Everful

Wholesale stainless steel bottles

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Stainless Steel Bottles

Find the perfect pieces: vacuum flasks & thermoses, tumblers, mugs and more

Popular collections in stainless steel bottles

All products in stainless steel bottles

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Christmas Mini Knit Hats Pompom Yarn Pendants Snowflake Pattern For Doll Accessories Wine Bottles Decorative Hanging Ornaments
Christmas Mini Knit Hats Pompom Yarn Pendants Snowflake Pattern For Doll Accessories Wine Bottles Decorative Hanging Ornaments
like
Find Similar
Mini red knitted Christmas hat with green pattern for festive doll decorations - Knitted Red Hat
Mini green knitted Christmas hat with red snowflake pattern and white pompom 7x6cm - Knitted Green Hat with White Ball
Mini knitted green Christmas hat with red wave pattern for festive tree decoration - Knitted Green Hat
Christmas Mini Knit Hats Pompom Yarn Pendants Snowflake Pattern For Doll Accessories Wine Bottles Decorative Hanging Ornaments
$0.69
Mix MOQ : 2
Free Shipping
Christmas Wine Bottle Cover Sequin Reindeer Antler Gnome Wine Bottle Topper Rudolph Santa Beard Xmas Table Decor Red Gold Grey
Christmas Wine Bottle Cover Sequin Reindeer Antler Gnome Wine Bottle Topper Rudolph Santa Beard Xmas Table Decor Red Gold Grey
like
Find Similar
Detail of Christmas wine bottle cover with red sequins, reindeer antlers and white beard - Red Hat Gnome Wine Bottle Cover
Detail of Christmas wine bottle cover with gold sequins, white beard and reindeer antlers - Gold Hat Gnome Wine Bottle Cover
Close-up of a Christmas gnome wine bottle cover with grey sequins and white beard decor - Grey Hat Gnome Wine Bottle Cover
Christmas Wine Bottle Cover Sequin Reindeer Antler Gnome Wine Bottle Topper Rudolph Santa Beard Xmas Table Decor Red Gold Grey
-4%
$1.92
Mix MOQ : 2
New Year 2026 Cheers Year Banner And Champagne Bottle Bunting Glitter Paper Party Decoration Eve Celebration Shiny
New Year 2026 Cheers Year Banner And Champagne Bottle Bunting Glitter Paper Party Decoration Eve Celebration Shiny
like
Find Similar
2025 New Year decoration banner with gold glitter Cheers Year text and bottle shapes - Black Gold Cheers Year 2026 Banner With Bottle Garland
Sparkly silver Cheers 2025 glitter banner with champagne bottle party decorations - Black Silver Cheers Year 2026 Banner With Bottle Garland
Glittering Rose Gold 2025 New Year Banner with Cheers Text and Champagne Bottle Shapes - Black Rose Gold Cheers Year 2026 Banner With Bottle Garland
New Year 2026 Cheers Year Banner And Champagne Bottle Bunting Glitter Paper Party Decoration Eve Celebration Shiny
-10%
$2.02
Mix MOQ : 5
Christmas Sequin Gnome Wine Bottle Cover Rudolph Reindeer Antler White Beard Striped Sleeve Festive Table Decor Holiday Gift
Christmas Sequin Gnome Wine Bottle Cover Rudolph Reindeer Antler White Beard Striped Sleeve Festive Table Decor Holiday Gift
like
Find Similar
Detail of Christmas wine bottle cover with red sequins, reindeer antlers and white beard - Red Sequin Bottle Cover
Detail of Christmas wine bottle cover with gold sequins, white beard and reindeer antlers - Gold Sequin Bottle Cover
Close-up of a Christmas gnome wine bottle cover with grey sequins and white beard decor - Silver Sequin Bottle Cover
Christmas Sequin Gnome Wine Bottle Cover Rudolph Reindeer Antler White Beard Striped Sleeve Festive Table Decor Holiday Gift
-4%
$1.92
Mix MOQ : 2
Christmas Wine Bottle Cover Santa Claus Snowman Reindeer Bear Brushed Fabric Merry Christmas Decoration Festive Table Ornament
Christmas Wine Bottle Cover Santa Claus Snowman Reindeer Bear Brushed Fabric Merry Christmas Decoration Festive Table Ornament
like
Find Similar
Detail of red felt wine bottle cover with Santa Claus and Merry Christmas gold pendant - Santa Claus
Red Christmas wine bottle cover featuring a 3D snowman and gold Merry Christmas tag - Snowman
Christmas wine bottle cover with 3D reindeer plush and golden Merry Christmas sign - Elk
Christmas wine bottle cover with plush bear decor and gold Merry Christmas lettering - Bear
Christmas Wine Bottle Cover Santa Claus Snowman Reindeer Bear Brushed Fabric Merry Christmas Decoration Festive Table Ornament
-4%
$0.88
Mix MOQ : 2
Christmas Wine Bottle Cover Knitted Gnome Tomte Faceless Doll Long Beard Snowflake Nordic Holiday Table Decoration Gift
Christmas Wine Bottle Cover Knitted Gnome Tomte Faceless Doll Long Beard Snowflake Nordic Holiday Table Decoration Gift
like
Find Similar
Christmas gnome wine bottle cover with red and grey knitted hat and long white beard - Red Gray Snowflake Style (Knitted Long Hair Face Cover 1)
Christmas gnome wine bottle cover with red and grey wave patterns and brown beard - Red Gray Wavy Geometric Style (Knitted Long Hair Face Cover 3)
Gnome wine bottle cover with grey snowflake knit hat and long white beard for Christmas décor - Gray Base Snowflake Red Wavy Style (Knitted Long Hair Face Cover 2)
