Everful

Wholesale suction cups

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Suction Cups

Find the perfect pieces: home decor, kitchen & dining, arts, crafts & sewing and more

All products in suction cups

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Self Adhesive Curtain Rod Holders No Drill Wall Brackets Plastic Spring Loaded Rod Support Hooks Kitchen Bathroom Modern
Self Adhesive Curtain Rod Holders No Drill Wall Brackets Plastic Spring Loaded Rod Support Hooks Kitchen Bathroom Modern
like
Find Similar
Transparent self-adhesive curtain rod bracket holder with spring clip and square base - 1 Piece / Clear
Adhesive curtain rod brackets for poles up to 2cm, clear wall mount holder hooks - 2 Pcs/Set / Clear
White self-adhesive curtain rod bracket with spring-loaded clip for tension rods - 1 Piece / White
2-pack of self-adhesive white curtain rod brackets with wide sticky pads for easy mounting - 2 Pcs/Set / White
+5
Self Adhesive Curtain Rod Holders No Drill Wall Brackets Plastic Spring Loaded Rod Support Hooks Kitchen Bathroom Modern
$0.14-0.57
Mix MOQ : 2
 · 
28 sold recently
Cartoon Cat Stickers Starry Sky Galaxy PVC Waterproof Graffiti Decals For Laptop Luggage Guitar DIY Decoration Cute
Cartoon Cat Stickers Starry Sky Galaxy PVC Waterproof Graffiti Decals For Laptop Luggage Guitar DIY Decoration Cute
like
Find Similar
Pack of 50 waterproof colorful galaxy cat graffiti stickers for laptop and guitar decoration - 50 Sheets Starry Sky Cats
Cartoon Cat Stickers Starry Sky Galaxy PVC Waterproof Graffiti Decals For Laptop Luggage Guitar DIY Decoration Cute
$0.98
No MOQ
 · 
31 sold recently
Portable Pet Water Bottle For Dogs Cats Foldable Button Leak Proof ABS Plastic Travel Drinking Bowl With Lanyard
Portable Pet Water Bottle For Dogs Cats Foldable Button Leak Proof ABS Plastic Travel Drinking Bowl With Lanyard
like
Find Similar
Portable pet water bottle with light blue folding bowl and white carrying strap - Blue
Portable pet water bottle with white foldable leaf bowl and clear plastic storage container - White
Portable pink folding dog water bottle with transparent reservoir and grey wrist strap - Pink
Portable Pet Water Bottle For Dogs Cats Foldable Button Leak Proof ABS Plastic Travel Drinking Bowl With Lanyard
$3.31
Mix MOQ : 2
 · 
37 views
Cute Cartoon Stickers Waterproof PVC Vinyl Stickers For Kids Laptop Water Bottle Scrapbook Journal DIY Decals Decor
Cute Cartoon Stickers Waterproof PVC Vinyl Stickers For Kids Laptop Water Bottle Scrapbook Journal DIY Decals Decor
like
Find Similar
Set of 50 cute cartoon waterproof stickers featuring animals and food for DIY decoration - Cute Cartoon Sticker Set (RXHC0039)
NewCute Cartoon Stickers Waterproof PVC Vinyl Stickers For Kids Laptop Water Bottle Scrapbook Journal DIY Decals Decor
$0.86
Mix MOQ : 5
Acrylic Wall Mounted Spice Rack Clear Floating Shelves Set With Adhesive Tape For Kitchen Bathroom Storage Organization
Acrylic Wall Mounted Spice Rack Clear Floating Shelves Set With Adhesive Tape For Kitchen Bathroom Storage Organization
like
Find Similar
Macro detail of magnetic clear acrylic kitchen spice rack organizers on a fridge - 2 Pcs/Set / Clear
Set of two black acrylic wall spice racks with strong adhesive tape for home storage - 2 Pcs/Set / Black
Set of 2 clear acrylic wall floating shelves with adhesive tape for kitchen spice storage - 2 Pcs/Set / White
Clear acrylic wall spice rack set with 4 shelves and nano adhesive tape for bathroom - Set of 4 / Clear
+1
Acrylic Wall Mounted Spice Rack Clear Floating Shelves Set With Adhesive Tape For Kitchen Bathroom Storage Organization
$6.34-11.82
No MOQ
High Density PVC Hot Water Bottle With Removable Soft Plush Cover Winter Hand Belly Warmer For Pain Relief Heat Therapy
High Density PVC Hot Water Bottle With Removable Soft Plush Cover Winter Hand Belly Warmer For Pain Relief Heat Therapy
like
Find Similar
Classic creamy white hot water bottle designed for hand and stomach warmth therapy - 500ml Small / Off White
Minimalist cherry pink hot water bottle for menstrual pain relief and hand warming - 500ml Small / Sakura Pink
Premium coral grey hot water bottle for soothing heat therapy and keeping hands warm - 500ml Small / Coral Grey
Fresh green hot water bottle for hot compress therapy and stomach warming comfort - 500ml Small / Fresh Green
+21
High Density PVC Hot Water Bottle With Removable Soft Plush Cover Winter Hand Belly Warmer For Pain Relief Heat Therapy
$1.04-2.54
No MOQ
 · 
26 views
Y2K Cartoon Stickers Waterproof PVC Decorative Decals For Laptop Phone Case DIY Scrapbooking Journal Creative Art Sticker Pack
