : 2
Cartoon Zinc Alloy Christmas Keychain Enameled Rhinestone Santa Claus Reindeer Tree Bell Pendant Holiday Gift Key Ring For Women
Cartoon Zinc Alloy Christmas Keychain Enameled Rhinestone Santa Claus Reindeer Tree Bell Pendant Holiday Gift Key Ring For Women
like
Find Similar
Christmas keychain featuring enamel reindeer, snowman, and wreath charms on a gold ring - Reindeer Snowman Wreath Style (ER812)
Christmas keychain with Santa Claus, reindeer and Christmas tree enamel pendants - Santa Reindeer Tree Style (ER813)
Golden Christmas keychain with snowflake pendant, wreath and Merry X-mas tag charms - Snowflake Wreath Christmas Tag Style (ER814)
Golden metal keychain with snowflake, Christmas tree and snowman enamel pendants - Snowflake Tree Snowman Style (ER815)
+5
Cartoon Zinc Alloy Christmas Keychain Enameled Rhinestone Santa Claus Reindeer Tree Bell Pendant Holiday Gift Key Ring For Women
-13%
$0.46
No MOQ
 · 
14 sold recently
Christmas Knit Beanie Hat With Pompom Santa Claus Reindeer Snowflake Pattern Warm Winter Jacquard Knit Hat For Men Women Holiday
Christmas Knit Beanie Hat With Pompom Santa Claus Reindeer Snowflake Pattern Warm Winter Jacquard Knit Hat For Men Women Holiday
like
Find Similar
Knitted Christmas hat with red pompom featuring Santa, snowflake and tree patterns - Santa Claus and Tree Style
Knitted Christmas hat with white snowflakes and cartoon monkey design on white background - Cartoon Monkey and LET IT SNOW Style
Detailed close-up of knit Christmas beanie featuring reindeer and tree patterns with blue pom-pom - Reindeer and Cabin Christmas Tree Style
Close-up of knitted Christmas beanie with Santa, reindeer patterns and red pom-pom - Santa Claus and Elk Black Style
+2
Christmas Knit Beanie Hat With Pompom Santa Claus Reindeer Snowflake Pattern Warm Winter Jacquard Knit Hat For Men Women Holiday
$2.74
No MOQ
Christmas Keychain Zinc Alloy Enamel Santa Claus Reindeer Christmas Tree Pendant Rhinestone Holiday Bag Accessories Gift
Christmas Keychain Zinc Alloy Enamel Santa Claus Reindeer Christmas Tree Pendant Rhinestone Holiday Bag Accessories Gift
like
Find Similar
Detail of Christmas keychain with festive pendants featuring Santa and a tree on green background - Christmas Tree And Bell Style (9536) / KC Gold
Golden Christmas keychain with Santa, reindeer and rhinestone tree on a festive background - Santa Claus And Reindeer Style (9543) / KC Gold
Christmas keychain with Santa Claus, snowflake and red sock pendants on green background - Snowflake And Stocking Style (9544) / KC Gold
Christmas keychain with Santa Claus, snowman and tree charms on a festive green background - Snowman And Christmas Tree Style (9568) / KC Gold
+2
Christmas Keychain Zinc Alloy Enamel Santa Claus Reindeer Christmas Tree Pendant Rhinestone Holiday Bag Accessories Gift
-13%
$0.62
No MOQ
Christmas 3D Santa Claus Reindeer Snowflakes Window Stickers Static Cling PVC Decorative Wall Decals For Home Shop Display
Christmas 3D Santa Claus Reindeer Snowflakes Window Stickers Static Cling PVC Decorative Wall Decals For Home Shop Display
like
Find Similar
Detail of Christmas window clings featuring Santa, reindeer, and snowflakes in white and gold - Santa Snowflakes Style (JDT-X78)
3D cartoon Santa, reindeer, and snowman static window decals for Christmas decor - Christmas Cartoon Rendering Style (JDT-X79)
3D Christmas static window clings featuring Santa Claus, snowman, and reindeer 9-piece set - 3D Festive Illustration Style (JDT-X80)
3D Christmas window stickers set featuring Santa, reindeer, and snowflakes for holiday decor - 3D Cute Reindeer Santa Style (JDT-X81)
Christmas 3D Santa Claus Reindeer Snowflakes Window Stickers Static Cling PVC Decorative Wall Decals For Home Shop Display
-11%
$2.16
No MOQ
9 Pcs Christmas Ball Wall Stickers Red White Snowflake Deer Tree Window Decals For Holiday Home Showcase Decoration
9 Pcs Christmas Ball Wall Stickers Red White Snowflake Deer Tree Window Decals For Holiday Home Showcase Decoration
like
