Everful

Wholesale snowmen

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Snowmen

Find the perfect pieces: christmas supplies, halloween supplies and more

Popular collections in snowmen

All products in snowmen

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Christmas Brooch Pins Alloy Enamel Rhinestone Santa Reindeer Snowman Tree Bell Holiday Jewelry Accessories Women
Christmas Brooch Pins Alloy Enamel Rhinestone Santa Reindeer Snowman Tree Bell Holiday Jewelry Accessories Women
like
Find Similar
Golden reindeer head Christmas brooch pin with detailed antlers on checkered fabric background - 398 Bearded Gold Reindeer
Vintage bronze reindeer head brooch for Christmas DIY accessory or jewelry making - 400 Bearded Antique Bronze Reindeer
Golden vintage reindeer head brooch with detailed antlers on textured background - 399 Gold Reindeer
Christmas tree brooch with colorful rhinestones on a gold-tone alloy base - 423 Branch Style Tree
+18
Christmas Brooch Pins Alloy Enamel Rhinestone Santa Reindeer Snowman Tree Bell Holiday Jewelry Accessories Women
-10%
$0.52-1.31
Mix MOQ : 2
 · 
38 views
Free Shipping
Christmas Wine Bottle Covers Knitted Santa Snowman Elk Decor For Holiday Dinner Party Table Decoration
Christmas Wine Bottle Covers Knitted Santa Snowman Elk Decor For Holiday Dinner Party Table Decoration
like
Find Similar
Knitted snowman wine bottle cover with red stripes and belt for Christmas table decor - Snowman Knitted Cover
Knitted Santa Claus wine bottle cover with faux fur trim and belt for Christmas decor - Santa Claus Knitted Cover
Festive reindeer knitted wine bottle cover with 3D nose and antlers for Christmas decor - Reindeer Knitted Cover
Christmas Wine Bottle Covers Knitted Santa Snowman Elk Decor For Holiday Dinner Party Table Decoration
$1.59
No MOQ
 · 
27 sold recently
Christmas Theme Resin Flatback Charms For DIY Handmade Jewelry Accessories Santa Claus Snowman Crystal Ball Road Sign
Christmas Theme Resin Flatback Charms For DIY Handmade Jewelry Accessories Santa Claus Snowman Crystal Ball Road Sign
like
Find Similar
DIY Christmas resin Santa Claus charm holding Merry Christmas sign for hair accessories - Glossy Santa Claus
Christmas resin sign charm for DIY crafts, snowy Merry Christmas design, 28mm x 22mm size - Glossy Road Sign
Christmas bow reindeer resin accessory for DIY hair clips, size 26mm x 20mm, 3.4g weight - Glossy Bowtie
Resin Christmas snow globe accessory with green tree and bear for DIY crafts - Glossy Crystal Ball
+1
Christmas Theme Resin Flatback Charms For DIY Handmade Jewelry Accessories Santa Claus Snowman Crystal Ball Road Sign
$0.10
No MOQ
 · 
60 sold recently
Christmas Cartoon Gel Pens Plastic Silicone Santa Snowman Reindeer Tree Black Ink Office School Stationery Festival Gift
Christmas Cartoon Gel Pens Plastic Silicone Santa Snowman Reindeer Tree Black Ink Office School Stationery Festival Gift
like
Find Similar
Christmas neutral pen with red barrel and 3D silicone Santa Claus decorative head - Red Santa Claus
Green Christmas tree themed neutral pen with festive 3D star topper for student gift - Green Christmas Tree
Christmas snowman gel pen with white barrel and 3D silicone topper for holiday stationery - White Snowman
Cartoon Christmas snowman gel pen with yellow body and holiday themed decoration - Yellow Elk
Christmas Cartoon Gel Pens Plastic Silicone Santa Snowman Reindeer Tree Black Ink Office School Stationery Festival Gift
$0.12
No MOQ
 · 
167 sold recently
Heat Resistant Oven Mitt And Pot Holder Polyester Kitchen Baking BBQ Christmas Santa Snowman Valentine Eid Pattern Printed
Heat Resistant Oven Mitt And Pot Holder Polyester Kitchen Baking BBQ Christmas Santa Snowman Valentine Eid Pattern Printed
like
Find Similar
Valentine's kitchen set with red heart print oven mitt and pot holder on white base - Christmas Owl
Christmas plaid oven mitt and pot holder set with Santa print for kitchen heat protection - Christmas Glove 8 (Christmas Cheer)
Christmas leopard print oven glove and mat set with Merry Christmas text for kitchen use - Christmas Glove 6 (Leopard Print Tree)
Heat resistant oven mitt and pot holder set with winter snowman pattern and size info - Christmas Glove 10 (Winter Snowman)
+45
Heat Resistant Oven Mitt And Pot Holder Polyester Kitchen Baking BBQ Christmas Santa Snowman Valentine Eid Pattern Printed
$1.54
Mix MOQ : 2
 · 
13 views
Christmas Hair Claw Clips Transparent Acrylic Festive Santa Snowman Gingerbread Man Pattern Hair Accessories For Women
Christmas Hair Claw Clips Transparent Acrylic Festive Santa Snowman Gingerbread Man Pattern Hair Accessories For Women
like
Find Similar
Transparent rectangular hair claw clip with red Christmas sock and candy cane patterns - Christmas Sock & Candy
Transparent acrylic snowman and snowflake hair claw clip for Christmas holiday theme - Snowman & Snowflake
Transparent acrylic hair claw clip with festive snowman and star patterns for Christmas - Snowman & Star
Transparent Christmas claw clip featuring cute Santa Claus patterns and snowflakes - Santa Claus
+8
Christmas Hair Claw Clips Transparent Acrylic Festive Santa Snowman Gingerbread Man Pattern Hair Accessories For Women
$0.95
Mix MOQ : 2
 · 
12 sold recently
Christmas Halloween Temporary Tattoo Stickers Waterproof Cartoon Santa Snowman Reindeer Ghost Pumpkin Festive Party For Kids
Christmas Halloween Temporary Tattoo Stickers Waterproof Cartoon Santa Snowman Reindeer Ghost Pumpkin Festive Party For Kids
like
Find Similar
Detailed grid view of 30 Halloween temporary tattoo designs with ghosts and pumpkins - Halloween Theme (AE)
Detailed grid of 30 watercolor Christmas tattoo stickers with Santa and reindeer designs - Watercolor Christmas (AD)
Set of 30 Christmas temporary tattoos for kids with Santa, reindeer and snowman designs - Classic Christmas (AB)
Christmas Halloween Temporary Tattoo Stickers Waterproof Cartoon Santa Snowman Reindeer Ghost Pumpkin Festive Party For Kids
$0.04
Mix MOQ : 30
 · 
210 sold recently
Christmas Snow Globe Music Box Resin Glass LED Light Music Santa Claus Snowman Desktop Ornament Festive Holiday Decor
Christmas Snow Globe Music Box Resin Glass LED Light Music Santa Claus Snowman Desktop Ornament Festive Holiday Decor
like
Find Similar
Pink Christmas snow globe with Santa Claus figure and golden Merry Christmas base - Christmas Pentagram (2061 Pink Series) / 8cm Music + Light