Christmas gnome wine bottle cover with red knitted snowflake hat and long grey beard - Red White Snowflake Geometric Style (Knitted Long Hair Face Cover 4)
Christmas Wine Bottle Cover Knitted Gnome Tomte Faceless Doll Long Beard Snowflake Nordic Holiday Table Decoration Gift
$1.73
Mix MOQ : 2
Mini Desktop Christmas Tree With LED Lights Sisal Glitter Bottle Brush Tree Wooden Base Christmas Decoration For Home Office Tabletop
Mini Desktop Christmas Tree With LED Lights Sisal Glitter Bottle Brush Tree Wooden Base Christmas Decoration For Home Office Tabletop
like
Find Similar
Mini white flocked Christmas tree with warm LED lights and wooden base 15cm height - 15cm Height White Christmas Tree
White mini LED Christmas tree with wooden base and battery box, 21cm height - 21cm Height White Christmas Tree
Mini white Christmas tree 25cm with warm LED lights and a wooden base for table decor - 25cm Height White Christmas Tree
31cm white mini artificial Christmas tree with LED lights and natural wood base - 31cm Height White Christmas Tree
Mini Desktop Christmas Tree With LED Lights Sisal Glitter Bottle Brush Tree Wooden Base Christmas Decoration For Home Office Tabletop
-3%
$1.25-2.42
Mix MOQ : 2
Funny Personified Dog Head PET Stickers Waterproof Transparent Decorative Decals For Water Bottle Laptop Phone Journal DIY Crafting
Funny Personified Dog Head PET Stickers Waterproof Transparent Decorative Decals For Water Bottle Laptop Phone Journal DIY Crafting
like
Find Similar
1 option
Funny Personified Dog Head PET Stickers Waterproof Transparent Decorative Decals For Water Bottle Laptop Phone Journal DIY Crafting
$0.93
No MOQ
Cute Cartoon Enamel Pin Alloy Brooch Goldfish Bowl Star Bottle Lemon Wine Bottle Badge Jewelry Gift For Women Men Decoration
Cute Cartoon Enamel Pin Alloy Brooch Goldfish Bowl Star Bottle Lemon Wine Bottle Badge Jewelry Gift For Women Men Decoration
like
Find Similar
Blue enamel jar pin with gold stars and white lid, measuring 1.18 by 0.63 inches - Starry Bottle (A00734)
Cute lemon jar enamel pin featuring a yellow ghost inside, size 2.6cm by 1.7cm - Lemon Jar (A00735)
Cartoon enamel brooch featuring a fish tank with two clownfish and a small bed - Goldfish Bowl (A00736)
Cartoon wine bottle enamel pin in black and brown with precise product size and weight specs - Wine Bottle (A00737)
Cute Cartoon Enamel Pin Alloy Brooch Goldfish Bowl Star Bottle Lemon Wine Bottle Badge Jewelry Gift For Women Men Decoration
-14%
$0.34-0.42
Mix MOQ : 2
 · 
10 views
50Pcs Halloween Zombie Food Stickers Horror Funny Waterproof PVC Decals For DIY Notebook Water Bottle Laptop Party Decor
50Pcs Halloween Zombie Food Stickers Horror Funny Waterproof PVC Decals For DIY Notebook Water Bottle Laptop Party Decor
like
Find Similar
Detail view showing 50 colorful cartoon zombie food stickers for Halloween DIY decor - 50 Sheets/Pack
50Pcs Halloween Zombie Food Stickers Horror Funny Waterproof PVC Decals For DIY Notebook Water Bottle Laptop Party Decor
$0.86
No MOQ
Velvet Christmas Wine Bottle Cover Mini Santa Clothes And Dress With Faux Fur Holiday Party Table Decoration Home Ornament
Velvet Christmas Wine Bottle Cover Mini Santa Clothes And Dress With Faux Fur Holiday Party Table Decoration Home Ornament
like
Find Similar
Christmas wine bottle cover in Santa suit style with red velvet and a gold belt - Coat Style (G-JT103)
Christmas wine bottle cover in red velvet dress style with white fur trim and belt - Dress Style (G-JT104)
Velvet Christmas Wine Bottle Cover Mini Santa Clothes And Dress With Faux Fur Holiday Party Table Decoration Home Ornament
-5%
$1.23-1.32
No MOQ
Knitted Christmas Wine Bottle Cover Thickened Faux Fur Collar Snowman Reindeer Pattern Xmas Dining Table Decor Gifts
Knitted Christmas Wine Bottle Cover Thickened Faux Fur Collar Snowman Reindeer Pattern Xmas Dining Table Decor Gifts
like
Find Similar
Green knitted Christmas wine bottle cover with snowman pattern and white pom-poms - Green
Knitted Christmas wine bottle cover with reindeer and snowflake pattern, 24x12 cm - Red
Grey and white knitted Christmas wine bottle cover with reindeer motif and white pom-poms - Gray
Knitted Christmas Wine Bottle Cover Thickened Faux Fur Collar Snowman Reindeer Pattern Xmas Dining Table Decor Gifts
$1.56
No MOQ
Christmas Gnome Wine Bottle Covers Knitted Reindeer Snowflake Rudolph Topper For Holiday Xmas Dinner Table Party Decorations
Christmas Gnome Wine Bottle Covers Knitted Reindeer Snowflake Rudolph Topper For Holiday Xmas Dinner Table Party Decorations
like
Find Similar
Rudolph faceless doll wine bottle cover with red knit hat and white faux beard - Belt Design
Christmas gnome wine bottle cover with red knitted snowflake hat and long white beard - Snowflake Design
Rudolph Christmas wine bottle cover with brown reindeer antlers and white faux fur beard - Reindeer Style
Christmas Gnome Wine Bottle Covers Knitted Reindeer Snowflake Rudolph Topper For Holiday Xmas Dinner Table Party Decorations
$1.15
No MOQ
Mini Christmas Hats Fabric Cutlery Holder Wine Bottle Topper Table Decorations Party Supplies Red White