Y2K Cartoon Stickers Waterproof PVC Decorative Decals For Laptop Phone Case DIY Scrapbooking Journal Creative Art Sticker Pack
like
Find Similar
Collection of 49 colorful 3D Y2K stickers featuring desserts, fruits and retro gadgets - 50 Sheets
Y2K Cartoon Stickers Waterproof PVC Decorative Decals For Laptop Phone Case DIY Scrapbooking Journal Creative Art Sticker Pack
$0.86
No MOQ
 · 
10 views
Cartoon Star Boy Ceramic Mug Lid Spoon Included Cute High Capacity Coffee Cup For Office Home Holiday Gift
Cartoon Star Boy Ceramic Mug Lid Spoon Included Cute High Capacity Coffee Cup For Office Home Holiday Gift
like
Find Similar
Adorable cartoon star boy ceramic mug set with lid and matching gift box packaging - Star Wish Painter Blue (With Lid And Spoon)
Cute cartoon star boy ceramic mug set with lid and matching gift box - Cloud Cup Yellow (With Lid And Spoon)
Cute cartoon star boy ceramic mug set with lid and spoon in a matching gift box - Bread Cup Yellow (With Lid And Spoon)
Cartoon Star Boy Ceramic Mug Lid Spoon Included Cute High Capacity Coffee Cup For Office Home Holiday Gift
$4.18
No MOQ
Funny Celebrity Meme Stickers Waterproof PVC Decals For Laptop Water Bottle Skateboard Luggage DIY Vintage Decor Gift
Funny Celebrity Meme Stickers Waterproof PVC Decals For Laptop Water Bottle Skateboard Luggage DIY Vintage Decor Gift
like
Find Similar
50 packs of funny historical celebrity stickers for DIY laptop and skateboard decor - Creative Celebrity Memes
Funny Celebrity Meme Stickers Waterproof PVC Decals For Laptop Water Bottle Skateboard Luggage DIY Vintage Decor Gift
$0.96
No MOQ
Cute Pink Cartoon Duck Stickers Waterproof PVC Graffiti Decals For Laptop Notebook Luggage Guitar DIY Decoration Gift
Cute Pink Cartoon Duck Stickers Waterproof PVC Graffiti Decals For Laptop Notebook Luggage Guitar DIY Decoration Gift
like
Find Similar
Set of 50 cute pink and yellow cartoon duck stickers, waterproof PVC duckling decals - T01041597
Cute Pink Cartoon Duck Stickers Waterproof PVC Graffiti Decals For Laptop Notebook Luggage Guitar DIY Decoration Gift
$0.86
Mix MOQ : 5
Gothic Vampire Girl Anime Stickers Waterproof PVC Vinyl Decals For Phone Water Bottle Skateboard Luggage DIY Scrapbooking
Gothic Vampire Girl Anime Stickers Waterproof PVC Vinyl Decals For Phone Water Bottle Skateboard Luggage DIY Scrapbooking
like
Find Similar
50pcs gothic vampire girl anime stickers for laptop skateboard waterproof decals - 50 Sheets/Pack
Gothic Vampire Girl Anime Stickers Waterproof PVC Vinyl Decals For Phone Water Bottle Skateboard Luggage DIY Scrapbooking
$0.96
No MOQ
 · 
11 views
Summer Blue Beach Waterproof Aesthetic Ocean Seaside Decorative Decals Cute Watercolor Sticker For Laptop Journal Scrapbook Guitar
Summer Blue Beach Waterproof Aesthetic Ocean Seaside Decorative Decals Cute Watercolor Sticker For Laptop Journal Scrapbook Guitar
like
Find Similar
50 pieces of waterproof transparent blue cartoon summer beach PET stickers for scrapbooking - Blue Beach (SLP191)
Summer Blue Beach Waterproof Aesthetic Ocean Seaside Decorative Decals Cute Watercolor Sticker For Laptop Journal Scrapbook Guitar
$1.04
No MOQ
 · 
12 views
Humorous Snarky Meme Graffiti Stickers For Laptop Luggage Guitar DIY Waterproof PVC Decal For Teens Adults Decoration
Humorous Snarky Meme Graffiti Stickers For Laptop Luggage Guitar DIY Waterproof PVC Decal For Teens Adults Decoration
like
Find Similar
Pack of 50 waterproof Snarky MEME vinyl stickers for laptop and guitar decoration - Default
Humorous Snarky Meme Graffiti Stickers For Laptop Luggage Guitar DIY Waterproof PVC Decal For Teens Adults Decoration
$0.98
No MOQ
 · 
17 sold recently
Cartoon Doodle Waterproof PVC Stickers For Luggage Laptop Motorcycle Skateboard Guitar Assorted Decorative Decals
Cartoon Doodle Waterproof PVC Stickers For Luggage Laptop Motorcycle Skateboard Guitar Assorted Decorative Decals
like
Find Similar
100pcs cute cartoon waterproof vinyl stickers for motorcycle luggage and scrapbooking - Colorful Cartoon Series
NewCartoon Doodle Waterproof PVC Stickers For Luggage Laptop Motorcycle Skateboard Guitar Assorted Decorative Decals
$2.42
No MOQ
Vintage Pin-up Girl Sailing Graffiti Stickers Waterproof PVC Decals For Luggage Laptop Guitar Skateboard Stationery Decoration
Vintage Pin-up Girl Sailing Graffiti Stickers Waterproof PVC Decals For Luggage Laptop Guitar Skateboard Stationery Decoration
like
Find Similar
50 pieces of vintage nautical pin-up girl stickers for luggage and waterproof laptop decor - Vintage Girl Series (HT171)
Vintage Pin-up Girl Sailing Graffiti Stickers Waterproof PVC Decals For Luggage Laptop Guitar Skateboard Stationery Decoration
$1.30