Pink Christmas crystal ball music box with Santa Claus and golden Merry Christmas base - Christmas Pentagram with Hat (2061 Pink Series) / 8cm Music + Light
Pink Christmas snow globe music box with Santa, snowman, and gold Merry Christmas text - Christmas Gift Box with Hat (2061 Pink Series) / 8cm Music + Light
Luminous Santa Claus snow globe with red striped base and Merry Christmas lettering - Christmas Pentagram (2062 Red Series) / 8cm Music + Light
+24
Christmas Snow Globe Music Box Resin Glass LED Light Music Santa Claus Snowman Desktop Ornament Festive Holiday Decor
$4.86-5.76
Mix MOQ : 2
 · 
14 views
Christmas Mini Figurines Ornaments Resin Ceramic Santa Snowman Reindeer Animal Cute Cartoon Desktop Decor Holiday Gift
Christmas Mini Figurines Ornaments Resin Ceramic Santa Snowman Reindeer Animal Cute Cartoon Desktop Decor Holiday Gift
like
Find Similar
Miniature resin Christmas sheep figurine with red hat and blue bow gift for kids - Lamb
Miniature resin Christmas snowman figurine with red hat and scarf, size 5x3cm - Snowman
Miniature resin hedgehog with Santa hat and teal cup, cute 5.5cm Christmas desktop decor - Hedgehog
Miniature Christmas deer figurine with red hat and candy cane, festive table ornament - Deer
+18
Christmas Mini Figurines Ornaments Resin Ceramic Santa Snowman Reindeer Animal Cute Cartoon Desktop Decor Holiday Gift
$0.86-5.42
No MOQ
 · 
11 views
Christmas Plush Brooches Embroidered Santa Elk Snowman Tree Patches Cute Holiday Party Bag Clothing Decor Accessories
Christmas Plush Brooches Embroidered Santa Elk Snowman Tree Patches Cute Holiday Party Bag Clothing Decor Accessories
like
Find Similar
Plush Christmas reindeer brooch with golden antlers and a green red plaid bow decoration - Cute Reindeer - No Brooch (Patch)
Plush Christmas reindeer brooch with golden glitter antlers and green plaid bow tie - Cute Reindeer - Brooch Style
Cute green Christmas tree plush brooch with golden ribbon and bell on white fur base - Green Character - No Brooch (Patch)
Pair of plush Christmas reindeer hair clips with green bows and golden bells - Reindeer (Ribbon & Bell) - No Brooch (Patch)
+45
Christmas Plush Brooches Embroidered Santa Elk Snowman Tree Patches Cute Holiday Party Bag Clothing Decor Accessories
-5%
$0.21-1.14
No MOQ
 · 
1 reviews
Free Shipping
Christmas Snow Globe Lantern LED Light Tabletop Decoration Retro Train Telephone Booth Santa Snowman Plastic Festive Gift
Christmas Snow Globe Lantern LED Light Tabletop Decoration Retro Train Telephone Booth Santa Snowman Plastic Festive Gift
like
Find Similar
Close-up of vintage bronze Christmas lantern with Santa scene and swirling colorful glitter - Bronze Lantern Santa Claus (Water Injection)
Close-up of lighted red Christmas telephone booth with Santa Claus inside and swirling glitter - Telephone Booth Santa Claus (Water Injection)
Close-up of a lit red telephone booth lantern with a snowman and swirling glitter snow - Telephone Booth Snowman (Water Injection)
Close-up of lighted Christmas red phone booth water lantern with glitter and mini tree - Telephone Booth Christmas Tree (Water Injection)
+12
Christmas Snow Globe Lantern LED Light Tabletop Decoration Retro Train Telephone Booth Santa Snowman Plastic Festive Gift
$2.16-7.20
No MOQ
 · 
15 views
Christmas Snowman Silicone Mold For Candle Making DIY Aromatherapy Soap Resin Crafting Knitted Texture Design Holiday
Christmas Snowman Silicone Mold For Candle Making DIY Aromatherapy Soap Resin Crafting Knitted Texture Design Holiday
like
Find Similar
Silicone snowman mold for DIY candles featuring knitted texture and scarf details - 1# (Small Snowman) / White
DIY Christmas snowman silicone mold with knitted texture for scented wax candles - 2# (Large Snowman) / White
Christmas Snowman Silicone Mold For Candle Making DIY Aromatherapy Soap Resin Crafting Knitted Texture Design Holiday
$1.59-2.16
No MOQ
 · 
12 views
Christmas Building Blocks Music Box DIY Rotating Tree Snowman Gingerbread House Desktop Ornament Festive Gift Plastic
Christmas Building Blocks Music Box DIY Rotating Tree Snowman Gingerbread House Desktop Ornament Festive Gift Plastic
like
Find Similar
Christmas tree building block music box with festive gold snowflake and rotating base - Christmas Tree Music Box - Gift Box Edition
DIY Christmas tree building block music box with LED lights and festive gift box - Christmas Tree Music Box With LED Lights
DIY Christmas tree building block music box with LED lights and rotating base - Christmas Tree Music Box With LED Lights & Case
Christmas stocking building block pen holder with red boots and festive ornaments - Christmas Snow Boots Storage Box
+12
Christmas Building Blocks Music Box DIY Rotating Tree Snowman Gingerbread House Desktop Ornament Festive Gift Plastic
$6.63-25.36
Mix MOQ : 2
 · 
28 views
Christmas Charms Pendants 304 Stainless Steel Snowflake Snowman Reindeer Tree DIY Jewelry Making Crafting Holiday Accessories
Christmas Charms Pendants 304 Stainless Steel Snowflake Snowman Reindeer Tree DIY Jewelry Making Crafting Holiday Accessories
like
Find Similar
Silver stainless steel snowman charm pendant for DIY jewelry making accessories - DY829-1 Steel Color Snowman
Silver stainless steel round hollow hexagram star pendant charm for DIY jewelry - DY834-1 Steel Color Star
Polished stainless steel round pendant with hollow Christmas tree design for DIY jewelry - DY830-1 Steel Color Hollow Christmas Tree
Silver stainless steel Christmas stocking pendant with snowflake cutout for DIY jewelry - DY831-1 Steel Color Christmas Sock
+14
Christmas Charms Pendants 304 Stainless Steel Snowflake Snowman Reindeer Tree DIY Jewelry Making Crafting Holiday Accessories
-13%
$0.23-0.40
No MOQ
 · 
74 sold recently
Free Shipping
Christmas Wind Up Toys Plastic Walking Jumping Santa Claus Snowman Reindeer Penguin Clockwork Holiday Party Favors
Christmas Wind Up Toys Plastic Walking Jumping Santa Claus Snowman Reindeer Penguin Clockwork Holiday Party Favors
like
Find Similar
Wind-up snowman toy with red top hat and smiling face for Christmas gifts - Snowman Ball with Red Top Hat
White snowman wind-up toy with a black top hat and cartoon face for Christmas - Snowman Ball with Black Top Hat
Wind-up Santa Claus toy with a spherical red body and black top hat for Christmas gifts - Santa Ball Clown Style with Top Hat
Wind-up Christmas Santa Claus toy in bright red ball shape with black top hat - Santa Ball with Top Hat
+69
Christmas Wind Up Toys Plastic Walking Jumping Santa Claus Snowman Reindeer Penguin Clockwork Holiday Party Favors