Find Similar
Christmas wall stickers set featuring red and white ball ornaments on white wooden door - Christmas Ball Set (PH-QT1279)
9 Pcs Christmas Ball Wall Stickers Red White Snowflake Deer Tree Window Decals For Holiday Home Showcase Decoration
-13%
$0.73
No MOQ
Festive Pink Christmas Pillow Case Polyester Decorative Cushion Cover With Santa Claus Nutcracker Print For Home Sofa Decor
Festive Pink Christmas Pillow Case Polyester Decorative Cushion Cover With Santa Claus Nutcracker Print For Home Sofa Decor
like
Find Similar
Pink Merry Christmas pillow cover in linen with festive tree and bell patterns - Merry Christmas Bubble Font (YMD402-1) / 18x18 Inch
Pink Merry Christmas linen pillow cover with snowman print for festive sofa decor - Merry Christmas Snowman Bow (YMD402-2) / 18x18 Inch
Pink Christmas linen pillowcase with Ho Ho Ho Santa Claus print for home sofa decor - Skateboarding Santa Claus (YMD402-3) / 18x18 Inch
Pink Nutcracker Christmas linen pillow cover with festive cartoon soldier patterns - Nutcracker Soldiers (YMD402-4) / 18x18 Inch
Festive Pink Christmas Pillow Case Polyester Decorative Cushion Cover With Santa Claus Nutcracker Print For Home Sofa Decor
$1.21
No MOQ
Christmas Blue Snowflake Throw Pillow Cover Nordic Polyester Printed Decorative Cushion Case For Sofa Home Holiday Decor
Christmas Blue Snowflake Throw Pillow Cover Nordic Polyester Printed Decorative Cushion Case For Sofa Home Holiday Decor
like
Find Similar
Blue winter snowflake pillow cover with vintage bicycle and hello winter lettering - 18x18 Inch / Vintage Bicycle Pattern (YMD336-1) / Cover Only
Blue Christmas gnome pillow cover with Let It Snow text and snowflake pattern - 18x18 Inch / Gnome and Snowman (YMD336-2) / Cover Only
Blue watercolor mittens and snowflake pattern pillow cover with Warm Winter Wishes text - 18x18 Inch / Blue Mittens Pattern (YMD336-3) / Cover Only
Blue Christmas gnome pillow cover with snowflake patterns on textured linen fabric - 18x18 Inch / Polka Dot Hat Gnome (YMD336-4) / Cover Only
NewChristmas Blue Snowflake Throw Pillow Cover Nordic Polyester Printed Decorative Cushion Case For Sofa Home Holiday Decor
$1.38
Mix MOQ : 2
Christmas Decorative Pillowcase Festive Cartoon Printed Cushion Cover Polyester Santa Claus Reindeer Gnome For Home Sofa Decor
Christmas Decorative Pillowcase Festive Cartoon Printed Cushion Cover Polyester Santa Claus Reindeer Gnome For Home Sofa Decor
like
Find Similar
Square linen Christmas pillowcase with a cartoon reindeer and Merry Christmas print - 45*45cm (No Insert) / Cartoon Reindeer (YMD187-1)
Christmas pillow cover with Santa Claus cartoon print and HoHoHo text on linen fabric - 45*45cm (No Insert) / Santa Claus (YMD187-2)
Christmas cushion cover with cute cartoon gnome and festive fa-la-la pattern print - 45*45cm (No Insert) / Nordic Gnome (YMD187-3)
Christmas linen pillowcase with happy holidays text and three snowmen illustration - 45*45cm (No Insert) / Snowmen (YMD187-4)
Christmas Decorative Pillowcase Festive Cartoon Printed Cushion Cover Polyester Santa Claus Reindeer Gnome For Home Sofa Decor
-5%
$1.31
Mix MOQ : 2
Christmas Elk Animal Printed Polyester Square Throw Pillowcase Decorative Cushion Cover For Home Sofa Living Room Bedroom Decor
Christmas Elk Animal Printed Polyester Square Throw Pillowcase Decorative Cushion Cover For Home Sofa Living Room Bedroom Decor
like
Find Similar
Christmas forest animals pillow case with elk squirrel and fox print on white background - 18x18 Inch / Forest Winter Deer Fox Illustration (DRD289-1)
Festive Christmas elk and snowman illustration on a polyester square throw pillow cover - 18x18 Inch / Snowman With Scarf And Forest Animals Illustration (DRD289-2)
Christmas reindeer and robin watercolor print decorative polyester pillow cover for sofa - 18x18 Inch / Winter Snow Sika Deer And Rabbit Illustration (DRD289-3)
Polyester square Christmas cushion cover with red fox and winter forest landscape - 18x18 Inch / Red Fox Looking Up At Bird Illustration (DRD289-4)