No MOQ
Acrylic Drinking Straw Holder Wall Mounted Straw Organizer Storage Rack For Cabinet Kitchen Countertop Quick Drying Tray
Acrylic Drinking Straw Holder Wall Mounted Straw Organizer Storage Rack For Cabinet Kitchen Countertop Quick Drying Tray
like
Find Similar
Adjustable acrylic straw holder stand with colorful straws on white background - Clear
Adjustable acrylic straw holder with colorful silicone and stainless steel straws set - White
Adjustable black acrylic straw holder set with colorful reusable drinking straws - Black
Acrylic Drinking Straw Holder Wall Mounted Straw Organizer Storage Rack For Cabinet Kitchen Countertop Quick Drying Tray
$2.02
Mix MOQ : 2
 · 
20 views
50Pcs Cartoon Travel Car Waterproof Stickers Decorative PVC Decals For Luggage Laptop Phone Case Skateboard Scrapbooking DIY
50Pcs Cartoon Travel Car Waterproof Stickers Decorative PVC Decals For Luggage Laptop Phone Case Skateboard Scrapbooking DIY
like
Find Similar
50pcs waterproof cartoon travel stickers featuring kids and cars for luggage and laptops - 50 Sheets/Pack
50Pcs Cartoon Travel Car Waterproof Stickers Decorative PVC Decals For Luggage Laptop Phone Case Skateboard Scrapbooking DIY
$0.96
No MOQ
Astronaut Space Stickers Waterproof Transparent PET Cartoon Watercolor Decorative Decals For Laptop Scrapbooking Journal DIY
Astronaut Space Stickers Waterproof Transparent PET Cartoon Watercolor Decorative Decals For Laptop Scrapbooking Journal DIY
like
Find Similar
Set of 50 waterproof cartoon astronaut PET stickers for laptop and journal decoration - Space Astronaut Series (SLP202)
Astronaut Space Stickers Waterproof Transparent PET Cartoon Watercolor Decorative Decals For Laptop Scrapbooking Journal DIY
$1.04
No MOQ
50Pcs Flat Style Cartoon Girl Stickers Waterproof PVC Decals For Laptop Phone Case Luggage Scrapbook Decorative Stickers
50Pcs Flat Style Cartoon Girl Stickers Waterproof PVC Decals For Laptop Phone Case Luggage Scrapbook Decorative Stickers
like
Find Similar
Set of 50 flat style cartoon girl stickers for suitcases and phone cases decoration - 50 Non-repeating Girl Styles (WES124)
50Pcs Flat Style Cartoon Girl Stickers Waterproof PVC Decals For Laptop Phone Case Luggage Scrapbook Decorative Stickers
$0.96
No MOQ
Cartoon Brown Line Dog Waterproof Stickers For Laptop Suitcase Scrapbooking DIY Decorative Cute Animal PVC Decals
Cartoon Brown Line Dog Waterproof Stickers For Laptop Suitcase Scrapbooking DIY Decorative Cute Animal PVC Decals
like
Find Similar
Set of 36 cute brown puppy and bear waterproof cartoon stickers for laptop and DIY decor - Brown Line Dog (36 Pieces)
Cartoon Brown Line Dog Waterproof Stickers For Laptop Suitcase Scrapbooking DIY Decorative Cute Animal PVC Decals
$0.72
No MOQ
Removable Chalkboard Labels Waterproof PVC Stickers For Kitchen Storage Jars Bottles Organization Reusable Black Stickers
Removable Chalkboard Labels Waterproof PVC Stickers For Kitchen Storage Jars Bottles Organization Reusable Black Stickers
like
Find Similar
Roll of 100 black matte chalkboard stickers for kitchen labels in 7.5x3.5cm size - 100 Stickers Per Roll (V219)
Two rolls of matte black wavy chalkboard labels for kitchen jars and home organization - 120 Stickers Per Roll CX25
Macro detail of waterproof chalkboard label roll with liquid chalk pen for kitchen - 120 Stickers Per Roll (HG15)
Macro view of 300pcs roll chalkboard labels 3.5x5.5cm with white liquid chalk pen - 300 Stickers Per Roll (HG16)
+1
Removable Chalkboard Labels Waterproof PVC Stickers For Kitchen Storage Jars Bottles Organization Reusable Black Stickers
$0.14-1.01
No MOQ
Waterproof PVC Cartoon Stickers Y2K Abstract Graffiti Decals For Water Bottles Laptop Helmet Luggage Skateboard Decor
Waterproof PVC Cartoon Stickers Y2K Abstract Graffiti Decals For Water Bottles Laptop Helmet Luggage Skateboard Decor
like
Find Similar
Pack of 56 aesthetic Y2K stickers with colorful abstract designs for laptop and helmet - Funny Cartoon Graffiti Mixed Style (T01042815)
Waterproof PVC Cartoon Stickers Y2K Abstract Graffiti Decals For Water Bottles Laptop Helmet Luggage Skateboard Decor
$0.86
Mix MOQ : 2
Waterproof PVC Sexy Lips Stickers Pack Cartoon Lips Graffiti Decals For Laptop Luggage Guitar Phone Skateboard Decoration
Waterproof PVC Sexy Lips Stickers Pack Cartoon Lips Graffiti Decals For Laptop Luggage Guitar Phone Skateboard Decoration
like
Find Similar
50 pieces of waterproof sexy lip graffiti stickers for luggage laptop and guitar decoration - Lip Series
NewWaterproof PVC Sexy Lips Stickers Pack Cartoon Lips Graffiti Decals For Laptop Luggage Guitar Phone Skateboard Decoration
$0.96
No MOQ