Mini Christmas Hats Fabric Cutlery Holder Wine Bottle Topper Table Decorations Party Supplies Red White
like
Find Similar
Mini red Christmas hat for cutlery holder or bottle topper, 12x6cm brushed fabric decor - Medium (12x6cm) / Red
Mini red Christmas hat utensil holder, 18cm height by 8cm width festive cutlery cover - Large (18x8cm) / Red
Mini red felt Christmas hat 8x4cm for cutlery holder or wine bottle decoration - Small (8x4cm) / Red
Mini Christmas Hats Fabric Cutlery Holder Wine Bottle Topper Table Decorations Party Supplies Red White
$0.09-0.13
Mix MOQ : 2
 · 
204 sold recently
Cartoon Christmas Candy Jars With Santa Claus Snowman Reindeer Plush Heads Clear Plastic Storage Bottles Holiday Desk Decor
Cartoon Christmas Candy Jars With Santa Claus Snowman Reindeer Plush Heads Clear Plastic Storage Bottles Holiday Desk Decor
like
Find Similar
Christmas Santa Claus candy jar with red knit hat and transparent storage container - Santa Claus Style / Small
Christmas snowman candy jar with clear spherical bottle and striped knit scarf decor - Snowman Style / Small
Christmas reindeer transparent candy jar with plush brown antlers and a knit scarf - Reindeer Style / Small
Cartoon Christmas Candy Jars With Santa Claus Snowman Reindeer Plush Heads Clear Plastic Storage Bottles Holiday Desk Decor
-5%
$1.42
Mix MOQ : 2
Christmas Wine Bottle Covers Linen Plush Plaid Santa Snowman Reindeer Styles Decorative Drawstring Wine Bags For Party Decor
Christmas Wine Bottle Covers Linen Plush Plaid Santa Snowman Reindeer Styles Decorative Drawstring Wine Bags For Party Decor
like
Find Similar
Christmas snowman wine bottle cover with red scarf and plaid hat decoration - New Linen Plaid Snowman Style
Christmas Santa red wine bottle cover with plaid fabric and white plush beard decor - New Linen Plaid Santa Style
Christmas reindeer wine bottle cover with red scarf and knit texture for table decor - New Linen Plaid Reindeer Style
NewChristmas Wine Bottle Covers Linen Plush Plaid Santa Snowman Reindeer Styles Decorative Drawstring Wine Bags For Party Decor
$2.25
No MOQ
Nordic Christmas Gnome Wine Bottle Cover Knitted Snowflake Faceless Old Man Wine Bag Holiday Table Dining Decoration
Nordic Christmas Gnome Wine Bottle Cover Knitted Snowflake Faceless Old Man Wine Bag Holiday Table Dining Decoration
like
Find Similar
Christmas gnome wine bottle cover with green snowflake knit hat and long beard decoration - Green
Christmas gnome wine bottle cover with red knitted snowflake hat and white faux fur beard - Red
Christmas gnome wine bottle cover with grey snowflake knitted hat and long white beard decor - Gray
Nordic Christmas Gnome Wine Bottle Cover Knitted Snowflake Faceless Old Man Wine Bag Holiday Table Dining Decoration
-5%
$1.45
Mix MOQ : 2
Cartoon Unicorn Stickers Vinyl Holographic Flash Waterproof DIY Decorative For Scrapbooking Journal Water Bottle Laptop Kids Girls
Cartoon Unicorn Stickers Vinyl Holographic Flash Waterproof DIY Decorative For Scrapbooking Journal Water Bottle Laptop Kids Girls
like
Find Similar
Colorful unicorn stickers set for DIY crafts featuring rainbows and glittery laser effects - Flash Unicorn Style (G065)
Cartoon Unicorn Stickers Vinyl Holographic Flash Waterproof DIY Decorative For Scrapbooking Journal Water Bottle Laptop Kids Girls
$1.38
Mix MOQ : 2
Electric Hot Water Bottle Rechargeable Hand Warmer Cute Cartoon Plush Faux Rabbit Fur Cover Winter Portable Heating Pad
Electric Hot Water Bottle Rechargeable Hand Warmer Cute Cartoon Plush Faux Rabbit Fur Cover Winter Portable Heating Pad
like
Find Similar
Close-up of a light blue plush electric hot water bag featuring cute dog embroidery - Blue (Includes Liner)
Electric Hot Water Bottle Rechargeable Hand Warmer Cute Cartoon Plush Faux Rabbit Fur Cover Winter Portable Heating Pad
$6.92
No MOQ
Christmas Ribbon Bows With Gold Bell And Red Berries Red Green Striped Fabric Decorations For Tree Wine Bottle
Christmas Ribbon Bows With Gold Bell And Red Berries Red Green Striped Fabric Decorations For Tree Wine Bottle
like
Find Similar
Christmas striped bow with gold bell and red berries hanging ornament 8cm size - 8cm*8cm / Green Red Green
Christmas Ribbon Bows With Gold Bell And Red Berries Red Green Striped Fabric Decorations For Tree Wine Bottle
$0.11
No MOQ
 · 
500 sold recently
Christmas Wine Bottle Cover Knitted Gnome Wine Bag With Snowflake Pattern Nordic Forest Man Champagne Bottle Sleeves For Xmas Party Table Decor
Christmas Wine Bottle Cover Knitted Gnome Wine Bag With Snowflake Pattern Nordic Forest Man Champagne Bottle Sleeves For Xmas Party Table Decor
like
Find Similar
3 options
Christmas Wine Bottle Cover Knitted Gnome Wine Bag With Snowflake Pattern Nordic Forest Man Champagne Bottle Sleeves For Xmas Party Table Decor
-5%
$2.08
Mix MOQ : 2
Halloween Wine Bottle Stickers Retro Horror Witch Zombie Poison Label Decals For Party Bar Bottle Atmosphere Decor Prop
Halloween Wine Bottle Stickers Retro Horror Witch Zombie Poison Label Decals For Party Bar Bottle Atmosphere Decor Prop
like
Find Similar