+15
Christmas Elk Animal Printed Polyester Square Throw Pillowcase Decorative Cushion Cover For Home Sofa Living Room Bedroom Decor
-5%
$1.26
Mix MOQ : 4
Christmas Gold White Snowflake Reindeer Angel Print Pillow Cover Peach Skin Polyester Square Cushion Case For Home Sofa Decor
Christmas Gold White Snowflake Reindeer Angel Print Pillow Cover Peach Skin Polyester Square Cushion Case For Home Sofa Decor
like
Find Similar
Detail of golden snowflake Christmas pillow case with festive gift box and ribbon patterns - Drd200-2 / 18x18 Inch
Christmas cushion cover in cream with golden pine branches and festive lettering - Gold Pine Branch And Sequins (DRD200-3)
Detailed view of cream pillow cover with golden Christmas balls and pine branches - Drd200-4 / 18x18 Inch
Golden reindeer and pine trees printed on a white Christmas peach skin pillow cover - Golden Leaping Reindeer (DRD200-5)
+17
Christmas Gold White Snowflake Reindeer Angel Print Pillow Cover Peach Skin Polyester Square Cushion Case For Home Sofa Decor
$1.27
No MOQ
Glow In The Dark Ghost Keychain Resin Christmas Halloween Keyring Spooky Cute Spirit Pendant For Backpack Bag Decor Gift
Glow In The Dark Ghost Keychain Resin Christmas Halloween Keyring Spooky Cute Spirit Pendant For Backpack Bag Decor Gift
like
Find Similar
Close-up of a luminous ghost figurine holding a small Christmas tree on a keychain - Ghost With Christmas Tree Style (JE1521A)
Detail showing a translucent resin ghost holding a gingerbread man on a silver keychain - Ghost With Gingerbread Man Style (JE1521B)
Detail of glow-in-the-dark resin ghost keychain with a tiny snowman held in hand - Ghost With Snowman Style (JE1521C)
Close-up of cute white resin ghost keychain with a tiny coffee cup and silver ring - Ghost With Coffee Cup Style (JE1521D)
+9
Glow In The Dark Ghost Keychain Resin Christmas Halloween Keyring Spooky Cute Spirit Pendant For Backpack Bag Decor Gift
-13%
$0.57-0.88
No MOQ
Christmas Socks Cotton Blend Soft Breathable Mid-Calf Crew Socks For Xmas Party Holiday Cartoon Santa Reindeer Novelty
Christmas Socks Cotton Blend Soft Breathable Mid-Calf Crew Socks For Xmas Party Holiday Cartoon Santa Reindeer Novelty
like
Find Similar
White Christmas crew sock featuring Santa Claus and Merry Christmas text patterns - Style 10 (White Santa)
Men's red Christmas crew sock with gingerbread man, candy cane and snowflake patterns - Style 4 (Red Gingerbread Man)
Christmas socks featuring Santa Claus and tree patterns in red and black cotton blend - Style 3 (Red & Black Santa)
Blue Christmas mid-calf socks with snowman and snowflake patterns in festive colors - Style 8 (Blue Snowman)
+6
Christmas Socks Cotton Blend Soft Breathable Mid-Calf Crew Socks For Xmas Party Holiday Cartoon Santa Reindeer Novelty
$0.92
No MOQ
 · 
10 sold recently
Christmas Knitted Beanie Hat Reindeer Snowflake Jacquard Warm Winter Pom Pom Hat For Parents And Children Festive Acrylic Cap
Christmas Knitted Beanie Hat Reindeer Snowflake Jacquard Warm Winter Pom Pom Hat For Parents And Children Festive Acrylic Cap
like
Find Similar
Detail of knit Christmas snowman hat with red and white colors and plush pom-pom - One Size / Kids Snowman Green
Christmas knit hat with reindeer and snowflake patterns featuring a large red pompom - One Size / Kids Snowflake Reindeer
Winter Christmas reindeer knit hat with large white pompom and festive snowflake pattern - One Size / Kids Reindeer Black
Christmas knit hat with red and white patterns and a fluffy pompom for kids and adults - One Size / Kids Santa Claus Red White
+7
Christmas Knitted Beanie Hat Reindeer Snowflake Jacquard Warm Winter Pom Pom Hat For Parents And Children Festive Acrylic Cap
$2.25-2.39
Mix MOQ : 2
 · 
10 views
Toddler Christmas Reindeer Knit Hat Plush Scarf Gloves Winter Warm Cartoon Animal Accessories For Boys Girls
Toddler Christmas Reindeer Knit Hat Plush Scarf Gloves Winter Warm Cartoon Animal Accessories For Boys Girls
like
Find Similar