Vintage Watercolor Floral Books Coffee Transparent Waterproof PET Stickers For Journaling Scrapbooking Laptop Phone Decoration
Vintage Watercolor Floral Books Coffee Transparent Waterproof PET Stickers For Journaling Scrapbooking Laptop Phone Decoration
like
Find Similar
50 pieces of vintage watercolor coffee and book stickers in transparent waterproof PET material - Books and Coffee PET Sticker Pack
Vintage Watercolor Floral Books Coffee Transparent Waterproof PET Stickers For Journaling Scrapbooking Laptop Phone Decoration
$0.93
No MOQ
 · 
15 sold recently
Burlap Lace Cutlery Holder Bag For Wedding Party Christmas Table Decoration Vintage Jute Tableware Pouch For Knives And Forks
Burlap Lace Cutlery Holder Bag For Wedding Party Christmas Table Decoration Vintage Jute Tableware Pouch For Knives And Forks
like
Find Similar
1 option
Burlap Lace Cutlery Holder Bag For Wedding Party Christmas Table Decoration Vintage Jute Tableware Pouch For Knives And Forks
$0.26
Mix MOQ : 10
 · 
256 sold recently
Stainless Steel 304 Vacuum Insulated Water Bottle Portable Travel Flask Creative Abstract Floral Print Modern Drinkware
Stainless Steel 304 Vacuum Insulated Water Bottle Portable Travel Flask Creative Abstract Floral Print Modern Drinkware
like
Find Similar
Yellow stainless steel vacuum flask with sun and blue wave art pattern print - Yellow Sun
White stainless steel bottle with sports illustrations and dark brown matte finish cap - White Sports Theme
Pink matte stainless steel water bottle with daisy prints and motivational quote - Pink Today Daisy
Yellow matte stainless steel thermal bottle with minimalist modern leaf and arch design - Yellow Abstract Geometric
+19
Stainless Steel 304 Vacuum Insulated Water Bottle Portable Travel Flask Creative Abstract Floral Print Modern Drinkware
$9.51
No MOQ
 · 
77 views
Cartoon Abstract Animal Waterproof PVC Stickers For Laptop Suitcase Guitar Journal Notebook Decorative Decals For Kids Teens
Cartoon Abstract Animal Waterproof PVC Stickers For Laptop Suitcase Guitar Journal Notebook Decorative Decals For Kids Teens
like
Find Similar
Assorted waterproof cartoon animal stickers featuring lion panda and koala designs - Cartoon Abstract Animal
Cartoon Abstract Animal Waterproof PVC Stickers For Laptop Suitcase Guitar Journal Notebook Decorative Decals For Kids Teens
$0.98
No MOQ
Waterproof Gift Box Decorative Stickers Hand Drawn Illustration Pattern For Laptop Journal Suitcase Scrapbooking Decoration
Waterproof Gift Box Decorative Stickers Hand Drawn Illustration Pattern For Laptop Journal Suitcase Scrapbooking Decoration
like
Find Similar
50 pieces of colorful gift box waterproof stickers for laptops and scrapbooking decoration - Colorful Gift Box Series (PMS081)
Waterproof Gift Box Decorative Stickers Hand Drawn Illustration Pattern For Laptop Journal Suitcase Scrapbooking Decoration
$0.96
No MOQ
Gothic Horror Waterproof PVC Stickers Dark Red Black White Skull Rose Decals For Laptop Water Bottle Suitcase Halloween Decoration
Gothic Horror Waterproof PVC Stickers Dark Red Black White Skull Rose Decals For Laptop Water Bottle Suitcase Halloween Decoration
like
Find Similar
Set of 100 gothic waterproof stickers with skull, rose, and dark magic illustrations - Dark Red Gothic Mixed Style (BP-0424+2200)
Macro view of gothic horror stickers featuring dark red skulls and punk art motifs - Gothic Horror Art Style (T01040424)
Detail of gothic dark red stickers with skull and crow patterns for laptops - Day of the Dead Gothic Aesthetic Style (T01042200)
Gothic Horror Waterproof PVC Stickers Dark Red Black White Skull Rose Decals For Laptop Water Bottle Suitcase Halloween Decoration
$0.95-1.73
Mix MOQ : 2
Waterproof Potted Plants Stickers PVC Botanical Decals For Scrapbooking Journal Laptop Phone Case DIY Stationery Decoration
Waterproof Potted Plants Stickers PVC Botanical Decals For Scrapbooking Journal Laptop Phone Case DIY Stationery Decoration
like
Find Similar
Set of 89 waterproof green potted plant stickers for DIY stationery and laptops - Set of Multiple Potted Plant Illustrations
Waterproof Potted Plants Stickers PVC Botanical Decals For Scrapbooking Journal Laptop Phone Case DIY Stationery Decoration
$0.95
No MOQ
 · 
17 sold recently
Halloween Ghost Mushroom Waterproof Stickers PVC Cartoon Aesthetic Decals For Water Bottle Laptop Scrapbooking DIY Stickers
Halloween Ghost Mushroom Waterproof Stickers PVC Cartoon Aesthetic Decals For Water Bottle Laptop Scrapbooking DIY Stickers
like
Find Similar
Flat lay of diverse waterproof Halloween mushroom ghost stickers with watercolor illustrations - Ghost Mushroom / Colorful
