Everful

Wholesale snowmen

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Snowmen

Find the perfect pieces: christmas supplies, halloween supplies and more

Popular collections in snowmen

All products in snowmen

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Women Coral Fleece Floor Socks Thick Warm Winter House Sleeping Stockings Cartoon Animal Christmas Gift Cozy Plush Soft
Women Coral Fleece Floor Socks Thick Warm Winter House Sleeping Stockings Cartoon Animal Christmas Gift Cozy Plush Soft
like
Find Similar
Thick coral fleece Christmas socks with red stripes and puppy design in gift box - No Box / Red White Striped Bear
Detail view of khaki and white striped plush socks with cute bear embroidery and gift box - No Box / Khaki White Striped Bear
Pink striped coral fleece socks with cute ears in a red Christmas gift box - No Box / Winking Pig
Thick warm coral fleece socks with rainbow hearts and 3D bunny ears in a festive gift box - No Box / Full Body Heart Rabbit
+8
Women Coral Fleece Floor Socks Thick Warm Winter House Sleeping Stockings Cartoon Animal Christmas Gift Cozy Plush Soft
$1.07
Mix MOQ : 2
Christmas Decorative Plastic LED Lantern Portable Retro Oil Lamp With Simulated Flame Festive Pattern For Home Holiday Decor
Christmas Decorative Plastic LED Lantern Portable Retro Oil Lamp With Simulated Flame Festive Pattern For Home Holiday Decor
like
Find Similar
White Christmas angel lantern LED flame light with star patterns and hanging ring - Small White Angel
Vintage bronze golden Christmas lantern with angel design and LED flame light effect - Small Golden Angel
Bronze Christmas LED lantern with Santa Claus and tree scene for holiday decor - Small Golden Santa
Bronze vintage LED Christmas lantern with snowman motif and warm flame light effect - Small Golden Snowman
+7
Christmas Decorative Plastic LED Lantern Portable Retro Oil Lamp With Simulated Flame Festive Pattern For Home Holiday Decor
-5%
$0.90
No MOQ
 · 
28 sold recently
Christmas Pillowcase Peach Skin Polyester Cushion Cover For Home Sofa Decor Festive Winter Holiday Print
Christmas Pillowcase Peach Skin Polyester Cushion Cover For Home Sofa Decor Festive Winter Holiday Print
like
Find Similar
Square Christmas pillowcase featuring festive red stocking and Santa Claus illustrations - Christmas Stocking And Santa(DRD213-25)
Dark green Christmas pillowcase with white stylized trees and festive holiday greeting - Three Artistic Christmas Trees(DRD213-26)
Festive Christmas cushion cover featuring snowman graphic on red and green diamond pattern - Snowman With Rhombus Background(DRD213-23)
Detail of square red Christmas pillow cover featuring a cute cartoon Santa and pine branches - Red Background Santa(DRD213-24)
+35
Christmas Pillowcase Peach Skin Polyester Cushion Cover For Home Sofa Decor Festive Winter Holiday Print
-4%
$1.15
Mix MOQ : 2
Christmas LED Hanging String Lights PVC Waterproof USB Battery Powered Warm White Window Wall Decor Holiday Party Novelty
Christmas LED Hanging String Lights PVC Waterproof USB Battery Powered Warm White Window Wall Decor Holiday Party Novelty
like
Find Similar
Christmas LED ball curtain lights with snowman and Santa patterns for indoor decor - 5-String USB Constant Mode / Warm White
Set of 5 LED Christmas hanging lights with Santa and snowman patterns in warm yellow glow - 5-String USB Remote Battery Box / Warm White
LED Christmas light featuring Santa Claus pattern with warm constant battery glow - Smoking Santa Claus / Warm White
LED Christmas suction cup light with windmill snow house pattern and warm glow - Windmill Snow House / Warm White
+9
Christmas LED Hanging String Lights PVC Waterproof USB Battery Powered Warm White Window Wall Decor Holiday Party Novelty
$2.54-10.09
No MOQ
 · 
13 views
Christmas Pillow Covers Peach Skin Polyester Square Cushion Case Festive Home Sofa Decor Reindeer Santa Snowflake Pattern
Christmas Pillow Covers Peach Skin Polyester Square Cushion Case Festive Home Sofa Decor Reindeer Santa Snowflake Pattern
like
Find Similar
Close-up of Christmas pillowcase with red reindeer and snowflake silhouette patterns - Reindeer Snowflake/White (DRD153-1)
Christmas pillowcase featuring a red and green plaid reindeer silhouette on white fabric - Plaid Reindeer/White (DRD153-2)
Red Christmas pillowcase with snowflake pattern and green patchwork Christmas tree - Christmas Tree Patchwork/Red Green (DRD153-3)
Christmas pillowcase with classic red and green plaid tartan pattern for holiday decor - Tartan Plaid (DRD153-4)
+19
Christmas Pillow Covers Peach Skin Polyester Square Cushion Case Festive Home Sofa Decor Reindeer Santa Snowflake Pattern
-4%
$1.15
Mix MOQ : 2
Coral Velvet Christmas Socks Thickened Warm Winter Floor Sleep Socks Cartoon Santa Elk Animal Gift For Unisex
Coral Velvet Christmas Socks Thickened Warm Winter Floor Sleep Socks Cartoon Santa Elk Animal Gift For Unisex
like
Find Similar
Brown and pink striped coral fleece Christmas socks with 3D ears and cartoon gift box - Adult (No Gift Box) / Khaki Striped Mole
Pink polka dot coral fleece socks with cute rabbit plush ears and gift box packaging - Adult (No Gift Box) / Pink Pig
Thick coral fleece Christmas socks featuring festive patterns and warm plush texture - Adult (No Gift Box) / Multicolor Mixed
Yellow coral fleece thermal socks with cartoon chick embroidery in a gift box - Adult (No Gift Box) / Yellow Chick
+67
Coral Velvet Christmas Socks Thickened Warm Winter Floor Sleep Socks Cartoon Santa Elk Animal Gift For Unisex
$1.04
Mix MOQ : 2
 · 
13 views
Christmas Wreath PVC Artificial Pine Needle With Golden Bells Ribbon Bow Merry Christmas Sign For Door Wall Hanging
Christmas Wreath PVC Artificial Pine Needle With Golden Bells Ribbon Bow Merry Christmas Sign For Door Wall Hanging
like
Find Similar
2 options
Christmas Wreath PVC Artificial Pine Needle With Golden Bells Ribbon Bow Merry Christmas Sign For Door Wall Hanging
$7.49-9.80
No MOQ
3D LED Christmas Window Hanging Lights Acrylic Suction Cup Lamp Battery Powered Holiday Party Festive Home Decor
3D LED Christmas Window Hanging Lights Acrylic Suction Cup Lamp Battery Powered Holiday Party Festive Home Decor
like
Find Similar
LED Santa Claus acrylic suction cup light for Christmas tree decoration 11.5x16cm - Santa Claus / Battery Steady Mode