Kids Christmas red knit hat scarf and mitten set with 3D reindeer decor for winter warmth - Red 3-Piece Set (No Box)
Pink children's winter warmth set with deer knit hat, plush scarf, and mittens - Pink 3-Piece Set (No Box)
Yellow knitted kids Christmas set with reindeer hat, plush scarf and mittens - Ginger 3-Piece Set (No Box)
Winter set with beige reindeer hat, plush scarf with bells, and grey bear mittens - Khaki 3-Piece Set (No Box)
+6
Toddler Christmas Reindeer Knit Hat Plush Scarf Gloves Winter Warm Cartoon Animal Accessories For Boys Girls
$8.65-10.09
Mix MOQ : 2
 · 
37 views
LED Light Up Knitted Christmas Hat For Men Women Kids Festive Acrylic Warm Winter Beanie With Santa Reindeer Pattern Holiday Party Hat
LED Light Up Knitted Christmas Hat For Men Women Kids Festive Acrylic Warm Winter Beanie With Santa Reindeer Pattern Holiday Party Hat
like
Find Similar
Dark blue LED knitted Christmas hat with Ho Ho Ho text and mixed color pompom - Navy Blue-HO HO HO
Blue LED knitted Christmas hat with Santa Claus motif and Merry X-mas lettering - Red Blue-Santa Claus
Blue LED Christmas knit hat with dinosaur and tree pattern for warm holiday wear - Blue-Dinosaur Tree
LED knitted Christmas hat in black and cyan with reindeer pattern and Oh Deer text - Black Teal-Reindeer Oh Deer
+30
LED Light Up Knitted Christmas Hat For Men Women Kids Festive Acrylic Warm Winter Beanie With Santa Reindeer Pattern Holiday Party Hat
-4%
$2.33
No MOQ
 · 
64 sold recently
Handmade Crochet Keychain Knitted Fruit Flower Animal Bag Charm Pendant Decorative Gift Cute Accessory
Handmade Crochet Keychain Knitted Fruit Flower Animal Bag Charm Pendant Decorative Gift Cute Accessory
like
Find Similar
Blue and white gradient crochet rose flower made of cotton yarn for DIY accessories - Gradient Blue Rose Flower Head
Detail of multi-layered hand-crocheted rose flower in pink and white yarn colors - Gradient Rose Red Rose Head
Handmade red crochet rose flower for DIY clothing accessories and crafts decoration - Red Rose Flower Head
Detail of handmade crochet purple rose flower with white edge for DIY accessories - Gradient Purple Rose Head
+194
Handmade Crochet Keychain Knitted Fruit Flower Animal Bag Charm Pendant Decorative Gift Cute Accessory
-50%
$0.08-9.90
Mix MOQ : 5
 · 
137 sold recently
Free Shipping
Christmas Phone Lanyard Charm Acrylic Beads Metal Bell Anti Drop Wrist Strap Santa Claus Holiday Party Decoration Gift
Christmas Phone Lanyard Charm Acrylic Beads Metal Bell Anti Drop Wrist Strap Santa Claus Holiday Party Decoration Gift
like
Find Similar
Detailed view of Christmas phone strap with red green beads and Santa Claus pendant - Santa Claus Bracelet
Detail of colorful beaded phone strap featuring a Christmas tree charm on a desktop - Christmas Tree
Christmas beaded phone charm with Santa Claus pendant on a minimalist white background - Santa Claus
Detailed view of Christmas phone charm with snowman, Santa, and candy cane beads - Polymer Clay
+3
Christmas Phone Lanyard Charm Acrylic Beads Metal Bell Anti Drop Wrist Strap Santa Claus Holiday Party Decoration Gift
-9%
$0.92-1.78
No MOQ
 · 
23 views
Free Shipping
Christmas Mid-Calf Socks For Men Women Cotton Cartoon Santa Claus Reindeer Pattern Winter Warm Novelty Socks Holiday Party Gift
Christmas Mid-Calf Socks For Men Women Cotton Cartoon Santa Claus Reindeer Pattern Winter Warm Novelty Socks Holiday Party Gift
like
Find Similar
Blue Christmas gingerbread man cotton crew socks with snowflake and gift patterns - Light Blue Snowman
Detail of red Christmas crew sock featuring a reindeer pattern and green striped cuff - Red Base Reindeer
Detail of green Christmas sock with reindeer pattern and Merry Christmas text - Green Base Reindeer
Dark blue Christmas socks with Santa Claus pattern and Happy lettering on white background - Navy Santa Claus
+4
Christmas Mid-Calf Socks For Men Women Cotton Cartoon Santa Claus Reindeer Pattern Winter Warm Novelty Socks Holiday Party Gift
-4%
$1.18
No MOQ