Halloween Ghost Mushroom Waterproof Stickers PVC Cartoon Aesthetic Decals For Water Bottle Laptop Scrapbooking DIY Stickers
-10%
$0.86
No MOQ
Leopard Print Houndstooth 316 Stainless Steel Vacuum Insulated Bottle Double Drink Lid Straw Portable Water Cup For Women
Leopard Print Houndstooth 316 Stainless Steel Vacuum Insulated Bottle Double Drink Lid Straw Portable Water Cup For Women
like
Find Similar
Pink leopard print stainless steel vacuum insulated tumbler with flip lid and handle - 500ml / 1449 Leopard Pink
Pink and white houndstooth thermal bottle with GLAM ROYAL logo and flip lid - 500ml / 1450 Houndstooth Pink
Blue houndstooth insulated travel mug with flip lid and GLAM ROYAL logo finish - 500ml / 1450 Houndstooth Blue
Leopard Print Houndstooth 316 Stainless Steel Vacuum Insulated Bottle Double Drink Lid Straw Portable Water Cup For Women
-4%
$5.75
No MOQ
 · 
23 views
Universe Space Planet Waterproof PVC Stickers Set Vintage Astronomy Starry Sky Decals For Laptop Suitcase Guitar DIY Scrapbooking Decorative Stickers
Universe Space Planet Waterproof PVC Stickers Set Vintage Astronomy Starry Sky Decals For Laptop Suitcase Guitar DIY Scrapbooking Decorative Stickers
like
Find Similar
Set of 50 vintage cosmic space stamp stickers featuring moon, planets, and astronauts - Mysterious Universe Series
NewUniverse Space Planet Waterproof PVC Stickers Set Vintage Astronomy Starry Sky Decals For Laptop Suitcase Guitar DIY Scrapbooking Decorative Stickers
$0.98
No MOQ
Cute Penguin Shaped 304 Stainless Steel Insulated Water Bottle Vacuum Thermos Cup Cartoon Portable Leakproof Travel
Cute Penguin Shaped 304 Stainless Steel Insulated Water Bottle Vacuum Thermos Cup Cartoon Portable Leakproof Travel
like
Find Similar
Outdoor close-up of a creative penguin-shaped stainless steel insulated water bottle - 280ml / Black
Close-up of cute red penguin-shaped stainless steel vacuum water bottle held by hand - 280ml / Red
Macro view of blue penguin cartoon vacuum insulated stainless steel water bottle outdoor - 280ml / Blue
Close-up of a cute penguin-shaped vacuum flask in dark grey and white for outdoor use - 280ml / Gray
Cute Penguin Shaped 304 Stainless Steel Insulated Water Bottle Vacuum Thermos Cup Cartoon Portable Leakproof Travel
-4%
$5.75
Mix MOQ : 2
 · 
23 views
Stainless Steel Vacuum Insulated Tumbler With Lid Christmas Cartoon Pattern Travel Mug Portable Reusable Cup
Stainless Steel Vacuum Insulated Tumbler With Lid Christmas Cartoon Pattern Travel Mug Portable Reusable Cup
like
Find Similar
Detailed view of 20oz stainless steel tumbler with Buffalo plaid and Christmas motifs - Red and Black Plaid Christmas
Detail shot of blue 20oz stainless steel Christmas tumbler with Santa and snowman patterns - Blue Snowman Merry Christmas
Close-up of a white 20oz stainless steel tumbler with festive Christmas tree patterns - Silver Snowflake and Snowman
Close-up of 20oz stainless steel tumbler with Santa Claus and Christmas patterns - White Christmas Line Art
+12
Stainless Steel Vacuum Insulated Tumbler With Lid Christmas Cartoon Pattern Travel Mug Portable Reusable Cup
-5%
$2.74-3.56
Mix MOQ : 2
 · 
115 views
Waterproof PVC Cartoon Cat Floral Stickers For Laptop Suitcase Journal DIY Scrapbooking Decorative Decal Set
Waterproof PVC Cartoon Cat Floral Stickers For Laptop Suitcase Journal DIY Scrapbooking Decorative Decal Set
like
Find Similar
50pcs cute cartoon cat and flower waterproof stickers for scrapbooking and suitcases - Cat Floral Series
Waterproof PVC Cartoon Cat Floral Stickers For Laptop Suitcase Journal DIY Scrapbooking Decorative Decal Set
$1.15
No MOQ
Creepy Cute Cartoon Graffiti Stickers PVC Waterproof Gothic Fantasy Fairytale Monster Decals For Laptop Luggage Cup DIY Decoration
Creepy Cute Cartoon Graffiti Stickers PVC Waterproof Gothic Fantasy Fairytale Monster Decals For Laptop Luggage Cup DIY Decoration
like
Find Similar
Set of 56 dark fantasy cartoon graffiti stickers with quirky and creative doodle designs - Fantasy Monster Style (T01042831)
Creepy Cute Cartoon Graffiti Stickers PVC Waterproof Gothic Fantasy Fairytale Monster Decals For Laptop Luggage Cup DIY Decoration
$0.86
Mix MOQ : 2
Cartoon Waterproof Stickers For Suitcase Laptop Decoration Cute Animal Fruit Graffiti Decals For Kids Students DIY Art
Cartoon Waterproof Stickers For Suitcase Laptop Decoration Cute Animal Fruit Graffiti Decals For Kids Students DIY Art
like
Find Similar
90pcs colorful cartoon doodle stickers for kids featuring animals and waterproof vinyl - Baby Concentration Training Series
Cartoon Waterproof Stickers For Suitcase Laptop Decoration Cute Animal Fruit Graffiti Decals For Kids Students DIY Art