LED acrylic Christmas bell pendant warm white light snowflake decor 11.5x16cm - Christmas Bell / Battery Steady Mode
Luminous LED Christmas snowman hanging light with battery box, 11.5x16cm festive decor - Snowman / Battery Steady Mode
LED Christmas tree suction cup light for festive window decoration, battery powered - Christmas Tree / Battery Steady Mode
+2
3D LED Christmas Window Hanging Lights Acrylic Suction Cup Lamp Battery Powered Holiday Party Festive Home Decor
$3.11
No MOQ
Natural Pine Cones Wood Slices Cinnamon Sticks Christmas Decoration DIY Craft Rustic Nordic Ornament Snowflake Star Heart
Natural Pine Cones Wood Slices Cinnamon Sticks Christmas Decoration DIY Craft Rustic Nordic Ornament Snowflake Star Heart
like
Find Similar
Golden Christmas pine cone bunch with six decorative heads for DIY wreaths - Artificial Gold Large Pine Cones (6 Heads)
Set of 6 natural heart-shaped birch bark slices for DIY wedding and craft decorations - Natural Bark Hearts (6 Pcs)
Pack of 6 snowman shaped natural birch bark ornaments for Christmas DIY crafts - Natural Bark Snowmen (6 Pcs)
6-Pack natural wood snowflake ornaments with bark texture for Christmas DIY, 8cm diameter - Natural Bark Snowflakes A6 (6 Pcs)
+17
Natural Pine Cones Wood Slices Cinnamon Sticks Christmas Decoration DIY Craft Rustic Nordic Ornament Snowflake Star Heart
$0.43-6.28
No MOQ
 · 
11 views
Free Shipping
Vintage Kraft Paper Christmas Greeting Card With Handmade 3D Felt Appliques Envelopes Festive Holiday Gift Cards
Vintage Kraft Paper Christmas Greeting Card With Handmade 3D Felt Appliques Envelopes Festive Holiday Gift Cards
like
Find Similar
Vintage kraft paper Christmas card featuring a 3D felt snowman with matching envelope - Snowman
Brown kraft Christmas card with red felt bell design and a matching envelope set - Bell
Vintage kraft paper Christmas card with red reindeer and green tree cutout plus envelope - Deer
Handmade kraft paper Christmas card with felt tree applique and envelope set - Christmas Tree
+2
Vintage Kraft Paper Christmas Greeting Card With Handmade 3D Felt Appliques Envelopes Festive Holiday Gift Cards
$0.36-2.19
No MOQ
 · 
13 views
LED Neon Sign Desktop Night Light Battery USB Powered For Home Bedroom Decor Party Wedding Atmosphere Novelty Lamp
LED Neon Sign Desktop Night Light Battery USB Powered For Home Bedroom Decor Party Wedding Atmosphere Novelty Lamp
like
Find Similar
Coconut tree LED neon table light with yellow trunk and green leaves on a black base - Coconut Tree Dual Color With Base
Pink LED love neon sign decorative light with round base for desk or bedroom atmosphere - Pink Love Heart With Base
Warm yellow crescent moon LED neon light with white base for bedroom decor - Warm White Moon With Base
Warm yellow LED cloud neon lamp with circular base, 22x10x23cm desktop atmosphere light - Warm White Cloud With Base
+48
LED Neon Sign Desktop Night Light Battery USB Powered For Home Bedroom Decor Party Wedding Atmosphere Novelty Lamp
$4.03-5.19
No MOQ
 · 
185 sold recently
Top 5% Best Sellers
in Home Decor
Snow Globe Music Box Resin Glass Crystal Ball With Led Light And Music Desktop Ornament For Holiday Home Decoration
Snow Globe Music Box Resin Glass Crystal Ball With Led Light And Music Desktop Ornament For Holiday Home Decoration
like
Find Similar
Detailed view of the Christmas snow globe with a Santa figure and glowing red base - Santa Trailer with Gifts
Christmas crystal ball music box with red base, snowman on reindeer, and warm glow - Snowman Riding Reindeer
Christmas musical snow globe with red base, reindeer patterns and a snowman inside - Snowman with Scarf and Wreath
Macro detail of Christmas snow globe featuring Santa, sleigh, and candy house base - Candy House Santa with Gifts
+34
Snow Globe Music Box Resin Glass Crystal Ball With Led Light And Music Desktop Ornament For Holiday Home Decoration
-14%
$4.61-5.76
Mix MOQ : 2
Christmas Snow Globe Music Box With LED Light Resin Glass Desktop Ornament Xmas Decoration Festive Holiday Gift
Christmas Snow Globe Music Box With LED Light Resin Glass Desktop Ornament Xmas Decoration Festive Holiday Gift
like
Find Similar
Set of 4 glowing Christmas snow globes with Santa and snowman on red gift box background - 65# Light Model / Santa Head Base - Large
Set of four Santa Claus crystal snow globes with glowing LED lights for Christmas decor - 45# Light Model / 86 Santa with Xmas Hat
Set of four Christmas glowing crystal balls with Santa, Snowman, and Reindeer figurines - 45# Light Model / 87 Christmas Chimney
Luminous Santa Claus and snowman crystal ball ornaments on red sleigh base - 45# Light Model / 88 Christmas Sleigh
+30
Christmas Snow Globe Music Box With LED Light Resin Glass Desktop Ornament Xmas Decoration Festive Holiday Gift
$1.86-7.01
Mix MOQ : 2
Crystal Ball Music Box Resin Glass Snow Globe With LED Lights Rotating Music Cartoon Style For Kids Girls Birthday Gift
Crystal Ball Music Box Resin Glass Snow Globe With LED Lights Rotating Music Cartoon Style For Kids Girls Birthday Gift
like
Find Similar
Blue princess crystal ball music box with snow castle base and lovely princess text - Blue Princess Castle
Macro detail of unicorn music box showing a golden crescent moon and glittery star base - Unicorn Moon
Detailed close-up of a unicorn snow globe music box with a pink cake-shaped base - Unicorn Rainbow
Dreamy pink castle princess crystal ball music box with floating snow on pink base - Pink Princess Castle
+34
Crystal Ball Music Box Resin Glass Snow Globe With LED Lights Rotating Music Cartoon Style For Kids Girls Birthday Gift
$5.19
Mix MOQ : 2
 · 
40 views
Santa Claus Christmas Jewelry Necklace And Drop Earrings Alloy Enamel Cartoon Holiday Accessory For Women
Santa Claus Christmas Jewelry Necklace And Drop Earrings Alloy Enamel Cartoon Holiday Accessory For Women
like
Find Similar
Christmas Santa Claus jewelry set with gold alloy necklace and earrings in festive colors - Christmas Snowman Earrings Necklace Set
Christmas Santa Claus enamel earrings with golden hooks for festive holiday jewelry sets - Christmas Snowman Earrings
Golden Christmas necklace with Santa Claus enamel pendant on white background - Christmas Snowman Necklace
Santa Claus Christmas Jewelry Necklace And Drop Earrings Alloy Enamel Cartoon Holiday Accessory For Women
$0.76-1.78
No MOQ
Free Shipping