Christmas Santa Claus Faux Fur Pom Pom Keychain Cute Cartoon Bag Pendant Synthetic Leather Metal Key Ring Festive Decoration Gift
Christmas Santa Claus Faux Fur Pom Pom Keychain Cute Cartoon Bag Pendant Synthetic Leather Metal Key Ring Festive Decoration Gift
like
Find Similar
Santa Claus keychain with large red faux fur pompom and gold metal lobster clasp - Santa Claus Style B
Christmas Santa pom pom keychain with red faux leather accents and gold metal ring - Grandpa Santa
Pink faux fur pom pom keychain with leather Santa Claus charm and golden clasp for bags - Santa Claus Style C
Christmas snowman plush pompom keychain with red fur ball and golden lobster clasp - Santa Claus Style D
+6
Christmas Santa Claus Faux Fur Pom Pom Keychain Cute Cartoon Bag Pendant Synthetic Leather Metal Key Ring Festive Decoration Gift
-5%
$0.37-0.74
Mix MOQ : 2
 · 
86 sold recently
Christmas Charms Bead 925 Sterling Silver Enamel Zircon Gingerbread Man Christmas Tree Candy Cane Festive Jewelry Accessory
Christmas Charms Bead 925 Sterling Silver Enamel Zircon Gingerbread Man Christmas Tree Candy Cane Festive Jewelry Accessory
like
Find Similar
1 option
Christmas Charms Bead 925 Sterling Silver Enamel Zircon Gingerbread Man Christmas Tree Candy Cane Festive Jewelry Accessory
$22.01
No MOQ
 · 
13 views
Free Shipping
Cartoon Christmas Santa Hat Brooch Alloy Enamel Rhinestone Reindeer Snowflake Brooches For Holiday Party Jewelry Accessory
Cartoon Christmas Santa Hat Brooch Alloy Enamel Rhinestone Reindeer Snowflake Brooches For Holiday Party Jewelry Accessory
like
Find Similar
Festive red enamel Christmas boot brooch with sparkling rhinestones and golden star detail - Christmas Boot Style (4431934482088)
Christmas hat brooch with red enamel and white rhinestones on golden alloy base - Christmas Hat Style (4431934482089)
Cute Christmas mittens brooch with red enamel and sparkling snowflake rhinestones - Christmas Mitten Style (4431934482090)
Christmas brooch with mint green hanger, reindeer, and snowman pendants in gold alloy - Hanger Snowman Style (4431934482091)
+10
Cartoon Christmas Santa Hat Brooch Alloy Enamel Rhinestone Reindeer Snowflake Brooches For Holiday Party Jewelry Accessory
-9%
$2.12
Mix MOQ : 2
Free Shipping
Stainless Steel Christmas Italian Charm Links Santa Tree Enamel Rhinestone Artificial Pearl Modular Bracelet Charms DIY Accessories
Stainless Steel Christmas Italian Charm Links Santa Tree Enamel Rhinestone Artificial Pearl Modular Bracelet Charms DIY Accessories
like
Find Similar
Italian charm link for DIY bracelet with a red Christmas hat and colorful rhinestone - Red and White Christmas Hat Style (1)
Italian charm stainless steel link with red and green enamel Christmas hat and rhinestone - Red and Green Christmas Hat Style (2)
Italian charm bracelet link in stainless steel with green Christmas stocking design - Green Enamel Christmas Stocking Style (3)
Italian charm bracelet link featuring a red Christmas stocking in stainless steel - Red Green Snowflake Christmas Stocking Style (4)
+28
Stainless Steel Christmas Italian Charm Links Santa Tree Enamel Rhinestone Artificial Pearl Modular Bracelet Charms DIY Accessories
$0.65
Mix MOQ : 10
Free Shipping
Christmas 3D Handmade Press On Nails Santa Claus Reindeer Relief Red Green Festive Artificial Pearl Decorative Fake Nails
Christmas 3D Handmade Press On Nails Santa Claus Reindeer Relief Red Green Festive Artificial Pearl Decorative Fake Nails
like
Find Similar
3D Santa Claus and reindeer press-on nails with Christmas red and green relief designs - XS / Long Almond Shape (3120)
NewChristmas 3D Handmade Press On Nails Santa Claus Reindeer Relief Red Green Festive Artificial Pearl Decorative Fake Nails
$7.20
No MOQ
Christmas Pet Scarf Bow Tie Collar For Dogs Cats Santa Reindeer Printed Polyester Decorative Neckband Festive Accessory
Christmas Pet Scarf Bow Tie Collar For Dogs Cats Santa Reindeer Printed Polyester Decorative Neckband Festive Accessory
like
Find Similar