Set of vintage Halloween potion labels featuring Dragon Blood and Witch Brew designs - 15 Sheets Set / 20x22cm
Vintage Halloween witch potion bottle labels with zombie and spider designs for party decor - 3 Sheets/Set / 20x22cm
Halloween Wine Bottle Stickers Retro Horror Witch Zombie Poison Label Decals For Party Bar Bottle Atmosphere Decor Prop
$0.43-2.16
Mix MOQ : 2
Vintage Christmas Decorative Throw Pillow Case Cotton Linen Mandala Leaves Wine Bottle Pattern Square Cushion Cover For Sofa Home Decor
Vintage Christmas Decorative Throw Pillow Case Cotton Linen Mandala Leaves Wine Bottle Pattern Square Cushion Cover For Sofa Home Decor
like
Find Similar
Bohemian square pillow case with yellow mandala pattern on beige cotton linen fabric - 60x60
Square pillow cover with blue and brown leaf geometric pattern on beige fabric - 60x60 / Curved Leaf Pattern
Vintage Christmas Decorative Throw Pillow Case Cotton Linen Mandala Leaves Wine Bottle Pattern Square Cushion Cover For Sofa Home Decor
-5%
$2.19-3.29
No MOQ
Christmas Wine Bottle Cover Gnome Design Knitted Fabric Holiday Party Table Decor Festive Wine Bottle Sleeve Gift Decoration
Christmas Wine Bottle Cover Gnome Design Knitted Fabric Holiday Party Table Decor Festive Wine Bottle Sleeve Gift Decoration
like
Find Similar
Christmas gnome wine bottle cover with knitted grey hat and white faux fur beard decor - Grey & White Stripes
Christmas gnome wine bottle cover with red knitted hat and long white faux fur beard - Red & Grey Stripes
Christmas gnome wine bottle cover with red striped knitted hat and white faux fur beard - Red & White Stripes Style
Knitted Christmas gnome wine bottle cover with snowflake pattern and long white beard - Red Stripes
Christmas Wine Bottle Cover Gnome Design Knitted Fabric Holiday Party Table Decor Festive Wine Bottle Sleeve Gift Decoration
$1.01
Mix MOQ : 4
Creative Surrealist Illustration Stickers Waterproof PVC Decals For Laptop Suitcase Water Bottle Helmet Decoration
Creative Surrealist Illustration Stickers Waterproof PVC Decals For Laptop Suitcase Water Bottle Helmet Decoration
like
Find Similar
Pack of 50 creative waterproof stickers with surreal food and lifestyle art illustrations - 50 Sheets Creative Illustration Pack (OPQ105)
Creative Surrealist Illustration Stickers Waterproof PVC Decals For Laptop Suitcase Water Bottle Helmet Decoration
$0.96
No MOQ
Waterproof PVC Book Reading Graffiti Stickers Cartoon Decorative Decals For Laptop Water Bottle Luggage Library Theme Gift
Waterproof PVC Book Reading Graffiti Stickers Cartoon Decorative Decals For Laptop Water Bottle Luggage Library Theme Gift
like
Find Similar
50pcs waterproof reading stickers set for book lovers DIY laptops and luggage decor - Book Reading Theme
Waterproof PVC Book Reading Graffiti Stickers Cartoon Decorative Decals For Laptop Water Bottle Luggage Library Theme Gift
$0.96
No MOQ
Realistic Dog Stickers Waterproof PET Transparent Animal Decals For DIY Scrapbook Water Bottle Laptop Decoration Journaling
Realistic Dog Stickers Waterproof PET Transparent Animal Decals For DIY Scrapbook Water Bottle Laptop Decoration Journaling
like
Find Similar
1 option
Realistic Dog Stickers Waterproof PET Transparent Animal Decals For DIY Scrapbook Water Bottle Laptop Decoration Journaling
$0.93
No MOQ
Christmas Wine Bottle Cover Mini Knitted Hat And Decorative Scarf Santa Reindeer Pattern For Holiday Table Decoration
Christmas Wine Bottle Cover Mini Knitted Hat And Decorative Scarf Santa Reindeer Pattern For Holiday Table Decoration
like
Find Similar
Mini Christmas knitted hat and scarf set with stripes and tree patterns for wine bottles - Christmas Tree Style
Christmas striped knit hat with pom-pom and deer pattern scarf set for wine bottles - Reindeer Style
Christmas knitted Santa hat and scarf set for wine bottles in festive red and green - Santa Claus Style
Christmas Wine Bottle Cover Mini Knitted Hat And Decorative Scarf Santa Reindeer Pattern For Holiday Table Decoration
$1.24
No MOQ
Christmas Knitted Wine Bottle Covers Santa Claus Snowman Elk Design Festive Table Decor For Xmas Party Dining Atmosphere
Christmas Knitted Wine Bottle Covers Santa Claus Snowman Elk Design Festive Table Decor For Xmas Party Dining Atmosphere
like
Find Similar
Knitted Santa Claus wine bottle cover with red festive hat and white beard decoration - Santa Claus / 28cmx12cm
Festive knitted Christmas wine bottle cover featuring a cute white snowman design - Snowman / 28cmx12cm
Close-up of a brown knitted reindeer wine bottle cover with detailed 3D antlers and nose - Elk Style / 28cmx12cm
Christmas Knitted Wine Bottle Covers Santa Claus Snowman Elk Design Festive Table Decor For Xmas Party Dining Atmosphere
$1.87
No MOQ
Christmas Wine Bottle Cover Santa Claus Snowman Elf Plush Knitted Fabric Wine Bottle Hugger For Festive Dinner Table Decor
Christmas Wine Bottle Cover Santa Claus Snowman Elf Plush Knitted Fabric Wine Bottle Hugger For Festive Dinner Table Decor
like
Find Similar
Plush Santa Claus wine bottle cover decoration for festive Christmas home dining table decor - Santa Claus