Christmas Stud Earrings Alloy Enamel Rhinestone Festive Holiday Party Gift Cute Snowflake Santa Reindeer Tree For Women Girls
Christmas Stud Earrings Alloy Enamel Rhinestone Festive Holiday Party Gift Cute Snowflake Santa Reindeer Tree For Women Girls
like
Find Similar
Detail of Christmas tree stud earrings with colorful enamel layers and golden edges - #1 Christmas Tree/White Red Green Gold
Christmas tree stud earrings with festive red green enamel and gold finish on white background - #2 Christmas Tree/Red Green White
Detail view of gold Christmas tree stud earrings with green enamel and red crystal rhinestones - #3 Christmas Tree/Green Enamel Rhinestone
Detail of Christmas tree earrings with green enamel and clear rhinestones on gold base - #4 Christmas Tree/Gold Base Green Enamel
+35
Christmas Stud Earrings Alloy Enamel Rhinestone Festive Holiday Party Gift Cute Snowflake Santa Reindeer Tree For Women Girls
-4%
$0.40
Mix MOQ : 12
 · 
115 views
Free Shipping
Christmas Bow Decorations PVC Burlap Velvet Printed Large Ornaments Festive Holiday Party Home Tree Decorating
Christmas Bow Decorations PVC Burlap Velvet Printed Large Ornaments Festive Holiday Party Home Tree Decorating
like
Find Similar
Red PVC Christmas bow with white dots and green tree prints for holiday decoration - 10*15cm / Red Christmas Tree Style
Linen Christmas bow with white tree patterns for festive holiday home decoration - 10*15cm / Christmas Tree
Rustic burlap Christmas bow with snowman print and Let it SNOW lettering for holiday decor - 10*15cm / Christmas Snowman Style
Large red flocked PVC Christmas bow ornament for holiday party and gift decoration - 10*15cm / Red Flocked
+14
Christmas Bow Decorations PVC Burlap Velvet Printed Large Ornaments Festive Holiday Party Home Tree Decorating
$0.29-2.01
No MOQ
 · 
15 views
Free Shipping
Christmas Decorative Bows Faux Linen Burlap Large Ribbon For Christmas Tree Wreath Farmhouse Rustic Holiday Hanging Decor
Christmas Decorative Bows Faux Linen Burlap Large Ribbon For Christmas Tree Wreath Farmhouse Rustic Holiday Hanging Decor
like
Find Similar
Detailed view of red burlap Christmas bow featuring golden reindeer and white tree patterns - Red Christmas Tree Reindeer Style
Close-up of burlap Christmas bow with festive stockings and Merry Christmas printing - Linen Christmas Sock Style
Detail of red and black buffalo plaid Christmas bow with white snowflake patterns - Red Plaid Snowflake Style
Detail of burlap Easter bow featuring colorful egg and butterfly prints on natural texture - Linen Easter Egg Style
+4
Christmas Decorative Bows Faux Linen Burlap Large Ribbon For Christmas Tree Wreath Farmhouse Rustic Holiday Hanging Decor
-5%
$0.49
No MOQ
 · 
39 sold recently
Christmas Placemats Faux Linen Polyester Heat Resistant Buffalo Plaid Holiday Dining Table Decor
Christmas Placemats Faux Linen Polyester Heat Resistant Buffalo Plaid Holiday Dining Table Decor
like
Find Similar
Detail view of red and black buffalo plaid Christmas placemat with snowflake patterns - Style 1 (Red & Black Plaid Snowflake)
Detail view of 45x32cm Christmas placemat with pine motif and black white plaid border - Style 2 (Black & White Plaid Pine)
Red buffalo plaid Christmas placemat with five trees and 45x32cm dimensions detail - Style 3 (Red & Black Plaid Xmas Tree)
Christmas placemat featuring buffalo plaid border and festive trees, size 45x32cm - Style 4 (Black & White Plaid Xmas Tree)
+1
Christmas Placemats Faux Linen Polyester Heat Resistant Buffalo Plaid Holiday Dining Table Decor
$0.57
No MOQ
Christmas Table Runner Cotton Polyester Jacquard Festive Tassel Dining Room Decoration Ornament
Christmas Table Runner Cotton Polyester Jacquard Festive Tassel Dining Room Decoration Ornament
like
Find Similar
Christmas table runner with poinsettia patterns and red tassels on marble table - 1# Poinsettia Floral
Christmas table runner with red poinsettia pattern and elegant tassel decoration - 18# Red Base Jacquard Floral
Christmas snowman table runner and wine bottle bags set with red tassel details - 16# Light Blue Snowman
Detail of red and black buffalo plaid Christmas table runner with white reindeer silhouettes - 17# Red Black Plaid Reindeer
+16
Christmas Table Runner Cotton Polyester Jacquard Festive Tassel Dining Room Decoration Ornament
-5%
$3.01
No MOQ
Christmas Printed Apron Polyester Festive Cooking Party Decoration Santa Claus Reindeer Elf Print Novelty Dressing Up
Christmas Printed Apron Polyester Festive Cooking Party Decoration Santa Claus Reindeer Elf Print Novelty Dressing Up
like
Find Similar
Detail of Christmas apron with Santa's Little Helper text and elf legs print design - 1#-Santa's Little Helper Elf Legs
Detailed flat lay of Christmas apron featuring Santa suit print and festive candy canes - 2#-Santa Suit With Candy Cane
Detailed view of blue Christmas apron featuring a cute cartoon snowman and red ties - 3#-Blue Snowman Pattern
Sexy Christmas apron for women featuring red mini dress print and Merry Christmas text - 5#-Sexy Christmas Dress Pattern
+3
Christmas Printed Apron Polyester Festive Cooking Party Decoration Santa Claus Reindeer Elf Print Novelty Dressing Up
-4%
$1.59
No MOQ
Christmas Gift Boxes Decorative Cardboard Square For Holiday Tree Bottom Party Festive Packaging Cartoon Pattern
Christmas Gift Boxes Decorative Cardboard Square For Holiday Tree Bottom Party Festive Packaging Cartoon Pattern
like
Find Similar
Three-piece stackable green Christmas gift boxes with festive Santa and snowman patterns - HY-3 (S/M/L Set)
Three-piece red Christmas gift box set with green tree patterns and striped lids - HY-2 (S/M/L Set)
Three-piece Christmas gift box set with festive illustrations of Santa and reindeer - HY-1 (S/M/L Set)
Three-piece red Christmas gift box set with gold reindeer and snowflake patterns - HY-4 (S/M/L Set)
+22
Christmas Gift Boxes Decorative Cardboard Square For Holiday Tree Bottom Party Festive Packaging Cartoon Pattern
$0.35-2.31
No MOQ
 · 
39 views
Christmas Mini Village Scenery Set Wooden LED Luminous House Figurines Miniature Tabletop Winter Holiday Town Decor
Christmas Mini Village Scenery Set Wooden LED Luminous House Figurines Miniature Tabletop Winter Holiday Town Decor
like
Find Similar
30-piece Christmas village set with LED glowing cabins, pine trees, and snow powder - 30-Piece Christmas Village Set