$0.75
No MOQ
Pink Dreamy Amusement Park PET Waterproof Transparent Stickers Carousel Ferris Wheel Unicorn Pattern For Scrapbooking Journal Skateboard Suitcase
Pink Dreamy Amusement Park PET Waterproof Transparent Stickers Carousel Ferris Wheel Unicorn Pattern For Scrapbooking Journal Skateboard Suitcase
like
Find Similar
Detailed set of 50 vintage pink PET stickers featuring dream carousel and ferris wheel motifs - Dreamy Amusement Park Theme
Pink Dreamy Amusement Park PET Waterproof Transparent Stickers Carousel Ferris Wheel Unicorn Pattern For Scrapbooking Journal Skateboard Suitcase
$0.93
No MOQ
 · 
23 views
Creative Rose Flower Shape Wine Glass Elegant Borosilicate Glass Stemware Romantic Gift For Anniversary Wedding Party
Creative Rose Flower Shape Wine Glass Elegant Borosilicate Glass Stemware Romantic Gift For Anniversary Wedding Party
like
Find Similar
Pink rose-shaped wine glass with green stem and leaves, 280ml creative glassware - 280ml Pink Green Leaf Cup
Detail showing pink rose flower wine glass with green stem and 150ml dimensions - 150ml Pink Green Leaf Cup
Green Leaf Rose Red Wine Glass 150ml creative flower shaped high borosilicate crystal stemware - 150ml Green Leaf Transparent Cup
Transparent rose-shaped wine glass in 150ml size with elegant green stem design - 150ml Transparent Leaf Transparent Cup
+8
Creative Rose Flower Shape Wine Glass Elegant Borosilicate Glass Stemware Romantic Gift For Anniversary Wedding Party
-6%
$3.36-9.18
No MOQ
 · 
12 sold recently
Watercolor Heart Stickers PVC Waterproof DIY Graffiti Decals For Laptop Guitar Luggage Phone Case Kids Teens Gift
Watercolor Heart Stickers PVC Waterproof DIY Graffiti Decals For Laptop Guitar Luggage Phone Case Kids Teens Gift
like
Find Similar
Set of 50 colorful watercolor heart stickers for DIY laptop and guitar decoration - Watercolor Heart Style
NewWatercolor Heart Stickers PVC Waterproof DIY Graffiti Decals For Laptop Guitar Luggage Phone Case Kids Teens Gift
$0.98
No MOQ
Sports Water Bottle Gradient Frosted With Time Marker Motivational Quotes Leakproof Portable Drinking For Fitness Gym
Sports Water Bottle Gradient Frosted With Time Marker Motivational Quotes Leakproof Portable Drinking For Fitness Gym
like
Find Similar
Close-up of frosted gradient sports water bottle with time markers and motivational quotes - 1000ml / Pink Lid Gradient
Detail of the purple-to-pink gradient frosted sports bottle with handle and scale - 1000ml / Purple Lid Gradient
Blue-purple gradient frosted sports water bottle with straw and time marker labels - 1000ml / Green Lid Gradient
Close-up of matte gradient black sports water bottle with motivational time markers - 1000ml / Black Lid Gradient
+1
Sports Water Bottle Gradient Frosted With Time Marker Motivational Quotes Leakproof Portable Drinking For Fitness Gym
$3.60
No MOQ
 · 
19 views
Cartoon Orange Cat Stickers Waterproof PVC DIY Decorative Decals For Laptop Guitar Luggage Phone Case Scrapbooking Decor
Cartoon Orange Cat Stickers Waterproof PVC DIY Decorative Decals For Laptop Guitar Luggage Phone Case Scrapbooking Decor
like
Find Similar
Set of 50 waterproof cartoon orange cat stickers for laptops and outdoor gear decoration - Default
Cartoon Orange Cat Stickers Waterproof PVC DIY Decorative Decals For Laptop Guitar Luggage Phone Case Scrapbooking Decor
$0.98
No MOQ
Protein Shaker Bottle Plastic Frosted Sport Water Cup With Mixing Ball Scale For Gym Fitness Mixing Drink
Protein Shaker Bottle Plastic Frosted Sport Water Cup With Mixing Ball Scale For Gym Fitness Mixing Drink
like
Find Similar
Pink and white protein shaker bottle with mixing ball for fitness and sports gym use - 500ml / Pink
Yellow protein shaker bottle set with mixing ball and scale on wooden table - 500ml / Yellow
Protein Shaker Bottle Plastic Frosted Sport Water Cup With Mixing Ball Scale For Gym Fitness Mixing Drink
-5%
$1.15-1.31
No MOQ
Initial Alphabet Tumbler Accessory Kit Letter Charm Bow Straw Cover Silicone Boot Rhinestone Sticker For Water Bottle
Initial Alphabet Tumbler Accessory Kit Letter Charm Bow Straw Cover Silicone Boot Rhinestone Sticker For Water Bottle
like
Find Similar
Detail of 40oz black tumbler accessories including alphabet charm, bow cover and boot - Letter A
Blue 40oz tumbler accessories set with letter A charm, bow straw cover, and glitter boot - Letter A / Light Blue Style
Black 40oz Stanley cup accessory set with letter K charm, straw cover and boot - Letter A / Black And Gold Style
Yellow Stanley cup accessories set with butterfly charm, straw cover and glitter letter A - Letter A / Bright Yellow Style
+308