Christmas pet scarf with red festive print, green silk bow, and Santa Claus ornament - M / Red (Red Scarf)
Green Christmas pet collar with red bow and reindeer charm for small dogs and cats - M / Green (Green Scarf)
Christmas Pet Scarf Bow Tie Collar For Dogs Cats Santa Reindeer Printed Polyester Decorative Neckband Festive Accessory
$2.56-2.85
Mix MOQ : 2
Christmas Window Clings Gingerbread Man House Snowflake Candy Static PVC Decals For Glass Display Holiday Home Decoration
Christmas Window Clings Gingerbread Man House Snowflake Candy Static PVC Decals For Glass Display Holiday Home Decoration
like
Find Similar
Christmas gingerbread man and snowflake static window stickers set for festive holiday decor - Gingerbread Man Snowflake Set (UV24Y12409S_T)
Detailed view of Christmas gingerbread man wall sticker with Merry Christmas red cup and sizes - Red Mug Gingerbread Man (UV24Y12770S_T)
Size guide for 8-sheet Christmas gingerbread man wall stickers with dimensions in cm and inches - Cartoon Gingerbread Man Candy Set (CT24Y12571J_T)
Detail specifications of 107pcs Christmas gingerbread man static window cling stickers set - Festive Snowman Elk Combo (UV24Y12580S_T)
+3
NewChristmas Window Clings Gingerbread Man House Snowflake Candy Static PVC Decals For Glass Display Holiday Home Decoration
$1.30-3.40
Mix MOQ : 2
Christmas Window Stickers PVC Santa Claus Snowflake Reindeer Static Cling Decals For Glass Holiday Party Home Decor
Christmas Window Stickers PVC Santa Claus Snowflake Reindeer Static Cling Decals For Glass Holiday Party Home Decor
like
Find Similar
Christmas window stickers set with 108pcs Santa and reindeer decals on 3 large sheets - Christmas Patterns (TBW9523-UV)
Christmas window decals set with 104 pieces of Santa and snowmen stickers for glass - Gingerbread & Santa (TBW9524-UV)
Detailed set of 80 Christmas window stickers including Santa Claus, snowflakes and joy text - Dark Skin Santa Set (10540T_T) / 20x30cm*4 Sheets
78pcs Christmas window stickers set with cartoon animals and snowflakes for holiday decor - Cartoon Animal Christmas (UV24Y10574T_T) / 20x30cm*6 Sheets
+1
Christmas Window Stickers PVC Santa Claus Snowflake Reindeer Static Cling Decals For Glass Holiday Party Home Decor
$1.73-3.08
Mix MOQ : 2
Vintage Winter Market Scrapbook Paper Pad 20 Sheets 20x20cm Heavyweight Cardstock For DIY Journaling Crafting Decoration
Vintage Winter Market Scrapbook Paper Pad 20 Sheets 20x20cm Heavyweight Cardstock For DIY Journaling Crafting Decoration
like
Find Similar
1 option
Vintage Winter Market Scrapbook Paper Pad 20 Sheets 20x20cm Heavyweight Cardstock For DIY Journaling Crafting Decoration
$1.96
No MOQ
Knitted Christmas Table Runner Festive Santa Reindeer Snowflake Pattern Holiday Tablecloth With Tassel For Home Party
Knitted Christmas Table Runner Festive Santa Reindeer Snowflake Pattern Holiday Tablecloth With Tassel For Home Party
like
Find Similar
Red Christmas snowman table runner with decorative tassels on a festive dinner table - Christmas Snowman Style
Red Christmas table runner with white knitted snowflake patterns and decorative tassels - Red Snowflake Style
Christmas table runner with festive tree patterns and red tassels in a cozy home setting - Green Christmas Tree Style
Christmas table runner with red tassels and holiday wreath patterns on wood dining table - Red Christmas Wreath Style
+5
Knitted Christmas Table Runner Festive Santa Reindeer Snowflake Pattern Holiday Tablecloth With Tassel For Home Party
$2.74
Mix MOQ : 20
Christmas Gingerbread House Bath Mat Non-Slip Absorbent Diatom Mud Floor Rug For Bathroom Kitchen Entrance Decorative Carpet
Christmas Gingerbread House Bath Mat Non-Slip Absorbent Diatom Mud Floor Rug For Bathroom Kitchen Entrance Decorative Carpet
like
Find Similar
Absorbent Christmas bathroom mat with gingerbread house and tree on white hexagonal tiles - Gingerbread House Snow Scene Style (JQ240709-1) / 40x60cm Diatom Mud
Absorbent Christmas gingerbread house bath mat with non-slip backing for bathroom decor - Gingerbread House Heart Window Style (JQ240709-2) / 40x60cm Diatom Mud