31-piece Christmas village set with glowing wooden cabins and miniature snowy trees - 31-Piece Christmas Village Set
14-piece Christmas miniature landscape set with Santa, snowmen, pinecones and lamps - 14-Piece Landscape Ornaments Set
5 LED snowy wooden houses and 8 sisal Christmas trees with wood bases for table decor - 8 Trees + 5 Flocked White Houses Set
+21
Christmas Mini Village Scenery Set Wooden LED Luminous House Figurines Miniature Tabletop Winter Holiday Town Decor
$1.59-39.16
No MOQ
 · 
56 views
Christmas Tree Topper LED Luminous Star Reindeer Iron Glitter Ornament Holiday Party Home Decoration Warm Light
Christmas Tree Topper LED Luminous Star Reindeer Iron Glitter Ornament Holiday Party Home Decoration Warm Light
like
Find Similar
Luminous golden iron Christmas tree topper with LED lights and glittery metal wire finish - 25CM Gold Straight Line Glitter Star
Silver mesh Christmas tree topper star with warm LED lights and a spiral base - 25CM Silver Straight Line Glitter Star
Golden hollow Christmas tree topper star with internal LED lights and glitter finish - 20CM Gold 18-Pointed Star
Lighted silver glitter Christmas tree star topper with LED lights for festive decor - 20CM Silver 18-Pointed Star
+9
Christmas Tree Topper LED Luminous Star Reindeer Iron Glitter Ornament Holiday Party Home Decoration Warm Light
$4.03-7.49
No MOQ
Christmas Snow Globe LED Lantern Retro Fireplace Ornament Plastic Glitter Liquid Glowing Holiday Desktop Decoration
Christmas Snow Globe LED Lantern Retro Fireplace Ornament Plastic Glitter Liquid Glowing Holiday Desktop Decoration
like
Find Similar
Vintage bronze fireplace Christmas crystal lantern with Santa, snow, and warm LED light - Fireplace Santa Claus
Vintage bronze snow globe featuring a snowman with a retro fireplace and clock design - Fireplace Snowman
Bronze fireplace Christmas snow globe lantern with golden deer and swirling sequins - Fireplace Elk
Christmas fireplace snow globe with liquid glitter and festive resin scene in hand - Fireplace Christmas Tree
Christmas Snow Globe LED Lantern Retro Fireplace Ornament Plastic Glitter Liquid Glowing Holiday Desktop Decoration
-4%
$2.88
Mix MOQ : 2
 · 
10 views
Christmas LED Candle Snow Globe Lamp Music Automatic Snowfall Flickering Flame Vintage Bronze Base Holiday Decorative Light
Christmas LED Candle Snow Globe Lamp Music Automatic Snowfall Flickering Flame Vintage Bronze Base Holiday Decorative Light
like
Find Similar
Christmas LED candle light with Santa Claus snow globe scene and vintage bronze base - Tall Santa Claus with Music
Nativity scene LED water candle with spinning glitter and vintage bronze base - Holy Family Nativity Scene with Music
Christmas LED candle light with Santa Claus, glitter snow, and vintage gold base decoration - Retro Tall Santa with Music
Christmas candle lantern with Santa Claus figurine and sparkling snow globe effect - Santa with Bear and Music
+4
Christmas LED Candle Snow Globe Lamp Music Automatic Snowfall Flickering Flame Vintage Bronze Base Holiday Decorative Light
-5%
$6.02-6.57
Mix MOQ : 2
 · 
15 sold recently
Christmas Church Lantern LED Luminous Retro Bronze Plastic Desktop Ornament Holiday Atmosphere Night Light Warm Glow Decoration
Christmas Church Lantern LED Luminous Retro Bronze Plastic Desktop Ornament Holiday Atmosphere Night Light Warm Glow Decoration
like
Find Similar
Bronze Christmas church lantern featuring a miniature snowman scene and warm LED light - Church Snowman
Retro bronze Christmas church lantern featuring Santa Claus illustration and warm LED glow - Church Santa Claus
Bronze vintage LED Christmas church lantern with reindeer silhouettes and warm light - Church Elk
Bronze Christmas church lantern with angel silhouette and warm glowing LED light - Church Angel
Christmas Church Lantern LED Luminous Retro Bronze Plastic Desktop Ornament Holiday Atmosphere Night Light Warm Glow Decoration
-5%
$1.23
Mix MOQ : 2
 · 
40 views
Christmas Earrings Alloy Enamel Holiday Party Jewelry Santa Claus Snowflake Reindeer Bell Cartoon Novelty Cute Festive Accessories
Christmas Earrings Alloy Enamel Holiday Party Jewelry Santa Claus Snowflake Reindeer Bell Cartoon Novelty Cute Festive Accessories
like
Find Similar
5-pair Christmas earring set with Santa, tree, and snowflake in colorful enamel - Christmas Mixed Styles (E0014-1/5 Pairs)
5-pair Christmas earring set with gold reindeer, snowmen, and trees on card - Reindeer Snowman Styles (E0067-1/5 Pairs)
5-pair Christmas earring set with red hats, stockings, and trees on jewelry card - Christmas Hat Gift Styles (E0068-1/5 Pairs)
Christmas earring set with red moose, wreath, and Santa pendants on display card - Santa Claus Glove Styles (E0069-1/5 Pairs)
+15
Christmas Earrings Alloy Enamel Holiday Party Jewelry Santa Claus Snowflake Reindeer Bell Cartoon Novelty Cute Festive Accessories
-12%
$0.92-2.46
No MOQ
 · 
12 views
Glitter Christmas Party Glasses Plastic Antler Tree Frame With Rhinestones And Pom Poms For Holiday Celebration
Glitter Christmas Party Glasses Plastic Antler Tree Frame With Rhinestones And Pom Poms For Holiday Celebration
like
Find Similar
Red glitter Christmas tree party glasses with Merry Christmas gold text detail - Red Christmas Tree
Sparkling gold glitter Christmas tree glasses with red rhinestones and Merry Christmas text - Golden Christmas Tree
Glittering gold reindeer antler Christmas glasses with Merry Christmas text and red frame - Gold with Stone
Glittering gold reindeer antler Christmas glasses with colorful pom-poms and red frame - Gold with Cotton Balls
+21
Glitter Christmas Party Glasses Plastic Antler Tree Frame With Rhinestones And Pom Poms For Holiday Celebration
$0.56
Mix MOQ : 2
Christmas Reindeer Antler Headband With Bells And Bows Elastic Festive Party Hair Accessory For Holiday Cosplay Costume
Christmas Reindeer Antler Headband With Bells And Bows Elastic Festive Party Hair Accessory For Holiday Cosplay Costume
like
Find Similar
Christmas reindeer antler headband in brown and red, measuring 23cm by 24cm for party decor - Brown Antlers Red Pom-pom
Christmas reindeer antler headband with plush balls and measurements in 23cm by 24cm size - Brown Antlers White Pom-pom
Christmas headband with red antlers, polka dot ears and bells, 23cm by 24cm size - Red Antler Snowman Headband
