Everful

Wholesale transparent gift boxes

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Transparent Gift Boxes

Find the perfect pieces: party gift bags, party favors, gift wrapping supplies and more

Popular collections in transparent gift boxes

All products in transparent gift boxes

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Laser Cut Heart Shaped Candy Box Pearlescent Paper Hollow Out Gift Box With Ribbon And Thank You Tag For Wedding Party Decoration
Laser Cut Heart Shaped Candy Box Pearlescent Paper Hollow Out Gift Box With Ribbon And Thank You Tag For Wedding Party Decoration
like
Find Similar
Elegant white laser-cut wedding favor box with heart patterns and gold thank you tag - White
Detail of white hollow favor box with heart laser cut patterns and thank you tag - Ivory
Pink heart laser-cut candy gift box with pink organza ribbon and thank you tag for wedding - Pink
Detailed laser-cut golden candy box with heart patterns and thank you tag on a plate - Gold
+2
Laser Cut Heart Shaped Candy Box Pearlescent Paper Hollow Out Gift Box With Ribbon And Thank You Tag For Wedding Party Decoration
$0.14
Mix MOQ : 50
Laser Cut Hollow Rose Wedding Favor Boxes Pearl Paper Candy Box With Ribbon And Thank You Tags For Party Gift Packaging
Laser Cut Hollow Rose Wedding Favor Boxes Pearl Paper Candy Box With Ribbon And Thank You Tags For Party Gift Packaging
like
Find Similar
Elegant white laser-cut rose gift box with white organza ribbon and Thank You tag - White
Detailed view of white laser-cut favor box with ribbon and gold Thank You tag on a plate - Ivory
Pink laser-cut rose hollow favor box with white ribbon and Thank You tag for weddings - Pink
Detail of laser-cut gold gift box with lace pattern and thank you tag on a ceramic plate - Gold
+1
Laser Cut Hollow Rose Wedding Favor Boxes Pearl Paper Candy Box With Ribbon And Thank You Tags For Party Gift Packaging
$0.14
Mix MOQ : 50
Simple Black White Square Gift Box With White Satin Ribbon Bow And Gold Glitter Heart Pattern For Wedding Birthday Party Favors Packaging
Simple Black White Square Gift Box With White Satin Ribbon Bow And Gold Glitter Heart Pattern For Wedding Birthday Party Favors Packaging
like
Find Similar
Elegant black and white square gift box with gold glitter hearts and white satin bow - Black Gold Heart Pattern Style / Small
Simple Black White Square Gift Box With White Satin Ribbon Bow And Gold Glitter Heart Pattern For Wedding Birthday Party Favors Packaging
$0.81
No MOQ
Laser Cut Rose Butterfly Candy Box Pearlescent Paper Wedding Favor Gift Box With Organza Ribbon Party Decoration Box
Laser Cut Rose Butterfly Candy Box Pearlescent Paper Wedding Favor Gift Box With Organza Ribbon Party Decoration Box
like
Find Similar
Detail of white laser-cut wedding candy box with rose patterns and a silk ribbon bow - White
Detail of cream laser cut candy box with butterfly motifs and white chiffon ribbon - Ivory
Pink laser-cut wedding candy box with rose and butterfly patterns and a ribbon bow - Pink
Laser cut light blue wedding candy box with hollow butterfly and rose pattern - Tiffany Blue
+7
Laser Cut Rose Butterfly Candy Box Pearlescent Paper Wedding Favor Gift Box With Organza Ribbon Party Decoration Box
$0.13
Mix MOQ : 50
Laser Cut Pearlescent Paper Favor Boxes With Ribbon Thank You Tags For Wedding Party Decoration Gift Wrapping Box
Laser Cut Pearlescent Paper Favor Boxes With Ribbon Thank You Tags For Wedding Party Decoration Gift Wrapping Box
like
Find Similar
Close-up of white laser-cut gift box with floral patterns, ribbon, and Thank You tag - Tag Included / 5x5x8CM / White
Detail of cream laser-cut gift box with floral patterns and Thank You tag - Tag Included / 5x5x8CM / Ivory
Detail of pink laser-cut gift box with floral patterns and a white Thank You tag - Tag Included / 5x5x8CM / Pink
Detail of laser-cut gift box with mint green leaf pattern, white ribbon, and thank you tag - Tag Included / 5x5x8CM / Pearl Pale Blue
+6
Laser Cut Pearlescent Paper Favor Boxes With Ribbon Thank You Tags For Wedding Party Decoration Gift Wrapping Box