Christmas diatom mud bath mat with snowy candy house and tree on white tile floor - Christmas Tree Snowman Candy House Style (JQ240709-3) / 40x60cm Diatom Mud
Christmas buffalo plaid bath mat featuring gingerbread houses and sweets on white tiles - Red Black Buffalo Plaid Gingerbread House Style (JQ240709-4) / 40x60cm Diatom Mud
+52
NewChristmas Gingerbread House Bath Mat Non-Slip Absorbent Diatom Mud Floor Rug For Bathroom Kitchen Entrance Decorative Carpet
-4%
$0.79-5.27
No MOQ
Free Shipping
Christmas Printed Rectangular Tablecloth Polyester Holiday Party Decor Kitchen Dining Room Reindeer Snowflake Pattern
Christmas Printed Rectangular Tablecloth Polyester Holiday Party Decor Kitchen Dining Room Reindeer Snowflake Pattern
like
Find Similar
Dark green Christmas tablecloth featuring Santa and snow prints in a cozy home setting - 140*100cm / Green Reindeer Head
Christmas tablecloth set with Santa patterns and red snowflake chair covers in cozy room - 140*100cm / Blue Santa Bear
Red Christmas tablecloth with white snowman and Merry Christmas print for home decor - 140*100cm / Snowman
Festive Christmas tablecloth featuring red and green holiday prints on white fabric base - 140*100cm / Christmas Bell House
+61
Christmas Printed Rectangular Tablecloth Polyester Holiday Party Decor Kitchen Dining Room Reindeer Snowflake Pattern
-4%
$4.08-10.11
No MOQ
Free Shipping
Christmas Theme Rectangular Tablecloth Polyester Table Cover Reindeer Snowflakes Print Holiday Decor Festive Table Linens
Christmas Theme Rectangular Tablecloth Polyester Table Cover Reindeer Snowflakes Print Holiday Decor Festive Table Linens
like
Find Similar
Deep green Christmas tablecloth with snowmen, reindeer, and Merry Christmas print - 140*100cm / Green Merry Christmas
Dark green Christmas tablecloth featuring Santa and snow prints in a cozy home setting - 140*100cm / Green Reindeer Head
Christmas tablecloth set with Santa patterns and red snowflake chair covers in cozy room - 140*100cm / Blue Santa Bear
Red Christmas tablecloth with white snowman and Merry Christmas print for home decor - 140*100cm / Snowman
+68
Christmas Theme Rectangular Tablecloth Polyester Table Cover Reindeer Snowflakes Print Holiday Decor Festive Table Linens
-4%
$4.08-10.11
No MOQ
Free Shipping
Merry Christmas Polyester Printed Tablecloth Festive Snowflake Tree Pattern Rectangular Table Cover For Xmas Party Home Decor
Merry Christmas Polyester Printed Tablecloth Festive Snowflake Tree Pattern Rectangular Table Cover For Xmas Party Home Decor
like
Find Similar
Rectangular white Christmas tablecloth with festive green trees and red gift prints - 140*100cm / Christmas Tree
Christmas tablecloth with gingerbread house and festive bells pattern on white fabric - 140*100cm / Christmas Bell
Festive red Christmas tablecloth and chair covers featuring Santa Claus and Merry Christmas text - 140*100cm / Red Christmas
Christmas theme waterproof tablecloth set with Santa and reindeer patterns for party decor - 140*100cm / Blue Christmas
+39
Merry Christmas Polyester Printed Tablecloth Festive Snowflake Tree Pattern Rectangular Table Cover For Xmas Party Home Decor
-4%
$4.08-8.74
No MOQ
Elegant Red Rhinestone Long Tassel Earrings For Women High-End Sparkly Dangle Earrings With Stainless Steel Post Party Wedding Jewelry
Elegant Red Rhinestone Long Tassel Earrings For Women High-End Sparkly Dangle Earrings With Stainless Steel Post Party Wedding Jewelry
like
Find Similar
Elegant long fringe earrings with bright red rhinestones worn by a fashion model - Red Semi-circle Large Pendant Earrings
Sparkling long red rhinestone tassel earrings on model showing elegant drape style - Red Long Tassel Earrings Style A
Elegant red rhinestone long tassel drop earrings for women with high-end luxury finish - Luxury Red Rhinestone Tassel Earrings
Macro detail of long red rhinestone tassel earrings showing length and brilliant shine - Red Dense Rhinestone Tassel Style
+52