Christmas reindeer headband with red velvet antlers and golden sequined ears for parties - Red Antlers Bow Bell
+1
Christmas Reindeer Antler Headband With Bells And Bows Elastic Festive Party Hair Accessory For Holiday Cosplay Costume
$1.24-1.44
Mix MOQ : 2
 · 
2 reviews
Christmas Headband Reindeer Antlers Sequin Star Santa Claus Party Decoration Hair Accessory Festive Novelty
Christmas Headband Reindeer Antlers Sequin Star Santa Claus Party Decoration Hair Accessory Festive Novelty
like
Find Similar
Christmas snowman headband with dimensions 24cm by 17cm and weight 14.5g details - Snowman with Red Hat
Red sequin Christmas headband with HOHOHO bow and white snowflakes, 23x20cm size - HOHOHO Sequin Bow
Detailed dimensions of the red and gold Christmas star headband with spring coils - Red & Gold Stars
Christmas reindeer antler headband with size dimensions 24.5x21cm and 17g weight details - Gold Reindeer Antlers
+24
Christmas Headband Reindeer Antlers Sequin Star Santa Claus Party Decoration Hair Accessory Festive Novelty
$0.69
Mix MOQ : 2
Christmas Glasses Frame Plastic And Glitter Fabric Festive Holiday Party Photo Props Decorative For Adults Kids
Christmas Glasses Frame Plastic And Glitter Fabric Festive Holiday Party Photo Props Decorative For Adults Kids
like
Find Similar
Macro shot of red glitter reindeer antler glasses with rhinestones and holly details - Red Antlers Style
Green glitter Christmas reindeer glasses frame with red pompom and rhinestones - Green Antlers Style
Sparkly gold Christmas reindeer glasses frame with holly leaf detail and size specs - Gold Reindeer Antlers Style
Christmas tree glasses with gold glitter frames and Merry Christmas festive lettering - Golden Christmas Tree
+59
Christmas Glasses Frame Plastic And Glitter Fabric Festive Holiday Party Photo Props Decorative For Adults Kids
$0.30-0.62
Mix MOQ : 2
 · 
22 sold recently
Christmas Candle Holder Gold Iron Snowflake Reindeer Star Desktop Ornaments With Artificial Pine Pinecones Red Berries
Christmas Candle Holder Gold Iron Snowflake Reindeer Star Desktop Ornaments With Artificial Pine Pinecones Red Berries
like
Find Similar
Golden iron elk candle holder with pine needles, cones and red berries, 15x8cm size - Reindeer Style / 15CM/No Candle
Golden star iron candle holder with pine cones and red berries for Christmas decor - Star Style / 15CM/No Candle
Golden iron snowflake candle holder with pine cones and red berries decorations - Snowflake Style / 15CM/No Candle
Golden Christmas tree candle holder with deer patterns, pine cones and red gift decor - Christmas Tree Style (ABCZ2-4) / 13CM/No Candle
+7
Christmas Candle Holder Gold Iron Snowflake Reindeer Star Desktop Ornaments With Artificial Pine Pinecones Red Berries
$2.56
No MOQ
 · 
47 views
Christmas Ribbons Faux Burlap Decorative Webbing For Tree Ornament Gift Wrapping Wired Edge Printed Festive Party Decor
Christmas Ribbons Faux Burlap Decorative Webbing For Tree Ornament Gift Wrapping Wired Edge Printed Festive Party Decor
like
Find Similar
Red and black plaid Christmas ribbon with white snowflake pattern, 4.8cm wide, 2m long - 4.8cm Width Red Black Plaid Snowflake / 2 Meters
Burlap Christmas ribbon with candy cane print and gold wired edge, 6.3cm x 2m size - 6.3cm Width Khaki Candy / 2 Meters
Linen-style Christmas ribbon 6.3cm x 2m with poinsettia, pine cones and holly berry pattern - 6.3cm Width Khaki Red Flower Pine Cone / 2 Meters
6.3cm wide burlap Christmas ribbon with red berry and holly leaf patterns, 2m length - 6.3cm Width Khaki Green Flower / 2 Meters
+4
Christmas Ribbons Faux Burlap Decorative Webbing For Tree Ornament Gift Wrapping Wired Edge Printed Festive Party Decor
$0.84-1.12
No MOQ
 · 
1 reviews
Christmas Headband LED Glowing Light Up Reindeer Antlers Santa Xmas Tree Feather Sequin Party Costume Accessory Kids Adults
Christmas Headband LED Glowing Light Up Reindeer Antlers Santa Xmas Tree Feather Sequin Party Costume Accessory Kids Adults
like
Find Similar
Light-up Christmas headband with red base, white feathers and golden double stars - Red Gold Pentagram (With Lights + Feather)
LED Christmas reindeer antler headband with colorful glowing feathers and bells - Brown Antlers With Bells (With Lights + Feather)
Close-up of glowing LED Christmas headband with Santa dolls and size dimensions - Santa Claus (With Lights + Feather)
LED Christmas headband with red sequin reindeer antlers and colorful feather trim - Red Scale Antlers (With Lights + Feather)
+27
Christmas Headband LED Glowing Light Up Reindeer Antlers Santa Xmas Tree Feather Sequin Party Costume Accessory Kids Adults
$1.12-1.33
Mix MOQ : 2
Christmas Lantern LED Night Light Church Shape Plastic Handheld Desktop Ornament Warm Light For Holiday Decoration
Christmas Lantern LED Night Light Church Shape Plastic Handheld Desktop Ornament Warm Light For Holiday Decoration
like
Find Similar
White church-style Christmas lantern with warm LED light and snowman illustration - Beige Snowman
White vintage Christmas church lantern with Santa Claus print and warm LED light - Beige Santa
White church-shaped Christmas lantern with reindeer print and warm LED light - Beige Reindeer
White Christmas lantern featuring a warm LED light and festive holiday tree print decoration - Beige Christmas Tree
+4
Christmas Lantern LED Night Light Church Shape Plastic Handheld Desktop Ornament Warm Light For Holiday Decoration
$1.79
Mix MOQ : 2
 · 
14 views
LED Christmas Lantern Retro Portable Plastic Night Light Warm Glow Holiday Home Tabletop Window Ornament Decoration
LED Christmas Lantern Retro Portable Plastic Night Light Warm Glow Holiday Home Tabletop Window Ornament Decoration
like
Find Similar
Ivory Christmas LED lantern with Merry Christmas tree motif and warm ambient lighting - D Christmas Tree
White Christmas lantern featuring a cute snowman design with warm glowing LED light - A Snowman
Vintage Christmas LED lantern with Santa Claus pattern and warm bokeh lighting effects - B Santa Claus
White Christmas retro lantern with Santa Claus pattern and warm LED lighting effect - C Santa with Gift Bag
LED Christmas Lantern Retro Portable Plastic Night Light Warm Glow Holiday Home Tabletop Window Ornament Decoration
$0.82
Mix MOQ : 2
Christmas LED Lantern Night Light Plastic Glass Battery Operated Desktop Hanging Ornament Retro Holiday Decor Santa Elk