$0.49-0.83
Mix MOQ : 3
 · 
88 sold recently
S925 Sterling Silver Christmas Charms Reindeer Santa Claus Snowman Bead For DIY Jewelry Making Festive Bracelet Xmas Gift
S925 Sterling Silver Christmas Charms Reindeer Santa Claus Snowman Bead For DIY Jewelry Making Festive Bracelet Xmas Gift
like
Find Similar
Cute S925 sterling silver Christmas reindeer charm with colorful enamel for DIY bracelets - Cartoon Reindeer (BSC1184)
S925 sterling silver Christmas safety chain with snowflake, bell and gingerbread man charms - Christmas Safety Chain (BSC1185)
925 sterling silver Santa Claus charm with red enamel and magenta heart crystal - Santa Claus (SCC3204)
S925 sterling silver Christmas wreath pendant with bell and colorful gemstones - Christmas Wreath (SCC3205)
+15
S925 Sterling Silver Christmas Charms Reindeer Santa Claus Snowman Bead For DIY Jewelry Making Festive Bracelet Xmas Gift
$16.51-32.49
No MOQ
 · 
38 views
Free Shipping
Christmas Gift Bags Drawstring Treat Sacks For Candy Apple Santa Snowman Reindeer Linen Knitted Holiday Party Favors
Christmas Gift Bags Drawstring Treat Sacks For Candy Apple Santa Snowman Reindeer Linen Knitted Holiday Party Favors
like
Find Similar
Christmas gift bag with 3D Santa Claus figure and white snowflake drawstring design - Green Border Christmas Santa Bag
Red felt Christmas gift bag with reindeer applique and festive drawstring closure - Green Border Christmas Elk Bag
Christmas gift bag in red velvet featuring a 3D polar bear and white snowflake patterns - Green Border Christmas Bear Bag
Christmas gnome plush bag with red tree hat and heart window for gifts - Christmas Cartoon Santa Bag
+21
Christmas Gift Bags Drawstring Treat Sacks For Candy Apple Santa Snowman Reindeer Linen Knitted Holiday Party Favors
$0.35-2.54
No MOQ
 · 
150 sold recently
Christmas Glass Ornament Set Hand-Painted Santa Snowman Gingerbread Man Hanging Decorations For Tree Holiday Party Decor
Christmas Glass Ornament Set Hand-Painted Santa Snowman Gingerbread Man Hanging Decorations For Tree Holiday Party Decor
like
Find Similar
9pcs set of glass Christmas ornaments with Santa and Snowman in a kraft gift box - Santa And Snowman Theme (Style A)
Set of 9 colorful glass Christmas ornaments with diverse shapes in a brown gift box - Mixed Holiday Gift Theme (Style B)
9-piece glass Christmas ornament set including Santa and Snowman in a display box - Teddy Bear And Train Theme (Style C)
6-piece hand-painted glass Christmas ornaments set in a 15x13x3.5cm kraft gift box - Soldier Bear And Car Theme (Style D)
+1
Christmas Glass Ornament Set Hand-Painted Santa Snowman Gingerbread Man Hanging Decorations For Tree Holiday Party Decor
$4.84-6.92
No MOQ
 · 
24 views
Christmas Snow Globe Lantern LED Light Glitter Water Desktop Ornament Vintage Santa Snowman Xmas Tree Holiday Decor Gift
Christmas Snow Globe Lantern LED Light Glitter Water Desktop Ornament Vintage Santa Snowman Xmas Tree Holiday Decor Gift
like
Find Similar
Detail of Christmas tree water lantern with Santa inside on a vintage book - Christmas Tree Red Santa
Close-up of a white Christmas tree lantern with a snowman and glitter inside the LED core - Christmas Tree White Snowman
Macro detail of Christmas tree light with golden base and swirling glitter effect - Christmas Tree Green Children
Detail of red Christmas lantern featuring Santa scene with LED glittering candle light - Candle Style Santa
+22
Christmas Snow Globe Lantern LED Light Glitter Water Desktop Ornament Vintage Santa Snowman Xmas Tree Holiday Decor Gift
$2.16-6.92
No MOQ
Stainless Steel Christmas Santa Claus Reindeer Snowman Pendant Necklace For Women Festive Enamel Holiday Jewelry Gold
Stainless Steel Christmas Santa Claus Reindeer Snowman Pendant Necklace For Women Festive Enamel Holiday Jewelry Gold
like
Find Similar
Stainless steel Santa Claus pendant necklace with red enamel and 45cm chain length - Santa Claus (G1)
Gold stainless steel Christmas tree pendant necklace with green and red enamel details - Christmas Tree (G2)
Golden stainless steel necklace featuring a festive red and white Santa Claus pendant - Santa Claus (G3)
Golden stainless steel necklace featuring a festive gingerbread man enamel pendant - Gingerbread Man (G4)
+22
Stainless Steel Christmas Santa Claus Reindeer Snowman Pendant Necklace For Women Festive Enamel Holiday Jewelry Gold
$2.12
No MOQ
 · 
23 sold recently
Free Shipping
Christmas Wind Up Toys Assorted Santa Snowman Reindeer Penguin Plastic Clockwork Walking Kids Party Favors Stocking Stuffers
Christmas Wind Up Toys Assorted Santa Snowman Reindeer Penguin Plastic Clockwork Walking Kids Party Favors Stocking Stuffers
like
Find Similar
Set of 12 Christmas wind-up toys including Santa Claus, reindeer, and penguin figures - Christmas Wind-up 12-Piece Set G
12-piece Christmas wind-up toy set featuring Santa, snowman, and reindeer models - Christmas Wind Up 12pcs Set A
Set of 12 festive Christmas clockwork toys featuring Santa, penguin, and reindeer - Christmas Wind Up 12pcs Set B
Detailed grid of 18 wind-up Christmas toys including Santa, reindeer, and penguins - Christmas Wind Up 18pcs Set A
+21
Christmas Wind Up Toys Assorted Santa Snowman Reindeer Penguin Plastic Clockwork Walking Kids Party Favors Stocking Stuffers
$2.59-14.12
Mix MOQ : 2
 · 
19 views
Christmas Flatback Resin Charms For DIY Crafts Phone Case Hair Clip Accessories Santa Snowman Reindeer Angel Gingerbread
Christmas Flatback Resin Charms For DIY Crafts Phone Case Hair Clip Accessories Santa Snowman Reindeer Angel Gingerbread
like
Find Similar
Macro shot of 2.5x2.6cm resin gingerbread house charm for DIY jewelry and phone cases - Yellow House
Christmas resin gingerbread house charm for DIY crafts with snow roof and candy cane details - Red House
Detail view of 2.6x3.2cm resin snowman accessory with black hat and red scarf for DIY - Waving Snowman
Detailed view of snowman resin charm with black hat and red scarf for DIY crafts - Smiling Snowman
+26
Christmas Flatback Resin Charms For DIY Crafts Phone Case Hair Clip Accessories Santa Snowman Reindeer Angel Gingerbread
$0.07-0.13
No MOQ
 · 
15 views
Christmas Stocking Hangers Durable Metal Mantel Hooks Fireplace Decoration Snowflake Reindeer Tree Snowman Festive Home Decor
Christmas Stocking Hangers Durable Metal Mantel Hooks Fireplace Decoration Snowflake Reindeer Tree Snowman Festive Home Decor
like
Find Similar