Christmas snowman wine bottle cover with red knit hat and scarf for holiday table decor - Snowman
Christmas elf wine bottle hugger in green and red festive attire for table decor - Elf
Christmas Wine Bottle Cover Santa Claus Snowman Elf Plush Knitted Fabric Wine Bottle Hugger For Festive Dinner Table Decor
$1.96
Mix MOQ : 2
Cartoon Yellow Duck Stickers Pack Waterproof PVC Vinyl Stickers For Laptop Luggage Water Bottle DIY Decoration Scrapbooking Stickers For Kids Students Adults
Cartoon Yellow Duck Stickers Pack Waterproof PVC Vinyl Stickers For Laptop Luggage Water Bottle DIY Decoration Scrapbooking Stickers For Kids Students Adults
like
Find Similar
50 pieces of waterproof yellow duck stickers for DIY decoration on laptops and suitcases - Cartoon Yellow Duck Series (WES130)
Cartoon Yellow Duck Stickers Pack Waterproof PVC Vinyl Stickers For Laptop Luggage Water Bottle DIY Decoration Scrapbooking Stickers For Kids Students Adults
$0.98
No MOQ
Mini Santa Hats Christmas Cutlery Holders Silverware Pockets Flannel Bottle Toppers Festive Dinner Table Decoration
Mini Santa Hats Christmas Cutlery Holders Silverware Pockets Flannel Bottle Toppers Festive Dinner Table Decoration
like
Find Similar
Red Christmas mini hat decoration with white pompom for wine bottles and cutlery - Mini Christmas Hat with Pompom
Mini Santa Hats Christmas Cutlery Holders Silverware Pockets Flannel Bottle Toppers Festive Dinner Table Decoration
$0.09
No MOQ
Mushroom In Glass Bottle PET Stickers Waterproof Transparent Decorative Decals For Scrapbooking Journal Laptop Phone Case DIY Art Craft
Mushroom In Glass Bottle PET Stickers Waterproof Transparent Decorative Decals For Scrapbooking Journal Laptop Phone Case DIY Art Craft
like
Find Similar
Pack of 50 vintage transparent mushroom bottle stickers for DIY journals and scrapbooking - Mushroom Bottle PET Sticker Bag / Colorful
Mushroom In Glass Bottle PET Stickers Waterproof Transparent Decorative Decals For Scrapbooking Journal Laptop Phone Case DIY Art Craft
$0.93
No MOQ
Mini Christmas Hats Felt Fabric Wine Bottle Cover Cutlery Holder Holiday Dinner Party Table Decoration Festive Red White
Mini Christmas Hats Felt Fabric Wine Bottle Cover Cutlery Holder Holiday Dinner Party Table Decoration Festive Red White
like
Find Similar
Mini Christmas hat cutlery holder in red and white fabric, dimensions 4.7 by 2.2 inches - 6x12cm Mini Christmas Hat Wine Bottle Cap
Mini Christmas Hats Felt Fabric Wine Bottle Cover Cutlery Holder Holiday Dinner Party Table Decoration Festive Red White
$0.09
Mix MOQ : 10
Golden Retriever Cartoon Dog Stickers For Water Bottles Laptop Luggage Waterproof Vinyl Animal Decals For Kids Adults Pet Lovers Gift
Golden Retriever Cartoon Dog Stickers For Water Bottles Laptop Luggage Waterproof Vinyl Animal Decals For Kids Adults Pet Lovers Gift
like
Find Similar
50pcs cute golden retriever cartoon stickers showing precise size and vibrant colors - Cute Golden Retriever Pattern (T01042393)
Golden Retriever Cartoon Dog Stickers For Water Bottles Laptop Luggage Waterproof Vinyl Animal Decals For Kids Adults Pet Lovers Gift
$0.86
Mix MOQ : 2
Cute Pink Axolotl Stickers Waterproof PVC Cartoon Animal Decals For Water Bottles Laptop Luggage Skateboard Decor For Kids Girls
Cute Pink Axolotl Stickers Waterproof PVC Cartoon Animal Decals For Water Bottles Laptop Luggage Skateboard Decor For Kids Girls
like
Find Similar
50pcs cute pink axolotl cartoon stickers for luggage and laptop decoration - Pink Axolotl (50 Sheets)
Cute Pink Axolotl Stickers Waterproof PVC Cartoon Animal Decals For Water Bottles Laptop Luggage Skateboard Decor For Kids Girls
$0.95
No MOQ
Christmas Wine Bottle Cover Knitted Reindeer Snowman Snowflake Pattern Wine Bag With Faux Fur Collar Holiday Table Decoration
Christmas Wine Bottle Cover Knitted Reindeer Snowman Snowflake Pattern Wine Bag With Faux Fur Collar Holiday Table Decoration
like
Find Similar
Christmas knitted wine bottle cover with white fur collar and snowflake pattern decor - Faux Fur Collar Knit Bottle Sleeve / Red
Green knitted Christmas wine bottle cover with snowman pattern and white faux fur collar - Faux Fur Collar Knit Bottle Sleeve / Green
Knitted Christmas wine bottle cover with elk and snowflake patterns and fur collar - Faux Fur Collar Knit Bottle Sleeve / Gray
Christmas Wine Bottle Cover Knitted Reindeer Snowman Snowflake Pattern Wine Bag With Faux Fur Collar Holiday Table Decoration
-5%
$1.70
Mix MOQ : 2
Christmas Gingerbread Man Wine Bottle Cover Hugger Plush Fabric Knitted Cloth Chef Hat Holiday Party Table Decor
Christmas Gingerbread Man Wine Bottle Cover Hugger Plush Fabric Knitted Cloth Chef Hat Holiday Party Table Decor
like
Find Similar
Gingerbread chef wine bottle cover with red vest and white hat for Christmas decor - Male Gingerbread Man Wine Bottle Hugger
Christmas gingerbread man chef wine bottle cover made of soft brown plush fabric - Female Gingerbread Man Wine Bottle Hugger
Christmas Gingerbread Man Wine Bottle Cover Hugger Plush Fabric Knitted Cloth Chef Hat Holiday Party Table Decor