Christmas LED Lantern Night Light Plastic Glass Battery Operated Desktop Hanging Ornament Retro Holiday Decor Santa Elk
like
Find Similar
Detail of a white Christmas lantern with warm LED light and Santa Claus patterns - White-Santa
Close-up of white vintage Christmas lantern with LED warm glow and snowman scene inside - White - Snowman
Detail of white Christmas lantern featuring Santa and deer patterns with warm LED lighting - White - Reindeer
Detail of warm LED Christmas lantern showing festive tree and Merry Christmas illustration - White - Christmas Tree
+8
Christmas LED Lantern Night Light Plastic Glass Battery Operated Desktop Hanging Ornament Retro Holiday Decor Santa Elk
$1.33-1.56
No MOQ
 · 
57 sold recently
Christmas LED Electronic Candle Lamp Transparent Plastic Flameless Tealight Warm Yellow Light Desktop Decor Night Light
Christmas LED Electronic Candle Lamp Transparent Plastic Flameless Tealight Warm Yellow Light Desktop Decor Night Light
like
Find Similar
Detail of Santa Claus LED candle lamp with warm light on a marble table decor - Santa Claus
Christmas LED crystal candle light with cartoon chicken print and warm yellow glow - Snowman
Detail of Christmas crystal LED candle light featuring reindeer and Santa illustrations - Elk
Christmas LED Electronic Candle Lamp Transparent Plastic Flameless Tealight Warm Yellow Light Desktop Decor Night Light
$1.04
Mix MOQ : 2
 · 
13 views
Christmas Gift Wrapping Paper Double Sided Vintage Kraft Paper For DIY Holiday Presents Santa Snowflake Patterns
Christmas Gift Wrapping Paper Double Sided Vintage Kraft Paper For DIY Holiday Presents Santa Snowflake Patterns
like
Find Similar
Brown kraft paper gift wrap featuring minimalist green and silver Christmas tree patterns - Gold and Silver Tree / 43cm*10m
Dual-sided Christmas kraft wrapping paper roll with festive gingerbread man and red dot patterns - Cups and Dots / 43cm*10m
Kraft Christmas wrapping paper roll with white snowflake patterns and polka dots - Snowflakes and Dots / 43cm*10m
Retro brown Kraft gift wrap roll with Santa and red Christmas tree patterns, 10m length - Christmas Gifting / 43cm*10m
+11
Christmas Gift Wrapping Paper Double Sided Vintage Kraft Paper For DIY Holiday Presents Santa Snowflake Patterns
-6%
$1.35-3.75
No MOQ
 · 
20 sold recently
Christmas Chocolate Gift Box White Cardboard With Window Golden Foiling Holiday Pastry Candy Packaging Square Foldable Design
Christmas Chocolate Gift Box White Cardboard With Window Golden Foiling Holiday Pastry Candy Packaging Square Foldable Design
like
Find Similar
White Christmas gift box with 6 compartments and gold Merry Christmas text - Chocolate Box - Bell (6 Grids)
White 6-grid Christmas gift box with gold Merry Christmas print and clear window - Chocolate Box - Stocking (6 Grids)
Christmas snowman 6-compartment chocolate gift box with gold snowflakes for festive treats - Chocolate Box - Snowman (6 Grids)
Christmas gift box for 4-grid chocolate featuring a Santa Claus window and gold foil print - Chocolate Box - Santa Claus (4 Grids)
+2
Christmas Chocolate Gift Box White Cardboard With Window Golden Foiling Holiday Pastry Candy Packaging Square Foldable Design
$0.52
Mix MOQ : 50
 · 
20 views
Christmas Gift Packaging Containers Paper Cardboard Butterfly Handle Square Bottom Holiday Party Favors Merry Christmas Print
Christmas Gift Packaging Containers Paper Cardboard Butterfly Handle Square Bottom Holiday Party Favors Merry Christmas Print
like
Find Similar
Blue Christmas gift box with snowman illustration and white bow closure - Snowman
Christmas penguin candy gift box in bright orange with a festive bow closure design - Penguin
Gingerbread house Christmas gift box in orange with cute gingerbread man pattern - Gingerbread Man
Green Christmas candy gift box with Santa Claus print and white butterfly bow closure - Santa Claus
+4
Christmas Gift Packaging Containers Paper Cardboard Butterfly Handle Square Bottom Holiday Party Favors Merry Christmas Print
$0.19
Mix MOQ : 50
 · 
16 views
Christmas Candy Boxes Triangular Pyramid Paper Gift Packaging With Ribbon Tags Cartoon Santa Reindeer Elf Patterns Holiday Party Favors
Christmas Candy Boxes Triangular Pyramid Paper Gift Packaging With Ribbon Tags Cartoon Santa Reindeer Elf Patterns Holiday Party Favors
like
Find Similar
Pyramid Christmas candy box with cute elf face design and festive red ribbon bow - Elf/Boy Face
Pyramid Christmas Santa gift box with red ribbon and Merry Christmas tag on white background - Santa Claus Face
Triangle Christmas gift box with snowman pattern, red ribbon and Merry Christmas tag - Snowman Face
Brown reindeer pyramid Christmas gift box with white snow top and a red ribbon bow - Reindeer Face
Christmas Candy Boxes Triangular Pyramid Paper Gift Packaging With Ribbon Tags Cartoon Santa Reindeer Elf Patterns Holiday Party Favors
$0.09
Mix MOQ : 50
Christmas Pillow Candy Boxes Kraft Paper Gift Packaging For Sweets Holiday Party Favors Merry Christmas Cartoon Patterns
Christmas Pillow Candy Boxes Kraft Paper Gift Packaging For Sweets Holiday Party Favors Merry Christmas Cartoon Patterns
like
Find Similar
Dark green Christmas pillow gift box with white snowflake and house prints for candy - White House
Orange Christmas pillow candy box with festive red house and reindeer illustrations - Red House
Christmas pillow candy box featuring a red background with a reindeer and Christmas tree - Deer
Red Christmas pillow gift box with gold Merry Christmas print on white background - Alphabet
+8
Christmas Pillow Candy Boxes Kraft Paper Gift Packaging For Sweets Holiday Party Favors Merry Christmas Cartoon Patterns
$0.06
Mix MOQ : 50
 · 
27 views
Christmas Pet Bandana Buffalo Plaid Triangle Scarf Holiday Festive Dog Cat Kerchief Merry Christmas Print Fabric Accessories
Christmas Pet Bandana Buffalo Plaid Triangle Scarf Holiday Festive Dog Cat Kerchief Merry Christmas Print Fabric Accessories
like
Find Similar
Close-up of green plaid Christmas dog bandana with reindeer print and Merry Christmas text - Green Buffalo Plaid Reindeer
Detail of red and black buffalo plaid pet Christmas bandana with festive print - Red Buffalo Plaid Elf
Close-up of pink buffalo plaid dog bandana featuring white big SISTER printed lettering - Pink Buffalo Plaid big SISTER