Polished silver metal snowflake Christmas stocking hook with a sturdy circular base - Snowflake / Silver
Silver metal reindeer Christmas stocking hook with polished finish for fireplace mantel - Reindeer / Silver
Polished silver snowman mantle hook for Christmas stockings with a mirror finish - Snowman / Silver
Silver metal Christmas fireplace hook featuring a 3D gift box design with ribbon bow - Gift Box / Silver
+39
Christmas Stocking Hangers Durable Metal Mantel Hooks Fireplace Decoration Snowflake Reindeer Tree Snowman Festive Home Decor
$1.59-1.82
No MOQ
 · 
11 sold recently
Christmas Scented Candle Gift Box Handmade Mixed Wax Tree Snowman Santa Shapes Festive Home Decor Holiday Gift
Christmas Scented Candle Gift Box Handmade Mixed Wax Tree Snowman Santa Shapes Festive Home Decor Holiday Gift
like
Find Similar
Christmas themed gift bag in red and green with festive cartoon santa illustrations - Christmas Gift Bag
Christmas gift box with snowman candle, green pine tree candle and natural pinecone - Apple Stacked Tree/Snowman Combo
Christmas candle gift set with green tree candle and Santa Claus in a red festive box - Cedar/Santa Combo
Christmas candle gift set featuring green tree candle and snowman in a red round box - Strawberry Snowman/Tree Combo
+9
Christmas Scented Candle Gift Box Handmade Mixed Wax Tree Snowman Santa Shapes Festive Home Decor Holiday Gift
$0.52-5.33
Mix MOQ : 5
 · 
15 sold recently
Christmas Theme Multi Color Ballpoint Pen Retractable Cartoon Capybara Santa Snowman Reindeer Writing School Stationery Holiday Gift
Christmas Theme Multi Color Ballpoint Pen Retractable Cartoon Capybara Santa Snowman Reindeer Writing School Stationery Holiday Gift
like
Find Similar
Christmas Capybara multi-color ballpoint pen with Santa Claus 3D charm and red barrel - Santa Claus (Red)
Christmas Capybara 10-color ballpoint pen with green barrel and festive tree topper - Christmas Tree (Green)
Christmas Capybara multi-color ballpoint pen with 10 colors and cute reindeer topper - Christmas Reindeer (Brown)
Blue Christmas Kapibara 10-color retractable ballpoint pen with a cute white bear topper - Snowman (Blue)
Christmas Theme Multi Color Ballpoint Pen Retractable Cartoon Capybara Santa Snowman Reindeer Writing School Stationery Holiday Gift
$0.35
No MOQ
Silicone Straw Covers Dustproof Reusable Straw Tips For Tumbler Cup Christmas Santa Snowman Gingerbread Decorations
Silicone Straw Covers Dustproof Reusable Straw Tips For Tumbler Cup Christmas Santa Snowman Gingerbread Decorations
like
Find Similar
Pink Christmas skeleton straw cover for 10mm tumblers featuring Freezing Season text - 02 Pink Winter Skull
Pink Santa Claus silicone straw cover with fixed ring for 10mm drinking straws - 03 Pink Jacket Santa
Snowman silicone straw cover cap for 10mm straws featuring a cute snowman with red cup - 04 Snowman with Red Cup
Universal 10mm silicone straw cover featuring a colorful Santa Claus decorative topper - 05 Santa with Light Bulb Beard
+8
Silicone Straw Covers Dustproof Reusable Straw Tips For Tumbler Cup Christmas Santa Snowman Gingerbread Decorations
$0.16
Mix MOQ : 100
 · 
16 views
Alloy Enamel Christmas Charms Pendants Santa Claus Reindeer Snowman Tree For DIY Jewelry Making Holiday Decoration
Alloy Enamel Christmas Charms Pendants Santa Claus Reindeer Snowman Tree For DIY Jewelry Making Holiday Decoration
like
Find Similar
Christmas Santa Claus alloy charm pendant with red and white oil drop finish - 01# Santa Claus (21*20mm)
Cute snowman alloy pendant with red and white striped scarf for Christmas DIY jewelry - 06# Snowman (15*25mm)
Christmas candy cane pendant in red and white alloy enamel for DIY jewelry making - 32# Candy Cane (8*18mm)
Christmas reindeer pendant in gold-tone alloy with white, red, and black enamel drip - 11# Elk (17*23mm)
+68
Alloy Enamel Christmas Charms Pendants Santa Claus Reindeer Snowman Tree For DIY Jewelry Making Holiday Decoration
$0.08-0.24
Mix MOQ : 10
 · 
60 sold recently
Free Shipping
Christmas Keychain Metal Enamel Snowman Christmas Tree Santa Moon Candy Pendant Merry Christmas Bag Charm Holiday Gift
Christmas Keychain Metal Enamel Snowman Christmas Tree Santa Moon Candy Pendant Merry Christmas Bag Charm Holiday Gift
like
Find Similar
Close-up of Christmas keychain with snowman, candy cane, and Merry Christmas charms - Snowman
Close-up of Christmas keychain with gold metal ring, green enamel tree and candy pendants - Christmas Tree
Christmas keychain with gold ring, candy cane, white tree and Merry Christmas plaque - Red Star Christmas Tree
Christmas keychain with Merry Christmas plate, candy cane and tree on a gold ring - White Star Christmas Tree
+2
Christmas Keychain Metal Enamel Snowman Christmas Tree Santa Moon Candy Pendant Merry Christmas Bag Charm Holiday Gift
-9%
$0.70
No MOQ
 · 
81 sold recently
Christmas Brooches Enamel Pins Alloy Cartoon Santa Claus Reindeer Snowman Tree For Holiday Decoration Party Gift
Christmas Brooches Enamel Pins Alloy Cartoon Santa Claus Reindeer Snowman Tree For Holiday Decoration Party Gift
like
Find Similar
Cartoon reindeer Christmas brooch in yellow enamel with size and weight dimensions - Reindeer
Enameled Christmas bells brooch with red bow in gold-tone alloy for holiday outfits - Bell
Enameled Christmas tree brooch pin with colorful ornaments and size measurements - Christmas Tree
Golden snowflake brooch with white enamel detail, size 25mm by 24mm, alloy accessory - Snowflake
+5
Christmas Brooches Enamel Pins Alloy Cartoon Santa Claus Reindeer Snowman Tree For Holiday Decoration Party Gift
-11%
$0.31
Mix MOQ : 2
 · 
116 sold recently
Free Shipping
Christmas Table Runner Linen Printed Santa Reindeer Snowman Pattern For Dining Coffee Table Holiday Home Decoration
Christmas Table Runner Linen Printed Santa Reindeer Snowman Pattern For Dining Coffee Table Holiday Home Decoration
like
Find Similar
Christmas linen table runner featuring bullfinch bird patterns and red green plaid borders - Bullfinch/Lantern/Bell/Red Green Plaid Edge / 33*183cm
Linen Christmas table runner with Merry Christmas text and festive gnome reindeer patterns - Christmas Gnome/Red and White/Merry Christmas / 33*183cm
Linen Christmas table runner with red cardinal bird, poinsettia, and red plaid borders - Cardinal Bird/Poinsettia/Red Black Grid/Merry Christmas / 33*183cm
Close-up of Christmas linen table runner featuring Santa and reindeer on wooden table - Santa Claus/Reindeer/Beige Background / 33*183cm
+8