-4%
$3.83
No MOQ
Cute Cartoon Little Yellow Duck Stickers For Kids DIY Water Bottle Laptop Suitcase Scrapbooking Decorative Vinyl Decals
Cute Cartoon Little Yellow Duck Stickers For Kids DIY Water Bottle Laptop Suitcase Scrapbooking Decorative Vinyl Decals
like
Find Similar
Detail of waterproof PVC yellow duck stickers showing various fun cartoon characters - T01041577 Various Rubber Ducks
Cute Cartoon Little Yellow Duck Stickers For Kids DIY Water Bottle Laptop Suitcase Scrapbooking Decorative Vinyl Decals
$0.95
Mix MOQ : 2
Christmas Gnome Wine Bottle Cover Nordic Forest Faceless Doll Set With Snowflake Hat Red Grey Festive Bottle Decor Xmas Party Dining Table Decoration
Christmas Gnome Wine Bottle Cover Nordic Forest Faceless Doll Set With Snowflake Hat Red Grey Festive Bottle Decor Xmas Party Dining Table Decoration
like
Find Similar
Detail of red Christmas gnome wine bottle cover with white snowflake pattern and beard - Red Forest Gnome Wine Cover
Detail of Christmas gnome wine bottle cover with grey felt hat and snowflake embroidery - Grey Forest Gnome Wine Cover
Close-up of Christmas gnome bottle cover with white snowflake hat and plush beard decor - Red Braided Forest Gnome Wine Cover
Gray Christmas gnome bottle cover with snowflake hat and white beard in festive setting - Grey Braided Forest Gnome Wine Cover
Christmas Gnome Wine Bottle Cover Nordic Forest Faceless Doll Set With Snowflake Hat Red Grey Festive Bottle Decor Xmas Party Dining Table Decoration
-5%
$1.51
Mix MOQ : 2
Christmas Knitted Faceless Gnome Wine Bottle Cover Long Beard Forest Old Man Bottle Sleeve Xmas Party Table Decoration
Christmas Knitted Faceless Gnome Wine Bottle Cover Long Beard Forest Old Man Bottle Sleeve Xmas Party Table Decoration
like
Find Similar
Christmas gnome plush decoration with knitted hat and long beard for holiday home decor - Knitted Gnome With Hands (Style A)
Christmas gnome doll with red grey striped hat and brown faux fur beard for holiday decor - Knitted Gnome With Hands (Style B)
Knitted Christmas gnome decoration with long white beard and festive snowflake pattern hat - Knitted Gnome With Hands (Style C)
Detail of a Christmas gnome decoration with a long knit red hat and white beard - Knitted Gnome With Hands (Style D)
Christmas Knitted Faceless Gnome Wine Bottle Cover Long Beard Forest Old Man Bottle Sleeve Xmas Party Table Decoration
$1.73
Mix MOQ : 2
Christmas Wine Bottle Cover Brushed Cloth Red Bottle Bag With Santa Snowman Elk Bear 3D Doll Decorative Sleeve For Holiday Party Xmas Table Decor
Christmas Wine Bottle Cover Brushed Cloth Red Bottle Bag With Santa Snowman Elk Bear 3D Doll Decorative Sleeve For Holiday Party Xmas Table Decor
like
Find Similar
Christmas wine bottle cover featuring a 3D Santa Claus and gold Merry Christmas ribbon - Santa Style With Letters
Red Christmas wine bottle cover with 3D snowman and Merry Christmas gold embroidery - Snowman Style With Letters
Christmas wine bottle cover with red fleece and white reindeer doll with gold bow - Elk Style With Letters
Christmas wine bottle cover with red fleece and white polar bear decor for holiday tables - Bear Style With Letters
Christmas Wine Bottle Cover Brushed Cloth Red Bottle Bag With Santa Snowman Elk Bear 3D Doll Decorative Sleeve For Holiday Party Xmas Table Decor
-4%
$0.82
No MOQ
Watercolor Sea Turtle Stickers Waterproof Decorative Decals For Laptop Scrapbook Notebook Water Bottle Artistic DIY Crafts
Watercolor Sea Turtle Stickers Waterproof Decorative Decals For Laptop Scrapbook Notebook Water Bottle Artistic DIY Crafts
like
Find Similar
56 pieces watercolor sea turtle stickers set with colorful hand-painted art designs - Sea Turtle Sticker Set (T01043082)
Watercolor Sea Turtle Stickers Waterproof Decorative Decals For Laptop Scrapbook Notebook Water Bottle Artistic DIY Crafts
$0.86
Mix MOQ : 2
Waterproof PVC Psychedelic Neon Graffiti Stickers For Laptop Skateboard Luggage Bottle Phone Decals Colorful Art Decoration
Waterproof PVC Psychedelic Neon Graffiti Stickers For Laptop Skateboard Luggage Bottle Phone Decals Colorful Art Decoration
like
Find Similar
50pcs colorful neon graffiti stickers for DIY laptop luggage and waterproof skateboard decor - Mixed Multicolor Graffiti Stickers Set
Waterproof PVC Psychedelic Neon Graffiti Stickers For Laptop Skateboard Luggage Bottle Phone Decals Colorful Art Decoration
$0.96
No MOQ
Cute Cartoon Cat Stickers PVC Waterproof Aesthetic Animal Decals For Water Bottle Laptop Phone Case DIY Scrapbooking Decoration Kids Gift
Cute Cartoon Cat Stickers PVC Waterproof Aesthetic Animal Decals For Water Bottle Laptop Phone Case DIY Scrapbooking Decoration Kids Gift
like
Find Similar
Set of 50 cute cartoon cat stickers with various DIY themes for laptop and luggage decor - Cartoon Cat Series
Cute Cartoon Cat Stickers PVC Waterproof Aesthetic Animal Decals For Water Bottle Laptop Phone Case DIY Scrapbooking Decoration Kids Gift
$0.86
No MOQ
Purple Gothic Stickers Cartoon Halloween Decals For Journal Laptop Water Bottle Fridge Waterproof Vinyl Graffiti Stickers