Blue and black buffalo plaid pet bandana with white big BROTHER text and star pattern - Blue Buffalo Plaid big BROTHER (Style C)
+13
Christmas Pet Bandana Buffalo Plaid Triangle Scarf Holiday Festive Dog Cat Kerchief Merry Christmas Print Fabric Accessories
$0.25-0.72
Mix MOQ : 10
Christmas Vintage Train Lantern Ornament LED Warm Light Micro Landscape PVC Antique Style Festive Desktop Decor
Christmas Vintage Train Lantern Ornament LED Warm Light Micro Landscape PVC Antique Style Festive Desktop Decor
like
Find Similar
Close-up of vintage bronze Santa train lantern with LED light and snow scene - Bronze Brushed Gold Snowman
Close-up of vintage bronze Santa train lantern with warm LED glow on festive table - Bronze Brushed Gold Santa Claus
Close-up of vintage bronze Christmas train lantern with reindeer scene and warm light - Bronze Brushed Gold Reindeer
Christmas Vintage Train Lantern Ornament LED Warm Light Micro Landscape PVC Antique Style Festive Desktop Decor
-5%
$3.01
Mix MOQ : 2
 · 
27 views
Christmas LED Snow Globe Lantern Water Injected Glowing Night Light Vintage Hexagonal Tabletop Ornament Plastic Resin Decor
Christmas LED Snow Globe Lantern Water Injected Glowing Night Light Vintage Hexagonal Tabletop Ornament Plastic Resin Decor
like
Find Similar
Luminous hexagonal Christmas lantern with interior Christmas tree and swirling glitter - Gold-brushed Christmas Tree / Bronze
Red Christmas street lamp snow globe light with Santa Claus figurine and sparkling glitter - Red Santa Claus / Red
White retro vintage Christmas lantern lamp with snowman scene and warm glowing lights - White Snowman / White
Christmas LED Snow Globe Lantern Water Injected Glowing Night Light Vintage Hexagonal Tabletop Ornament Plastic Resin Decor
$6.63
Mix MOQ : 2
 · 
10 views
Christmas Ball Ornaments Hanging Tree Decorations Plastic Painted Assorted Shapes Holiday Party Home Decor
Christmas Ball Ornaments Hanging Tree Decorations Plastic Painted Assorted Shapes Holiday Party Home Decor
like
Find Similar
Detailed size chart for 72pcs Christmas ornaments set including tree balls and festive shapes - Red Green Gold Bear Style
72pcs Christmas tree ornaments set with red and gold balls, bells, and Santa shapes - Red Gold Santa Sleigh Style
72-piece Christmas tree ornament set with red and white balls and holiday shapes - Red White Snowman Sock Style
Detailed catalog of 72pcs colorful Christmas tree ornaments including balls and stars - Pink Blue Donut Style
+3
Christmas Ball Ornaments Hanging Tree Decorations Plastic Painted Assorted Shapes Holiday Party Home Decor
$8.82
No MOQ
Christmas Balls Shatterproof Plastic Decorative Hanging Ornaments For Xmas Tree Glitter Pattern Mixed Styles Elegant Holiday Decor
Christmas Balls Shatterproof Plastic Decorative Hanging Ornaments For Xmas Tree Glitter Pattern Mixed Styles Elegant Holiday Decor
like
Find Similar
Set of 9 red, green and white 6cm patterned Christmas balls with glitter motifs - Grinch Elf Style
9-piece 6cm Christmas ball ornaments set in white and gold with glitter and embossing - White Gold Plated
Detail of 9pcs 6cm red Christmas ornaments featuring Santa and tree patterns in a box - Classic Red White Snowman
9-piece 6cm Christmas ball set with red and green festive patterns and Santa motifs - Red Green and White
+3
Christmas Balls Shatterproof Plastic Decorative Hanging Ornaments For Xmas Tree Glitter Pattern Mixed Styles Elegant Holiday Decor
$3.40-3.54
No MOQ
 · 
15 views
Christmas Glasses Frames Glitter Sequin Reindeer Antler Santa Hat Party Costume Props Festive Novelty Eyewear
Christmas Glasses Frames Glitter Sequin Reindeer Antler Santa Hat Party Costume Props Festive Novelty Eyewear
like
Find Similar
Green sequined Christmas glasses frame with white fur and Merry Christmas gold lettering - Green Christmas Hat Style
Santa Claus glasses with hat, gold star and white beard details, size 17.5x17.3cm - Santa Hat with Beard
Christmas party glasses with silver glitter, white fur trim and HO HO HO gold lettering - Silver HOHO Christmas Hat
Christmas reindeer antler glasses with green glitter wreath and Merry Christmas sign - Red Reindeer Antlers with Tinsel
+26
Christmas Glasses Frames Glitter Sequin Reindeer Antler Santa Hat Party Costume Props Festive Novelty Eyewear
$0.44-1.23
No MOQ
 · 
10 views
Christmas Decorative Tie Sequin Felt Glitter Cartoon Pattern Adjustable Elastic Necktie Festive Party Dress Up Costume Accessory
Christmas Decorative Tie Sequin Felt Glitter Cartoon Pattern Adjustable Elastic Necktie Festive Party Dress Up Costume Accessory
like
Find Similar
Detailed dimensions of white glitter Christmas tree tie with green sequin decorations - Christmas Tie / Christmas Tree Berries Style
Detailed size chart of Christmas green sequin tie showing dimensions 41cm x 7.7cm - Christmas Tie / Elf Costume Style
Detail view showing dimensions of kids Christmas tie with Santa Claus and holly design - Christmas Tie / Santa Berries Style
Detail of Christmas Santa necktie with red sequins and 41cm size specifications - Christmas Tie / Santa Outfit Style
+16
Christmas Decorative Tie Sequin Felt Glitter Cartoon Pattern Adjustable Elastic Necktie Festive Party Dress Up Costume Accessory
$0.88
No MOQ
 · 
10 sold recently
Free Shipping
3D Pop Up Christmas Greeting Cards With Envelopes And Stickers Cartoon Honeycomb Holiday Blessing Cards For Kids Family
3D Pop Up Christmas Greeting Cards With Envelopes And Stickers Cartoon Honeycomb Holiday Blessing Cards For Kids Family
like
Find Similar
3D Pop-up Christmas card set with Santa, reindeer, and snowman designs with envelopes - Full Collection Set
3D Pop-up Christmas card set with pink background and festive snowman and santa designs - Pink Snowman Style (Style A)
3D pop-up Christmas card featuring a green honeycomb tree, Santa Claus, and red envelope - Green Xmas Tree Style (Style B)
3D pop-up Christmas card set with snowman design, red envelope and festive sticker - Blue 3D Snowman Style (Style C)
+3
3D Pop Up Christmas Greeting Cards With Envelopes And Stickers Cartoon Honeycomb Holiday Blessing Cards For Kids Family
$0.58-3.46
Mix MOQ : 2
Festive Christmas Decoration Bows With Gold Bells Plaid Velvet Linen Hanging Ornaments For Tree Wreath Gift Decor
Festive Christmas Decoration Bows With Gold Bells Plaid Velvet Linen Hanging Ornaments For Tree Wreath Gift Decor