Christmas Table Runner Linen Printed Santa Reindeer Snowman Pattern For Dining Coffee Table Holiday Home Decoration
$2.56
Mix MOQ : 2
Christmas Plush Doll Reindeer Santa Snowman Pine Cones Bells Decoration Materials Ribbon Wrapping Paper Festive DIY Flower Gift Ornament
Christmas Plush Doll Reindeer Santa Snowman Pine Cones Bells Decoration Materials Ribbon Wrapping Paper Festive DIY Flower Gift Ornament
like
Find Similar
18 options
Christmas Plush Doll Reindeer Santa Snowman Pine Cones Bells Decoration Materials Ribbon Wrapping Paper Festive DIY Flower Gift Ornament
$0.27-3.97
No MOQ
 · 
21 views
Halloween Christmas Nail Art Stickers Self Adhesive Holiday Party Manicure Decoration Pumpkin Skeleton Snowman Santa Penguin
Halloween Christmas Nail Art Stickers Self Adhesive Holiday Party Manicure Decoration Pumpkin Skeleton Snowman Santa Penguin
like
Find Similar
Christmas nail art stickers F688 with Santa, snowman and wreath designs on white background - Self-adhesive F-688 (Unpackaged)
Christmas nail stickers F687 with Santa Claus, snowflakes, and festive trees patterns - Self-adhesive F-687 (Unpackaged)
Christmas nail art stickers F691 featuring snowman and New Year penguin patterns - Self-adhesive F-691 (Unpackaged)
Halloween self-adhesive nail stickers F682 with skeletons, pumpkins, and ghost motifs - Self-adhesive F-682 (Unpackaged)
+6
Halloween Christmas Nail Art Stickers Self Adhesive Holiday Party Manicure Decoration Pumpkin Skeleton Snowman Santa Penguin
$0.22
No MOQ
 · 
50 views
Christmas Wind Up Toys Santa Claus Snowman Reindeer Walking Shaking Head Mechanical Plastic Desktop Novelty Party Favors
Christmas Wind Up Toys Santa Claus Snowman Reindeer Walking Shaking Head Mechanical Plastic Desktop Novelty Party Favors
like
Find Similar
Wind-up walking Santa Claus toy in classic red and white plastic for Christmas gifts - Wind-up Walking Shaking Head Santa Claus
Wind-up walking snowman toy with red hat and green scarf for Christmas gift - Wind-up Walking Shaking Head Snowman
Wind-up brown reindeer toy with red scarf and felt antlers for Christmas gift - Wind-up Walking Shaking Head Reindeer
Christmas Wind Up Toys Santa Claus Snowman Reindeer Walking Shaking Head Mechanical Plastic Desktop Novelty Party Favors
$1.44
Mix MOQ : 10
 · 
10 sold recently
Free Shipping
Christmas Knitted Glowing Hat And Scarf Winter Warm Light Up Beanie Reindeer Snowman Pattern Holiday Party Adults Kids
Christmas Knitted Glowing Hat And Scarf Winter Warm Light Up Beanie Reindeer Snowman Pattern Holiday Party Adults Kids
like
Find Similar
LED Christmas knitted hat featuring red and white reindeer pattern and Merry Christmas text - Reindeer Christmas Tree Style-Christmas Hat
Reindeer pattern knitted hat and scarf set with colorful glowing LED lights - Black Double Reindeer-Set
Knitted Christmas hat with colorful LED lights, red and white stripes with pom-pom top - Christmas Tree Short Style-Christmas Hat
Knitted Christmas hat with LED lights featuring Santa and reindeer patterns - Christmas Clown Style-Christmas Hat
+46
Christmas Knitted Glowing Hat And Scarf Winter Warm Light Up Beanie Reindeer Snowman Pattern Holiday Party Adults Kids
$2.31-4.84
No MOQ
 · 
12 sold recently
Christmas Glasses Frames Glitter Plastic Felt Party Decoration Holiday Favors Photo Props Reindeer Antler Santa Snowman
Christmas Glasses Frames Glitter Plastic Felt Party Decoration Holiday Favors Photo Props Reindeer Antler Santa Snowman
like
Find Similar
Red sequin Christmas reindeer glasses with colorful pom-poms for festive parties - Red Cotton Ball
Sparkly red glitter reindeer Christmas glasses frame with holly leaf for kids party decor - Red Antlers Style
Detailed view of rose gold glitter Christmas glasses with bunny ears and dimensions - Brown Rabbit Ears
Glittery gold Merry Christmas glasses frame with holly leaves and white snowflake decor - Golden Merry Christmas
+60
Christmas Glasses Frames Glitter Plastic Felt Party Decoration Holiday Favors Photo Props Reindeer Antler Santa Snowman
$0.31-0.69
No MOQ
 · 
110 sold recently
Christmas Stocking Gift Bag 3D Cartoon Santa Snowman Reindeer Bear Plaid Burlap Xmas Tree Hanging Ornament Festive Decor
Christmas Stocking Gift Bag 3D Cartoon Santa Snowman Reindeer Bear Plaid Burlap Xmas Tree Hanging Ornament Festive Decor
like
Find Similar
Christmas stocking with Santa Claus applique and red-green plaid cuff for holiday decor - Fence Large Stocking-Santa Claus / 32*19CM
Detailed view of red plaid Christmas stocking with 3D plush bear on a white fireplace - 3D Extra Large Stocking-Bear / 40*25cm
Detail of Christmas stocking with 3D snowman doll and Merry Christmas text on tree - Extra Large Stocking with Legs-Snowman / 47*28cm
Close-up of a festive Christmas stocking with a 3D plush reindeer on a branch - Extra Large Stocking with Legs-Reindeer / 47*28cm
+58
Christmas Stocking Gift Bag 3D Cartoon Santa Snowman Reindeer Bear Plaid Burlap Xmas Tree Hanging Ornament Festive Decor
-5%
$0.52-3.84
No MOQ
 · 
10 sold recently
Merry Christmas Stickers Stamp Style Santa Claus Snowman Reindeer Decorative Adhesive Labels Gift Packaging Envelope Decor
Merry Christmas Stickers Stamp Style Santa Claus Snowman Reindeer Decorative Adhesive Labels Gift Packaging Envelope Decor
like
Find Similar
500pcs roll of vintage stamp style Merry Christmas stickers measuring 36mm x 50mm - 50*36MM / Santa Claus Snowman Style (Style 1)
500pcs roll of vintage stamp style Merry Christmas stickers with Santa and snowman designs - 50*36MM / Holiday Gift Box Decor Style (Style 2)
Roll of 500 stamp-style Merry Christmas stickers with Santa and reindeer designs - 50*36MM / Reindeer Stocking Illustration Style (Style 3)
NewMerry Christmas Stickers Stamp Style Santa Claus Snowman Reindeer Decorative Adhesive Labels Gift Packaging Envelope Decor
$2.68
No MOQ
Christmas DIY Charms Resin Flatback Accessories Glitter Santa Claus Snowman Tree For Phone Case Hair Clips Decor
Christmas DIY Charms Resin Flatback Accessories Glitter Santa Claus Snowman Tree For Phone Case Hair Clips Decor
like
Find Similar
Glittery resin Christmas reindeer charm with silver sequins and colorful details - Deer
Glittery snowman DIY resin accessory with red hat and dimensions 28mm by 26mm - Snowman
Glitter Christmas glove resin accessory in green with red dots and white wave trim - Green Glove
Glittery red Christmas glove resin accessory with white snowflake patterns for DIY crafts - Red Glove
+10