Purple Gothic Stickers Cartoon Halloween Decals For Journal Laptop Water Bottle Fridge Waterproof Vinyl Graffiti Stickers
like
Find Similar
50pcs purple gothic creepy-cute stickers for laptops and water bottles with waterproof finish - Purple Gothic Style (50 Sheets)
Purple Gothic Stickers Cartoon Halloween Decals For Journal Laptop Water Bottle Fridge Waterproof Vinyl Graffiti Stickers
$0.95
No MOQ
50Pcs Cartoon Brain Stickers Waterproof Vinyl Doodle Decals For Laptop Luggage Guitar Water Bottle Mental Health Slogan Stickers
50Pcs Cartoon Brain Stickers Waterproof Vinyl Doodle Decals For Laptop Luggage Guitar Water Bottle Mental Health Slogan Stickers
like
Find Similar
50 pieces of cartoon brain graffiti stickers for decorating laptops, guitars, and luggage - Brain Doodle (50 Sheets)
50Pcs Cartoon Brain Stickers Waterproof Vinyl Doodle Decals For Laptop Luggage Guitar Water Bottle Mental Health Slogan Stickers
$0.98
No MOQ
Knitted Christmas Wine Bottle Cover Xmas Beer Bottle Sweater Decor Reindeer Tree Snowflake Gingerbread Man Festive Table Decoration
Knitted Christmas Wine Bottle Cover Xmas Beer Bottle Sweater Decor Reindeer Tree Snowflake Gingerbread Man Festive Table Decoration
like
Find Similar
Knitted red and white striped Christmas beer bottle cover with gingerbread man design - Gingerbread Man
Blue knitted Christmas beer bottle cover with a cartoon reindeer and snowflake pattern - Blue Reindeer
Green knit beer bottle sleeve with snowflake patterns for Christmas table decor - Green Snowflake
Knitted Christmas Wine Bottle Cover Xmas Beer Bottle Sweater Decor Reindeer Tree Snowflake Gingerbread Man Festive Table Decoration
$1.21
No MOQ
Christmas Wine Bottle Cover Knit Cloth Santa Claus Snowman Reindeer Decoration For Dining Table Party Decor Xmas Gift
Christmas Wine Bottle Cover Knit Cloth Santa Claus Snowman Reindeer Decoration For Dining Table Party Decor Xmas Gift
like
Find Similar
Knitted Santa Claus wine bottle cover for Christmas table decor and festive gift packaging - Santa Claus
Knitted Christmas snowman wine bottle cover with red scarf and green holly berries decor - Snowman
Knitted reindeer Christmas wine bottle cover featuring plush details and 3D antlers - Deer
Christmas Wine Bottle Cover Knit Cloth Santa Claus Snowman Reindeer Decoration For Dining Table Party Decor Xmas Gift
$1.30
Mix MOQ : 3
Christmas Wine Bottle Cover Faux Linen Buffalo Plaid Drawstring Gift Bag Festive Party Decor Gnomes Tree Truck Flower
Christmas Wine Bottle Cover Faux Linen Buffalo Plaid Drawstring Gift Bag Festive Party Decor Gnomes Tree Truck Flower
like
Find Similar
Merry Christmas wine bottle bag with red buffalo plaid trim and festive tree design - Christmas Tree / Beige
Christmas burlap wine bag with red truck gnome design and red black plaid collar - Truck and Gnomes Style / Beige
Detail of burlap Christmas wine bag with poinsettia flower and Merry Christmas text - Stereo Flower Style / Beige
Christmas Wine Bottle Cover Faux Linen Buffalo Plaid Drawstring Gift Bag Festive Party Decor Gnomes Tree Truck Flower
-5%
$1.64
Mix MOQ : 2
Christmas Burlap Wine Bottle Cover Drawstring Gift Bag Santa Claus Snowman Applique Xmas Party Table Decor Champagne Bag
Christmas Burlap Wine Bottle Cover Drawstring Gift Bag Santa Claus Snowman Applique Xmas Party Table Decor Champagne Bag
like
Find Similar
Linen Christmas wine bottle bag with 3d snowman and tree for festive table decor - Beige Snowman Style
Linen Christmas wine bottle cover with 3D snowman and festive tree on a red sack - Red Snowman Style
Linen Christmas wine bottle cover with Santa Claus and sequined tree decorations - Green Santa Claus
Christmas Burlap Wine Bottle Cover Drawstring Gift Bag Santa Claus Snowman Applique Xmas Party Table Decor Champagne Bag
-16%
$1.18
No MOQ
Christmas Wine Bottle Cover Embroidered Knitted Sweater Bottle Bag With Hat Santa Claus Reindeer Snowman Xmas Party Table Decor
Christmas Wine Bottle Cover Embroidered Knitted Sweater Bottle Bag With Hat Santa Claus Reindeer Snowman Xmas Party Table Decor
like
Find Similar
Christmas wine bottle cover with Santa embroidery and red knit mini sweater set - Santa Claus Style
Christmas snowman knitted wine bottle sweater and mini hat for festive holiday table decor - Snowman Style
Christmas wine bottle cover with reindeer sweater and polka dot hat decoration - Reindeer Style
Christmas Wine Bottle Cover Embroidered Knitted Sweater Bottle Bag With Hat Santa Claus Reindeer Snowman Xmas Party Table Decor
$1.59
Mix MOQ : 2
Christmas Knitted Wine Bottle Covers Mini Sweater Hat Reindeer Snowflake Santa Belt Style Holiday Party Table Decoration
Christmas Knitted Wine Bottle Covers Mini Sweater Hat Reindeer Snowflake Santa Belt Style Holiday Party Table Decoration
like
Find Similar
Christmas Santa knit bottle cover set with red sweater and mini hat for holiday decor - Belt Style
Christmas wine bottle cover with red deer and snowflake knit pattern and mini hat - Reindeer Style Wine Cover