Initial Alphabet Tumbler Accessory Kit Letter Charm Bow Straw Cover Silicone Boot Rhinestone Sticker For Water Bottle
-5%
$4.10
Mix MOQ : 3
 · 
12 views
Transparent Stackable Washi Tape Dispenser Storage Box Plastic Desktop Stationery Organizer With Serrated Cutter For Office School Hand Account
Transparent Stackable Washi Tape Dispenser Storage Box Plastic Desktop Stationery Organizer With Serrated Cutter For Office School Hand Account
like
Find Similar
Transparent washi tape dispenser with a green spool and sharp cutting edge for stationery - Green
Transparent plastic washi tape dispenser with beige cutter for office stationery - Yellow
Transparent desktop tape dispenser with cream-colored spindle for office stationery storage - Beige
Transparent multi-roll washi tape dispenser with five colorful tape rolls - Brown
Transparent Stackable Washi Tape Dispenser Storage Box Plastic Desktop Stationery Organizer With Serrated Cutter For Office School Hand Account
-5%
$1.01
No MOQ
 · 
30 views
Funny Cat Meme Stickers Waterproof PVC Vinyl Decals For Laptop Phone Case Water Bottle DIY Decoration Cute Humor Animal Novelty
Funny Cat Meme Stickers Waterproof PVC Vinyl Decals For Laptop Phone Case Water Bottle DIY Decoration Cute Humor Animal Novelty
like
Find Similar
Set of 50 funny cat stickers for laptop and DIY decor featuring waterproof PVC material - 50pcs Funny Cat Stickers
Funny Cat Meme Stickers Waterproof PVC Vinyl Decals For Laptop Phone Case Water Bottle DIY Decoration Cute Humor Animal Novelty
$0.96
No MOQ
 · 
26 views
Waterproof PVC Ocean Animal Stickers Cartoon Sea Life Decorative Decals For Laptop Guitar Luggage Phone Case Kids Gift
Waterproof PVC Ocean Animal Stickers Cartoon Sea Life Decorative Decals For Laptop Guitar Luggage Phone Case Kids Gift
like
Find Similar
Set of 50 watercolor sea animal stickers for laptops and guitars with vibrant fish designs - Ocean Creature Series
Waterproof PVC Ocean Animal Stickers Cartoon Sea Life Decorative Decals For Laptop Guitar Luggage Phone Case Kids Gift
$0.98
No MOQ
Cute Cartoon Cat Stickers Assorted Patterns Waterproof PVC DIY Decorative Decals For Journal Laptop Scrapbooking Kids Gift
Cute Cartoon Cat Stickers Assorted Patterns Waterproof PVC DIY Decorative Decals For Journal Laptop Scrapbooking Kids Gift
like
Find Similar
Set of 8 waterproof cartoon cat stickers with creative bread and sushi outfits for DIY - Multiple Styles Random
Cute Cartoon Cat Stickers Assorted Patterns Waterproof PVC DIY Decorative Decals For Journal Laptop Scrapbooking Kids Gift
$0.10
Mix MOQ : 8
Cartoon Animal Graduation Stickers PVC Waterproof Decals For Water Bottles Laptop Scrapbooking Reward For Students
Cartoon Animal Graduation Stickers PVC Waterproof Decals For Water Bottles Laptop Scrapbooking Reward For Students
like
Find Similar
Waterproof preschool graduation stickers set featuring cute cartoon animals and school icons - Cartoon Graduation Sticker Pack
Cartoon Animal Graduation Stickers PVC Waterproof Decals For Water Bottles Laptop Scrapbooking Reward For Students
$0.95
No MOQ
Universe Starry Sky Stickers Waterproof Aesthetic Galaxy Planet Moon Astronaut Decals For Laptop Scrapbooking DIY Decor Journaling
Universe Starry Sky Stickers Waterproof Aesthetic Galaxy Planet Moon Astronaut Decals For Laptop Scrapbooking DIY Decor Journaling
like
Find Similar
Close-up of waterproof cosmic stickers with astronauts, planets, and artistic galaxy designs - Space Planet Series
Universe Starry Sky Stickers Waterproof Aesthetic Galaxy Planet Moon Astronaut Decals For Laptop Scrapbooking DIY Decor Journaling
$0.86
No MOQ
Moth Butterfly Moon Stickers Waterproof PVC Decorative Art Decals For Scrapbooking Laptop Water Bottle DIY Retro Aesthetic
Moth Butterfly Moon Stickers Waterproof PVC Decorative Art Decals For Scrapbooking Laptop Water Bottle DIY Retro Aesthetic
like
Find Similar
Waterproof moon and moth stickers for scrapbook, laptop and artistic decorations set - Butterfly And Moth Series
Moth Butterfly Moon Stickers Waterproof PVC Decorative Art Decals For Scrapbooking Laptop Water Bottle DIY Retro Aesthetic
$0.96
No MOQ
Cute Cartoon Frog Stickers For Kids Student Reward PVC Waterproof Green Animal Decal For Scrapbook Journal Laptop DIY Decoration
Cute Cartoon Frog Stickers For Kids Student Reward PVC Waterproof Green Animal Decal For Scrapbook Journal Laptop DIY Decoration
like
Find Similar
100pcs cute cartoon frog reward stickers for kids variety of creative green animal decals - 100Pcs Frog Stickers
NewCute Cartoon Frog Stickers For Kids Student Reward PVC Waterproof Green Animal Decal For Scrapbook Journal Laptop DIY Decoration
$0.95
No MOQ