Christmas DIY Charms Resin Flatback Accessories Glitter Santa Claus Snowman Tree For Phone Case Hair Clips Decor
-11%
$0.08-0.13
Mix MOQ : 10
 · 
19 views
Christmas Burlap Tote Bags With 3D Plush Dolls Santa Snowman Reindeer For Party Gift Packaging Holiday Decor
Christmas Burlap Tote Bags With 3D Plush Dolls Santa Snowman Reindeer For Party Gift Packaging Holiday Decor
like
Find Similar
Christmas Santa Claus burlap gift bag with faux fur trim, dimensions 34x20cm for holiday candy - Santa Claus
Christmas snowman candy gift bag in deep red linen with festive plush trim and belt - Snowman
Christmas gift bag with 3D plush reindeer design and festive golden buckle detail - Christmas Reindeer
Christmas burlap gift bag with 3D plush bear wearing plaid hat and golden snowflakes - Christmas Bear
Christmas Burlap Tote Bags With 3D Plush Dolls Santa Snowman Reindeer For Party Gift Packaging Holiday Decor
-5%
$1.64
No MOQ
Christmas Coral Fleece Thickened Warm Floor Socks Soft Fuzzy Festive Winter Crew Socks With Santa Reindeer Snowman Patterns
Christmas Coral Fleece Thickened Warm Floor Socks Soft Fuzzy Festive Winter Crew Socks With Santa Reindeer Snowman Patterns
like
Find Similar
Close-up of coral fleece Christmas socks with snowman pattern and festive holiday decor - One Size / Scarf Snowman
Red and white coral fleece Christmas socks featuring Santa Claus on a wooden surface - One Size / Santa Claus
Plush Christmas socks in white with red hearts and green tree patterns in coral fleece - One Size / Heart and Small Tree
Flat lay of soft red Christmas coral fleece socks with snowman pattern on wooden floor - One Size / Red Multiple Snowmen
+40
Christmas Coral Fleece Thickened Warm Floor Socks Soft Fuzzy Festive Winter Crew Socks With Santa Reindeer Snowman Patterns
$0.56-0.63
No MOQ
 · 
874 sold recently
Christmas Brooch Pin Retro Alloy Enamel Rhinestone Festive Santa Tree Snowman Holiday Party Clothes Decor Accessory
Christmas Brooch Pin Retro Alloy Enamel Rhinestone Festive Santa Tree Snowman Holiday Party Clothes Decor Accessory
like
Find Similar
Classic snowman brooch with red hat and scarf accessory for Christmas outfits - Red Hat Snowman
Cute Santa Claus brooch with red enamel finish and sparkling red crystal star accent - Q-Style Santa Claus
Vintage silver Christmas tree brooch with festive red and green rhinestones decoration - Antique Silver Colorful Stone Tree
Vintage gold-plated Christmas tree brooch with green enamel and colorful rhinestones - Green Enamel Christmas Tree
+21
Christmas Brooch Pin Retro Alloy Enamel Rhinestone Festive Santa Tree Snowman Holiday Party Clothes Decor Accessory
-9%
$0.39-1.44
No MOQ
 · 
36 sold recently
Free Shipping
Christmas Gift Bags Drawstring Plastic Foil Wrapping Bags For Party Favors Santa Reindeer Snowman Patterns Holiday Decor
Christmas Gift Bags Drawstring Plastic Foil Wrapping Bags For Party Favors Santa Reindeer Snowman Patterns Holiday Decor
like
Find Similar
Variety of colorful Christmas drawstring gift bags with festive patterns and ribbon bows - Christmas Gift Bag Set
Blue and purple drawstring Christmas gift bags with snowflake and Santa Claus patterns - Christmas Gift Bag Assortment
Set of drawstring Christmas gift bags in various colors with festive holiday prints - Christmas Gift Bag Multi-color Set
Set of colorful Christmas drawstring gift bags in red, blue, green and purple colors - Christmas Gift Bag Set
+51
Christmas Gift Bags Drawstring Plastic Foil Wrapping Bags For Party Favors Santa Reindeer Snowman Patterns Holiday Decor
-5%
$0.19-12.97
No MOQ
 · 
25 sold recently
Christmas Miniature Figurines Wooden Display Stand Resin Gingerbread Man Snowman Reindeer Tree Desktop Decoration Dollhouse Accessory
Christmas Miniature Figurines Wooden Display Stand Resin Gingerbread Man Snowman Reindeer Tree Desktop Decoration Dollhouse Accessory
like
Find Similar
Miniature Christmas decor set with wooden display rack, snowman and festive bell ornaments - Snowman Set 1 (4 Pieces)
Mini Christmas gingerbread man figurine set with snowman and three-layer display stand - Snowman Set 2 (4 Pieces)
Miniature Christmas set with tree, reindeer, and train on a 3-tier wooden stand - Reindeer Set (4 Pieces)
Miniature Christmas set with wooden stand, gingerbread man and tree for DIY decor - Gingerbread Man Set 1 (5 Pieces)
+2
Christmas Miniature Figurines Wooden Display Stand Resin Gingerbread Man Snowman Reindeer Tree Desktop Decoration Dollhouse Accessory
-5%
$2.08-2.30
No MOQ
 · 
18 views
Free Shipping
Christmas Theme Charms Resin Alloy Pendants DIY Jewelry Making Accessory Santa Claus Snowman Reindeer Tree Ornament
Christmas Theme Charms Resin Alloy Pendants DIY Jewelry Making Accessory Santa Claus Snowman Reindeer Tree Ornament
like
Find Similar
Detail of Christmas wreath pendant with red bow and gold bell for DIY accessories - Christmas Wreath
Detailed macro view of a red Santa Claus resin pendant with a silver metal loop for DIY - Santa Claus
Macro view of red Christmas gift box charm with green bow and golden cross detail - Christmas Gift
Green resin Christmas stocking pendant with red accents and a white knit texture charm - Christmas Green Sock
+9
Christmas Theme Charms Resin Alloy Pendants DIY Jewelry Making Accessory Santa Claus Snowman Reindeer Tree Ornament
$0.15
Mix MOQ : 20
 · 
459 sold recently
Free Shipping
Christmas Mailbox Ornament Metal Mini Postbox Hanging Decor With Santa Snowman Figurines For Holiday Tree Decoration
Christmas Mailbox Ornament Metal Mini Postbox Hanging Decor With Santa Snowman Figurines For Holiday Tree Decoration
like
Find Similar
Red Christmas mailbox ornament with To Santa Claus lettering, 10cm height metal pendant - Postbox Style / Red Simple Style 3
Christmas snowman mailbox ornament with festive tree and Merry Christmas text - Snowman Decor Style / White Vintage Style
Santa Claus with green mailbox Christmas tree hanging ornament in hand-painted metal - Santa Decor Style / Green Vintage Style
Red Christmas mailbox ornament with moose and cedar tree on festive background - Moose Decor Style / Red Vintage Style
+2
Christmas Mailbox Ornament Metal Mini Postbox Hanging Decor With Santa Snowman Figurines For Holiday Tree Decoration
-5%
$2.88-6.85
No MOQ
Free Shipping
Christmas Stockings Burlap Felt Fabric Raised Santa Snowman Reindeer Pattern Hanging Fireplace Gift Bags Festive Decor
Christmas Stockings Burlap Felt Fabric Raised Santa Snowman Reindeer Pattern Hanging Fireplace Gift Bags Festive Decor