Red and green snowflake knit sweater and hat cover for wine bottles Christmas decoration - Snowflake Style
Christmas Knitted Wine Bottle Covers Mini Sweater Hat Reindeer Snowflake Santa Belt Style Holiday Party Table Decoration
-5%
$2.24
Mix MOQ : 2
Cartoon Doodle Stickers PVC Waterproof Cute Hand Drawn Animals Decals For Water Bottle Laptop Scrapbook Journal Decor Kids Gift
Cartoon Doodle Stickers PVC Waterproof Cute Hand Drawn Animals Decals For Water Bottle Laptop Scrapbook Journal Decor Kids Gift
like
Find Similar
Vibrant 54pcs set of cartoon doodle stickers with animals and vehicles for kid's notebooks - 54 Sheets Cartoon Doodle Stickers
Cartoon Doodle Stickers PVC Waterproof Cute Hand Drawn Animals Decals For Water Bottle Laptop Scrapbook Journal Decor Kids Gift
$0.96
No MOQ
Christmas Wine Bottle Decoration Knitted Hat And Mini Scarf Festive Santa Reindeer Patterns For Holiday Party Table Decor
Christmas Wine Bottle Decoration Knitted Hat And Mini Scarf Festive Santa Reindeer Patterns For Holiday Party Table Decor
like
Find Similar
Mini Christmas knitted hat and scarf set with stripes and tree patterns for wine bottles - Knitted Scarf Bottle Cover Christmas Tree
Christmas striped knit hat with pom-pom and deer pattern scarf set for wine bottles - Knitted Scarf Bottle Cover Reindeer
Christmas knitted Santa hat and scarf set for wine bottles in festive red and green - Knitted Scarf Bottle Cover Santa Claus
Christmas Wine Bottle Decoration Knitted Hat And Mini Scarf Festive Santa Reindeer Patterns For Holiday Party Table Decor
$1.24
Mix MOQ : 2
Christmas Candy Jars Transparent Plastic Storage Bottles Knitted Plush Reindeer Snowman Santa Decor Table Ornament Gift
Christmas Candy Jars Transparent Plastic Storage Bottles Knitted Plush Reindeer Snowman Santa Decor Table Ornament Gift
like
Find Similar
Christmas glass candy jar with plush Santa Claus wearing elk antlers on a wooden background - Large Santa Claus
Christmas reindeer Santa and snowman plush candy jars with transparent storage spheres - Small Santa Claus Balloon
Christmas Candy Jars Transparent Plastic Storage Bottles Knitted Plush Reindeer Snowman Santa Decor Table Ornament Gift
$1.50-3.03
Mix MOQ : 2
Christmas Wine Bottle Decor Mini Hat And Scarf Buffalo Plaid Fabric Holiday Table Ornament Party Dining Accessory
Christmas Wine Bottle Decor Mini Hat And Scarf Buffalo Plaid Fabric Holiday Table Ornament Party Dining Accessory
like
Find Similar
Christmas wine bottle cover set with red and black plaid scarf and holly berry hat ornament - Red and Black Plaid
Christmas wine bottle decor set with black and white plaid mini hat and matching scarf - Black and White Plaid
Christmas Wine Bottle Decor Mini Hat And Scarf Buffalo Plaid Fabric Holiday Table Ornament Party Dining Accessory
-4%
$0.88
No MOQ
Cartoon Funny Animal Meme Stickers Waterproof PVC Vinyl Graffiti Decals For Laptop Luggage Guitar Water Bottle DIY Decor
Cartoon Funny Animal Meme Stickers Waterproof PVC Vinyl Graffiti Decals For Laptop Luggage Guitar Water Bottle DIY Decor
like
Find Similar
50pcs waterproof cartoon animal meme stickers for laptops and luggage DIY decoration - Funny Animal Meme Style (YCK053)
NewCartoon Funny Animal Meme Stickers Waterproof PVC Vinyl Graffiti Decals For Laptop Luggage Guitar Water Bottle DIY Decor
$0.98
No MOQ
Funny Humorous Birthday Wine Bottle Labels PVC Self Adhesive Waterproof Sticker For Party Celebration Sisters Gifting Decor
Funny Humorous Birthday Wine Bottle Labels PVC Self Adhesive Waterproof Sticker For Party Celebration Sisters Gifting Decor
like
Find Similar
Black and gold 3-piece set of Happy Birthday wine labels with elegant dot patterns - Qt1355-1
Set of three black square wine bottle labels with humorous white birthday typography - Its Your Birthday-You Can Wine(QT1355-2)
Set of 4 funny self-adhesive wine bottle labels with black text for sisters and friends - Qt1355-3
Funny Humorous Birthday Wine Bottle Labels PVC Self Adhesive Waterproof Sticker For Party Celebration Sisters Gifting Decor
$0.72
Mix MOQ : 2
Free Shipping
Christmas Knitted Wine Bottle Covers Red Green Wine Bottle Sweater With Pom Poms For Christmas Dining Table Decoration
Christmas Knitted Wine Bottle Covers Red Green Wine Bottle Sweater With Pom Poms For Christmas Dining Table Decoration
like
Find Similar
Knitted Christmas wine bottle cover with snowman patterns and festive red bow decoration - Snowman Style / Red
Knitted snowman wine bottle cover with green and white snowflake patterns for Christmas decor - Christmas Tree Style / Green
Knitted red and white wine bottle cover with snowflake pattern and fluffy white pom-poms - Snowflake Style / Burgundy
NewChristmas Knitted Wine Bottle Covers Red Green Wine Bottle Sweater With Pom Poms For Christmas Dining Table Decoration
$2.05
Mix MOQ : 2
Go to

More in home & kitchen

Explore more in stainless steel bottles

steel316 stainless steelkidsstrapmagneticstylediymetalwidegirls
304 stainless steeldoubledisplaybarbandnaturaldesignlongbottlessimple

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access