Waterproof Cartoon Food Stickers For Water Bottles Laptop Luggage Cute PVC Vinyl Aesthetic Foodies Decals Decor For Kids Teens
Waterproof Cartoon Food Stickers For Water Bottles Laptop Luggage Cute PVC Vinyl Aesthetic Foodies Decals Decor For Kids Teens
like
Find Similar
Set of 50 cute cartoon food stickers in waterproof PVC for laptops and water bottles - 50 Sheets/Pack (PMS155)
Waterproof Cartoon Food Stickers For Water Bottles Laptop Luggage Cute PVC Vinyl Aesthetic Foodies Decals Decor For Kids Teens
$0.96
No MOQ
Cartoon Anthropomorphic Animal Fashion OOTD Stickers Waterproof PVC DIY Decorative Decals For Scrapbook Journal Luggage Water Bottle
Cartoon Anthropomorphic Animal Fashion OOTD Stickers Waterproof PVC DIY Decorative Decals For Scrapbook Journal Luggage Water Bottle
like
Find Similar
Close-up of waterproof cartoon animal stickers in fashionable OOTD outfits for DIY decor - Animal Fashion Series (8 Sheets)
Cartoon Anthropomorphic Animal Fashion OOTD Stickers Waterproof PVC DIY Decorative Decals For Scrapbook Journal Luggage Water Bottle
-10%
$0.86
No MOQ
Waterproof Transparent PET Fairy Tale Castle Stickers Watercolor Mushroom House Decals For Journal Scrapbooking Laptop Guitar
Waterproof Transparent PET Fairy Tale Castle Stickers Watercolor Mushroom House Decals For Journal Scrapbooking Laptop Guitar
like
Find Similar
50 pieces waterproof transparent PET stickers with fairy tale castles and magic houses - Fairy Tale Cottage Series (SLP118)
Waterproof Transparent PET Fairy Tale Castle Stickers Watercolor Mushroom House Decals For Journal Scrapbooking Laptop Guitar
$1.04
No MOQ
Water Bottle Holder Quilted Cotton Gingham Pattern Portable Cup Carrier Bag With Handle Insulated Sleeve Protective Pouch
Water Bottle Holder Quilted Cotton Gingham Pattern Portable Cup Carrier Bag With Handle Insulated Sleeve Protective Pouch
like
Find Similar
Detailed view of pink plaid quilted cup sleeve with thick handle and brand label - Pink
Quilted green and white gingham water bottle carrier bag with soft long handles - Green
Quilted blue gingham water bottle bag with heart stitching and sturdy fabric handle - Blue
Quilted yellow checkered water bottle bag with cotton padding and portable handle - Yellow
+1
Water Bottle Holder Quilted Cotton Gingham Pattern Portable Cup Carrier Bag With Handle Insulated Sleeve Protective Pouch
$2.28
No MOQ
Blueberry Milk Cartoon Stickers Waterproof PVC DIY Decals For Suitcase Laptop Scrapbook Cute Animal Aesthetic Stickers
Blueberry Milk Cartoon Stickers Waterproof PVC DIY Decals For Suitcase Laptop Scrapbook Cute Animal Aesthetic Stickers
like
Find Similar
50pcs cute cartoon animal and milk box stickers set for laptops in pastel blue - Blueberry Milk
Blueberry Milk Cartoon Stickers Waterproof PVC DIY Decals For Suitcase Laptop Scrapbook Cute Animal Aesthetic Stickers
-4%
$0.88
No MOQ
Vacuum Insulated Water Bottle Stainless Steel With Bamboo Lid Portable Handle Outdoor Sport Flask Minimalist
Vacuum Insulated Water Bottle Stainless Steel With Bamboo Lid Portable Handle Outdoor Sport Flask Minimalist
like
Find Similar
Minimalist cream yellow insulated water bottle with a wooden lid and silicone handle - Cream
350ml double-wall orange vacuum flask with bamboo-style lid and portable handle - Cinnabar Orange
Detail of a 350ml navy blue vacuum insulated bottle with natural bamboo lid and handle - Lake Blue
350ml double-walled thermal bottle in matte morandi green with bamboo lid and handle - Grey Green
+9
Vacuum Insulated Water Bottle Stainless Steel With Bamboo Lid Portable Handle Outdoor Sport Flask Minimalist
$9.37
Mix MOQ : 2
 · 
11 sold recently
Ceramic Coffee Cup And Saucer Irregular Hand-Pinch Painted Heart Cherry Flower Bow Cute Ins Style Mug
Ceramic Coffee Cup And Saucer Irregular Hand-Pinch Painted Heart Cherry Flower Bow Cute Ins Style Mug
like
Find Similar
Cream ceramic coffee cup and saucer set with black cherry pattern and handle - 340ml / Black Cherry
Handcrafted white ceramic coffee cup and saucer with red hand-painted rose patterns - 340ml / Rose
Handcrafted cream ceramic coffee cup and saucer set with vibrant red heart patterns - 340ml / Small Heart
Ceramic coffee cup and saucer set with red heart polka dots and irregular wavy edges - 340ml / Large Heart
+5
Ceramic Coffee Cup And Saucer Irregular Hand-Pinch Painted Heart Cherry Flower Bow Cute Ins Style Mug
-4%
$7.67
Mix MOQ : 2
 · 
139 views
Go to

More in home & kitchen

Explore more in suction cups

wallplasticwindowbabystainlessadjustableholidaypartyroundstorage rack
hangingracksteelshapewarmcleaningfoothomeopenpet

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access