like
Find Similar
Exquisite 3D Christmas stockings featuring reindeer snowman and Santa for holiday gift candy bag - Set of 3 Door Hanging
Christmas reindeer gift stocking with green scarf and size markings 20cm by 13cm - Door Hanging Reindeer
Santa Claus burlap Christmas stocking with bells and plaid knit detail, 20x13cm size - Door Hanging Santa
Medium 20cm snowman Christmas stocking with red plaid and green felt for candy gifts - Door Hanging Snowman
+16
Christmas Stockings Burlap Felt Fabric Raised Santa Snowman Reindeer Pattern Hanging Fireplace Gift Bags Festive Decor
-5%
$1.03-13.52
No MOQ
 · 
59 sold recently
Christmas Ceramic Mug With Star Handle Wave Design Lid And Spoon Cartoon Reindeer Snowman Santa Porcelain Coffee Cup Holiday Gift
Christmas Ceramic Mug With Star Handle Wave Design Lid And Spoon Cartoon Reindeer Snowman Santa Porcelain Coffee Cup Holiday Gift
like
Find Similar
Ceramic Christmas mug with gingerbread man pattern and green wavy star handle - Gingerbread Man - Single Cup
Christmas ceramic mug with snowman illustration, red wavy handle and star detail - Christmas Snowman - Single Cup
Christmas ceramic mug with green wavy handle and festive reindeer graffiti pattern - Cute Reindeer - Single Cup
Christmas ceramic mug with Santa pattern, red wavy handle and a yellow star topper - Santa Claus - Single Cup
+4
Christmas Ceramic Mug With Star Handle Wave Design Lid And Spoon Cartoon Reindeer Snowman Santa Porcelain Coffee Cup Holiday Gift
$3.08-4.01
No MOQ
 · 
27 views
Christmas Charm Bracelet DIY Beaded Snake Chain Alloy Glass Beads Snowflake Snowman Christmas Tree Festive Jewelry Gift
Christmas Charm Bracelet DIY Beaded Snake Chain Alloy Glass Beads Snowflake Snowman Christmas Tree Festive Jewelry Gift
like
Find Similar
Silver snake chain bracelet for Christmas DIY charms with sleek cylindrical clasp - 18cm Basic Chain
DIY Christmas charm bracelet with snowman, tree and snowflake beads in red and green colors - SD-0015 Christmas Set
Christmas beaded bracelet with red green crystals and festive Santa charms on white background - SD-0014 Christmas Set
Silver snake chain bracelet with heart charm and lobster clasp for DIY Christmas jewelry - Lobster Clasp Base Chain 18+5cm
+3
Christmas Charm Bracelet DIY Beaded Snake Chain Alloy Glass Beads Snowflake Snowman Christmas Tree Festive Jewelry Gift
$0.73-3.30
No MOQ
 · 
13 sold recently
Free Shipping
Christmas Lantern Round Vintage LED Electronic Candle Light Desktop Hanging Ornament Santa Snowman Holiday Atmosphere Decor
Christmas Lantern Round Vintage LED Electronic Candle Light Desktop Hanging Ornament Santa Snowman Holiday Atmosphere Decor
like
Find Similar
White LED Christmas lantern featuring Santa Claus and pine tree scene with warm light - Small / Santa Claus White
White Christmas LED candle lantern with snowman scene and warm light sitting in snow - Small / Snowman White
Detail of vintage Christmas lantern with LED candle, snowman scene and bronze finish - Small / Snowman Bronze
Macro detail of a vintage bronze LED Christmas lantern with Santa Claus illustration - Small / Santa Claus Bronze
+6
Christmas Lantern Round Vintage LED Electronic Candle Light Desktop Hanging Ornament Santa Snowman Holiday Atmosphere Decor
$1.87-8.29
Mix MOQ : 2
 · 
60 sold recently
Nordic Christmas Gnome Plush Reindeer Santa Snowman Faceless Doll Buffalo Plaid Forest Man Xmas Ornament Window Decoration
Nordic Christmas Gnome Plush Reindeer Santa Snowman Faceless Doll Buffalo Plaid Forest Man Xmas Ornament Window Decoration
like
Find Similar
Christmas gnome plush decoration with black hat and white faux fur in a festive setting - Snowman Ornament
Christmas gnome plush toy with red buffalo plaid hat and a small gift box decor - Gnome Ornament
Plush Christmas gnome doll with reindeer antlers and beard for festive tabletop decoration - Elk Reindeer Ornament
Nordic Christmas Gnome Plush Reindeer Santa Snowman Faceless Doll Buffalo Plaid Forest Man Xmas Ornament Window Decoration
-4%
$3.15
No MOQ
Christmas Kids Coral Fleece Socks Thickened Warm Floor Sleep Wear Cartoon 3D Santa Reindeer Snowman Holiday Gift
Christmas Kids Coral Fleece Socks Thickened Warm Floor Sleep Wear Cartoon 3D Santa Reindeer Snowman Holiday Gift
like
Find Similar
Yellow cartoon chick coral fleece warm socks in a clear spherical gift box with red ribbon - Kids Size (Without Ball) / Yellow Chick
Brown striped coral fleece puppy socks for kids in a festive Christmas ball gift box - Kids Size (Without Ball) / Coffee Striped Bear
Blue Christmas coral fleece fuzzy socks with Santa pattern and 3D pompom in gift box - Kids Size (Without Ball) / Blue Santa Claus
Winter coral fleece Christmas socks with 3D reindeer ears in a clear gift ball - Kids Size (Without Ball) / Striped Reindeer
+77
Christmas Kids Coral Fleece Socks Thickened Warm Floor Sleep Wear Cartoon 3D Santa Reindeer Snowman Holiday Gift
$1.04
Mix MOQ : 2
Christmas Gift Bags Plastic Aluminum Foil PE Drawstring Ribbon Tie Holiday Candy Party Wrap Santa Reindeer Snowman Patterns
Christmas Gift Bags Plastic Aluminum Foil PE Drawstring Ribbon Tie Holiday Candy Party Wrap Santa Reindeer Snowman Patterns
like
Find Similar
6-piece festive Christmas gift bag set with colorful Santa and snowman patterns - Set Two (3 of Each, 18 Total)
Golden reflective Christmas gift bag with star patterns and white ribbon closure - Laser Gold 2 (29*43cm)
Christmas gift drawstring bags set in various sizes and festive colors for holiday decoration - 33 Pcs Set
Christmas drawstring gift bag in white and red with reindeer and snowflake patterns - Christmas White (16*24cm)
+56
Christmas Gift Bags Plastic Aluminum Foil PE Drawstring Ribbon Tie Holiday Candy Party Wrap Santa Reindeer Snowman Patterns
$0.12-12.80
No MOQ
Free Shipping
Christmas Pet Costume Cape Scarf Hat Antlers Headband Santa Snowman Knit Plush Cosplay Accessories For Cats Dogs
Christmas Pet Costume Cape Scarf Hat Antlers Headband Santa Snowman Knit Plush Cosplay Accessories For Cats Dogs
like
Find Similar
Christmas pet costume set with red Santa hat and plush scarf for cats and small dogs - S / Hat And Scarf Set
Festive red pet birthday cloak and crown set for cats and small dogs in party scene - S / Christmas Party Cape and Crown Set
Christmas pet scarf in red and white fleece with size chart S, M, and L - S / Christmas Red and White Collar
Festive red pet Christmas cloak with plush white trim and pom-pom for cats and dogs - S / Hooded Christmas Flannel Cape