Elegant Red Rhinestone Long Tassel Earrings For Women High-End Sparkly Dangle Earrings With Stainless Steel Post Party Wedding Jewelry
$0.86-3.80
No MOQ
 · 
1 reviews
Free Shipping
Festive Snow Globe Crystal Ball Luminous Desk Ornament Resin Glass Lucky Cat Santa Claus Figurine For Christmas New Year Home Decor Gift
Festive Snow Globe Crystal Ball Luminous Desk Ornament Resin Glass Lucky Cat Santa Claus Figurine For Christmas New Year Home Decor Gift
like
Find Similar
Five assorted God of Wealth crystal balls with colorful bases and festive red background - 45# (Glowing + Snowflakes) / God of Wealth Style
Set of four Santa Claus crystal snow globes with glowing LED lights for Christmas decor - 45# (Glowing + Snowflakes) / Santa in Christmas Hat
Set of four Christmas glowing crystal balls with Santa, Snowman, and Reindeer figurines - 45# (Glowing + Snowflakes) / Christmas Chimney Style
Cartoon Christmas snow globe set with Santa figurines and glowing festive light base - 45# (Glowing + Snowflakes) / Reindeer Base Style
+30
Festive Snow Globe Crystal Ball Luminous Desk Ornament Resin Glass Lucky Cat Santa Claus Figurine For Christmas New Year Home Decor Gift
$1.63-2.70
No MOQ
5D Relief Snowflake Nail Art Stickers Embossed Metallic Christmas Winter DIY Manicure Decals For Women Nails Decoration
5D Relief Snowflake Nail Art Stickers Embossed Metallic Christmas Winter DIY Manicure Decals For Women Nails Decoration
like
Find Similar
Adhesive Christmas snowflake nail art stickers with metallic gold and red foil patterns - Hot Stamping Gold Jelly (YT6956Pro)
Blue and silver snowflake nail art stickers with metallic finish for winter manicures - Hot Stamping Silver Jelly (YT6957Pro)
New5D Relief Snowflake Nail Art Stickers Embossed Metallic Christmas Winter DIY Manicure Decals For Women Nails Decoration
$0.86
No MOQ
Free Shipping
Christmas Table Runner Jacquard Polyester Cotton Reindeer Snowflakes Pattern Xmas Dining Decor Bed Runner Holiday Party
Christmas Table Runner Jacquard Polyester Cotton Reindeer Snowflakes Pattern Xmas Dining Decor Bed Runner Holiday Party
like
Find Similar
Christmas tree plaid table runner with red and green jacquard weave on wooden table - Plaid 3-tier Tree Hemmed Edge / 35*140cm
Christmas plaid table runner with festive tree and reindeer pattern on wooden table - Christmas Plaid Hemmed Edge / 35*140cm
Green Christmas table runner featuring a Santa Claus print and red pompom tassels - Santa Claus With Red Balls / 35*140cm
Christmas tree and gift box jacquard table runner with red pompom trim and festive plaid - Square 3-Layer Tree With Red Balls / 35*140cm
+60
NewChristmas Table Runner Jacquard Polyester Cotton Reindeer Snowflakes Pattern Xmas Dining Decor Bed Runner Holiday Party
$3.17-6.34
No MOQ
Christmas Jacquard Table Runner Polyester Cotton American Style Plaid Snowflake Reindeer Xmas Tree Dining Table Decor Holiday
Christmas Jacquard Table Runner Polyester Cotton American Style Plaid Snowflake Reindeer Xmas Tree Dining Table Decor Holiday
like
Find Similar
Christmas tree plaid table runner with red and green jacquard weave on wooden table - 35X140cm / Plaid 3-Tier Tree (Hemmed)
Christmas plaid table runner with festive tree and reindeer pattern on wooden table - Christmas Plaid (with Rolled Edges At Both Ends) / 35*140cm
Christmas table runner with green knit trees and red berries on a vintage wooden table - Beaded Christmas Tree (with Two Curled Edges) / 35*140cm
Christmas tree and gift box jacquard table runner with red pompom trim and festive plaid - A 3-layer Grid Tree + A Red Ball (cannot Be Machine Washed) / 35*140cm
+52
Christmas Jacquard Table Runner Polyester Cotton American Style Plaid Snowflake Reindeer Xmas Tree Dining Table Decor Holiday
$3.17-7.49
No MOQ
Go to

More in party supplies

Explore more in snowmen

holidaypartyhangingdesktopmakinghandshapeswindowballpointbracelet necklace
diyresinmankidswarmsteelgirlsmetalphoneunisex

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access