like
Find Similar
Red and green plaid Christmas bow with golden bells and berries, 9.8cm height ornament - Style A (Red Green Plaid Gold Edge)
Christmas bow ornament in red and green tartan fabric with gold bells and berries - Style B (Red Green Black Plaid)
Christmas plaid ribbon bow with golden bell and leaves, dimensions 9.8cm x 8cm decoration - Style C (Fine Red Green Plaid)
Christmas bow ornament with red and green plaid pattern and golden bells for tree decoration - Style D (Traditional Red Green Plaid)
+12
Festive Christmas Decoration Bows With Gold Bells Plaid Velvet Linen Hanging Ornaments For Tree Wreath Gift Decor
$0.52
Mix MOQ : 2
 · 
1 reviews
Free Shipping
Christmas Headbands Antlers Xmas Tree Santa Hat Sequins PET Fabric Holiday Party Favors Festive Hair Accessories Kids Adults
Christmas Headbands Antlers Xmas Tree Santa Hat Sequins PET Fabric Holiday Party Favors Festive Hair Accessories Kids Adults
like
Find Similar
Brown reindeer antler headband with sequins, bells, red bow and golden ears decoration - Antler Bell Style
Glittery green Christmas tree headband with colorful pom-poms and a golden star topper - Green Star Christmas Tree with Foil
Green Christmas Elf Hat Headband with red bow and dimensions 23cm by 17.5cm for party - Green Feather Elf Hat
Green Christmas tree headband with gold star and colorful pom-poms for party costume - Star Christmas Tree Pom Style
+17
Christmas Headbands Antlers Xmas Tree Santa Hat Sequins PET Fabric Holiday Party Favors Festive Hair Accessories Kids Adults
-16%
$0.53-1.37
No MOQ
 · 
18 sold recently
Christmas Snow Globe Lantern Water Filled LED Night Light Box Glittering Snow Desktop Ornament PC Plastic Resin
Christmas Snow Globe Lantern Water Filled LED Night Light Box Glittering Snow Desktop Ornament PC Plastic Resin
like
Find Similar
Detail of red Christmas gift box snow globe lamp with Santa and reindeer on wooden base - Red Santa & Deer
Close-up of a Santa Claus water snow globe in a green gift box shape with red bow - Green Santa Claus
Close-up of lighted Christmas snow globe gift box with snowman and elk on wood base - White Snowman
Detail of Christmas gift box snow globe with festive tree inside and red bow - Green Tree
+1
Christmas Snow Globe Lantern Water Filled LED Night Light Box Glittering Snow Desktop Ornament PC Plastic Resin
$5.19
No MOQ
 · 
12 views
LED Christmas Lantern Church Shaped Night Light Retro Glowing Desktop Ornament PC Plastic Decorative Holiday Atmosphere Lamp
LED Christmas Lantern Church Shaped Night Light Retro Glowing Desktop Ornament PC Plastic Decorative Holiday Atmosphere Lamp
like
Find Similar
Detail shot of a red Christmas church lantern with warm LED light on wooden base - A Red Old Deer Pulls A Cart
Close-up of white LED church light on a wooden base with winter scenery and bokeh lights - White Snowman
Close-up of bronze church-shaped Christmas lantern with LED candle on a wood base - Bronze-colored Old Man Pulling A Deer Cart
LED Christmas Lantern Church Shaped Night Light Retro Glowing Desktop Ornament PC Plastic Decorative Holiday Atmosphere Lamp
$1.87
No MOQ
 · 
12 views
Christmas Snow Globe Lantern Retro Bronze LED Luminous Music Water Filled Decorative Lamp Desktop Holiday Gift Resin
Christmas Snow Globe Lantern Retro Bronze LED Luminous Music Water Filled Decorative Lamp Desktop Holiday Gift Resin
like
Find Similar
Close-up of vintage bronze Santa lantern on rustic wood slices with festive bokeh lights - Santa Claus
Close-up of vintage bronze snowman street lamp with warm LED lights and swirling glitter - Snowman
Close-up of a vintage bronze Christmas snow globe lamp featuring Santa and a tree - Christmas Tree
Detailed view of a vintage bronze Christmas water lantern with nativity scene and glitter - Nativity Scene Style
Christmas Snow Globe Lantern Retro Bronze LED Luminous Music Water Filled Decorative Lamp Desktop Holiday Gift Resin
$17.29
No MOQ
LED Christmas Train Lantern Night Light Retro Plastic Locomotive Glowing Festive Party Home Decor Gift
LED Christmas Train Lantern Night Light Retro Plastic Locomotive Glowing Festive Party Home Decor Gift
like
Find Similar
Macro shot of red Christmas locomotive lamp featuring Santa and reindeer on wood base - Santa Claus / Red
Close-up of vintage bronze Christmas train lantern with snowman scene and warm LED light - Snowman / Bronze
Detail of Christmas train candle light with tree and elk pattern on wood base - Christmas Tree / White
LED Christmas Train Lantern Night Light Retro Plastic Locomotive Glowing Festive Party Home Decor Gift
$1.41
No MOQ
 · 
15 sold recently
Musical Christmas Snow Village Scene Resin Rotating Train Ornament With Led Light And Music Festive Home Decor Gift
Musical Christmas Snow Village Scene Resin Rotating Train Ornament With Led Light And Music Festive Home Decor Gift
like
Find Similar
Detailed Christmas village scene with colorful LED lights and rotating train on snowy cabin - Santa Claus
Detailed view of LED musical Christmas resin ornament with a rotating small train - Snowman
Luminous Christmas music box with rotating train and snowy tree festive table decoration - Christmas Tree
Musical Christmas Snow Village Scene Resin Rotating Train Ornament With Led Light And Music Festive Home Decor Gift
$24.50
No MOQ
LED Light Up Knitted Christmas Beanie Hat Glowing Colorful Flashing Holiday Party Xmas Novelty Cartoon For Adults Kids
LED Light Up Knitted Christmas Beanie Hat Glowing Colorful Flashing Holiday Party Xmas Novelty Cartoon For Adults Kids
like
Find Similar
White Christmas knit hat with LED Santa Paws dog pattern and red pom-pom - Dog Pattern
Black knitted Christmas hat with Santa, penguin, LED lights and red pompom - Owl Santa Pattern
Green knitted Christmas hat with glowing LED Santa Claus pattern and colorful lights - Finger Santa Pattern
Navy blue LED knitted Christmas hat featuring reindeer pattern and let it snow text - Purple Deer Pattern
+13
LED Light Up Knitted Christmas Beanie Hat Glowing Colorful Flashing Holiday Party Xmas Novelty Cartoon For Adults Kids
$2.31
No MOQ
 · 
133 sold recently
Go to

More in party supplies

Explore more in snowmen

holidaypartyhangingdesktopmakinghandshapeswindowballpointbracelet necklace
diyresinmankidswarmsteelgirlsmetalphonestorage

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access