+68
Christmas Pet Costume Cape Scarf Hat Antlers Headband Santa Snowman Knit Plush Cosplay Accessories For Cats Dogs
$0.74-4.20
Mix MOQ : 5
 · 
19 sold recently
Free Shipping
Christmas Cartoon Enamel Santa Claus Reindeer Snowman Pendant Necklace For Women Stainless Steel Gold Plated Holiday Party Fashion Jewelry Gift
Christmas Cartoon Enamel Santa Claus Reindeer Snowman Pendant Necklace For Women Stainless Steel Gold Plated Holiday Party Fashion Jewelry Gift
like
Find Similar
Golden necklace with a red Christmas stocking and cat pendant with size markings - Cat in Sock
Detailed view of red glove pendant necklace with heart motif and 39+5cm size specs - Heart Gloves
Macro shot of 13mm red Christmas stocking pendant on a golden 39cm adjustable chain - Red Sock
Detailed view of Christmas reindeer pendant necklace with dimensions and 39+5cm chain length - Brown Reindeer
+15
Christmas Cartoon Enamel Santa Claus Reindeer Snowman Pendant Necklace For Women Stainless Steel Gold Plated Holiday Party Fashion Jewelry Gift
$2.12
No MOQ
 · 
30 sold recently
Free Shipping
Retro Vintage Christmas Stickers Roll Pink Watercolor Santa Claus Reindeer Snowman Adhesive Decals For Holiday Party Decor Gift Packaging Sealing
Retro Vintage Christmas Stickers Roll Pink Watercolor Santa Claus Reindeer Snowman Adhesive Decals For Holiday Party Decor Gift Packaging Sealing
like
Find Similar
Detail showing 8 vintage watercolor Christmas stickers including Santa and reindeer - Vintage Illustration 8 Patterns (ZA84) / 1 Roll
Detailed view of eight vintage pink Christmas stickers featuring Santa and reindeer designs - Christmas Truck and Train 8 Patterns (ZA85) / 1 Roll
Retro Vintage Christmas Stickers Roll Pink Watercolor Santa Claus Reindeer Snowman Adhesive Decals For Holiday Party Decor Gift Packaging Sealing
$0.72
No MOQ
 · 
40 sold recently
Christmas Star Shaped Gift Box Cardboard Candy Packaging With Ribbon Handle Hanging Holiday Decor Santa Snowman Print
Christmas Star Shaped Gift Box Cardboard Candy Packaging With Ribbon Handle Hanging Holiday Decor Santa Snowman Print
like
Find Similar
Green star-shaped Christmas candy gift box with festive tree prints and ribbon handle - Green Christmas Tree (Green Ribbon)
White star-shaped Christmas candy gift box with red ribbon and Merry Christmas text - Red Christmas Ball (Red Ribbon)
Red star-shaped Christmas candy box featuring a cute Santa Claus and ribbon handle - Red Santa Claus with Gift (Red Ribbon)
Star-shaped Christmas gift box with Santa Claus print and green silk hanging ribbon - Dark Green Christmas Gift (Green Ribbon)
+3
Christmas Star Shaped Gift Box Cardboard Candy Packaging With Ribbon Handle Hanging Holiday Decor Santa Snowman Print
$0.08
Mix MOQ : 10
 · 
62 sold recently
Christmas Gingerbread Man Snowman Tree Snowflake Resin Flatback DIY Accessories Phone Case Decor Miniature Food Play
Christmas Gingerbread Man Snowman Tree Snowflake Resin Flatback DIY Accessories Phone Case Decor Miniature Food Play
like
Find Similar
Miniature resin gingerbread man DIY accessory with hat and scarf 18mm x 21mm - Snowman Cookie
Miniature resin Christmas tree gingerbread charm for DIY crafts and magnets 16mm x 21mm - Christmas Cookie
Gingerbread style snowflake resin flatback for Christmas DIY crafts, size 21x19mm - Snowflake Cookie
Miniature resin gingerbread man charm for DIY crafts, measures 16mm by 21mm size - Gingerbread Man
Christmas Gingerbread Man Snowman Tree Snowflake Resin Flatback DIY Accessories Phone Case Decor Miniature Food Play
$0.08
Mix MOQ : 10
 · 
30 views
Free Shipping
Christmas Drawstring Gift Bags Metallic Plastic Candy Packaging Ribbon Closure Holiday Party Decor Santa Snowman
Christmas Drawstring Gift Bags Metallic Plastic Candy Packaging Ribbon Closure Holiday Party Decor Santa Snowman
like
Find Similar
Green Christmas foil drawstring gift bag with Happy Holidays print and white ribbons - 24*32cm / Green Text
Red Christmas drawstring gift bag with Santa Claus illustration for party candy packaging - 23*16cm / Red Santa Claus
Detailed view of a green Christmas drawstring gift bag with Santa and reindeer motifs - 24*32cm / Green Santa Deer
Detail of Christmas drawstring gift bag with snowman pattern and festive ribbon - 32*24cm / Blue Snowman
+39
Christmas Drawstring Gift Bags Metallic Plastic Candy Packaging Ribbon Closure Holiday Party Decor Santa Snowman
$0.20-13.54
Mix MOQ : 2
 · 
32 sold recently
Christmas Tree Hanging Ornaments Plush Cloth Santa Snowman Reindeer Bear Dolls For Holiday Party Home Decor
Christmas Tree Hanging Ornaments Plush Cloth Santa Snowman Reindeer Bear Dolls For Holiday Party Home Decor
like
Find Similar
Detail of Santa plush ornament with red plaid hat and long dangling legs for Christmas tree - F2-3 Hanging Black Leg Santa
Detail of plush Christmas snowman ornament with red checkered hat and silver beaded legs - F2-3 Hanging Black Leg Snowman
Close-up of a Christmas reindeer plush pendant with red plaid scarf and silver bead legs - F2-3 Hanging Black Leg Reindeer
Detailed close-up of a Christmas plush bear ornament with tartan hat and beaded legs - F2-3 Hanging Black Leg Bear
+64
Christmas Tree Hanging Ornaments Plush Cloth Santa Snowman Reindeer Bear Dolls For Holiday Party Home Decor
$0.43-1.15
Mix MOQ : 2
 · 
100 sold recently
Free Shipping
Christmas LED Water Candle Snow Globe Lamp Retro Glitter Night Light Tabletop Decoration Santa Snowman Tree Ornament
Christmas LED Water Candle Snow Globe Lamp Retro Glitter Night Light Tabletop Decoration Santa Snowman Tree Ornament
like
Find Similar
LED Christmas candle lantern with Santa Claus figurine and bronze vintage base - Small Tall Candle Santa Claus
LED Christmas candle snow globe featuring a snowman and bronze retro base - Small Tall Candle Snowman
Bronze vintage LED candle light with Christmas tree and gifts in a glitter globe - Small Tall Candle Christmas Tree
Bronze LED Christmas candle lamp featuring an angel figurine with glitter water and warm light - Small Tall Candle Angel
+7
Christmas LED Water Candle Snow Globe Lamp Retro Glitter Night Light Tabletop Decoration Santa Snowman Tree Ornament
-5%
$2.33-2.60
Mix MOQ : 2
 · 
20 views
Go to

More in party supplies

Explore more in snowmen

holidaypartyhangingdesktopmakinghandshapeswindowballpointbracelet necklace
diyresinmankidswarmsteelgirlsmetalphoneunisex

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access