$0.14
Mix MOQ : 50
Princess Dress Shape Laser Cut Glitter Paper Favor Box Elegant Hollow Out Floral Candy Gift Box For Wedding Party Favor
Princess Dress Shape Laser Cut Glitter Paper Favor Box Elegant Hollow Out Floral Candy Gift Box For Wedding Party Favor
like
Find Similar
Silver glitter ballerina favor box with laser-cut hollow lace dress and ribbon bow - Silver Glitter
Elegant gold glitter bride silhouette candy box with laser-cut floral lace details - Glitter Rose Gold
Red glitter hollow-out princess gown wedding favor box with elegant rose lace patterns - Glitter Red
Blue glitter princess dress candy box with laser-cut lace and organza ribbon bow - Glitter Royal Blue
+5
Princess Dress Shape Laser Cut Glitter Paper Favor Box Elegant Hollow Out Floral Candy Gift Box For Wedding Party Favor
-5%
$0.17
Mix MOQ : 50
European Style Wedding Candy Gift Box With Faux Artificial Pearl Handle And Ribbon Bow Embossed Paper Handbag For Party Favors
European Style Wedding Candy Gift Box With Faux Artificial Pearl Handle And Ribbon Bow Embossed Paper Handbag For Party Favors
like
Find Similar
Tiffany blue candy gift box with pearl handle and embossed floral texture - Large / Lake Blue
Elegant pink embossed candy gift box featuring a pearl handle and pink ribbon bow - Small / Pink
Elegant red wedding candy gift box with pearl handle and ribbon on white plush background - Small / Red
Detail of white gift box with floral embossing, pearl handle and large ribbon bow - Small / White
+4
European Style Wedding Candy Gift Box With Faux Artificial Pearl Handle And Ribbon Bow Embossed Paper Handbag For Party Favors
-4%
$0.24-0.34
No MOQ
 · 
320 sold recently
Laser Cut Butterfly Favor Box Pearlescent Paper Hollow Candy Box With Ribbon Thank You Tag For Wedding Party Decoration
Laser Cut Butterfly Favor Box Pearlescent Paper Hollow Candy Box With Ribbon Thank You Tag For Wedding Party Decoration
like
Find Similar
White butterfly-shaped laser-cut wedding favor box with Thank You tag and ribbon - White
Pink laser-cut butterfly gift box with rose patterns and thank you tag for weddings - Pink
Light blue laser-cut butterfly gift box with ribbon and Thank You tag for wedding favors - Pearl Pale Blue
Laser Cut Butterfly Favor Box Pearlescent Paper Hollow Candy Box With Ribbon Thank You Tag For Wedding Party Decoration
$0.14
Mix MOQ : 50
Laser Hollow Flower Heart Paper Candy Box With Satin Ribbon Bow Metallic Finish Wedding Party Favor Chocolate Gift Box
Laser Hollow Flower Heart Paper Candy Box With Satin Ribbon Bow Metallic Finish Wedding Party Favor Chocolate Gift Box
like
Find Similar
Elegant gold laser-cut hollow candy box with floral patterns and a matching ribbon bow - Reflective Gold
Silver laser-cut wedding favor box with intricate floral patterns and blue silk bow - Reflective Silver
Iridescent laser-cut favor box with floral patterns and a silver silk bow for weddings - Reflective Iridescent
Laser cut gift box with metallic blue finish and navy ribbon bow for weddings and parties - Reflective Dark Blue
+3
Laser Hollow Flower Heart Paper Candy Box With Satin Ribbon Bow Metallic Finish Wedding Party Favor Chocolate Gift Box
$0.16
Mix MOQ : 50
Heart Shape Laser Cut Wedding Favor Candy Boxes With Ribbons Pearl Paper Hollow Out Gift Boxes Valentine Party Decorations
Heart Shape Laser Cut Wedding Favor Candy Boxes With Ribbons Pearl Paper Hollow Out Gift Boxes Valentine Party Decorations
like
Find Similar
Detail of pink laser-cut heart favor box with floral patterns and soft ribbon bow - Pink
Laser cut white heart candy box with pearl paper floral patterns and white ribbon bow - White
Laser-cut hollow heart-shaped gold mirror gift box with elegant ribbon and floral pattern - Reflective Gold
Close-up of heart-shaped laser-cut silver gift box with white satin ribbon and floral pattern - Reflective Silver
+4
Heart Shape Laser Cut Wedding Favor Candy Boxes With Ribbons Pearl Paper Hollow Out Gift Boxes Valentine Party Decorations
$0.13
Mix MOQ : 50
Hollow Heart Shaped Love Paper Candy Box With Ribbon For Wedding Party Valentine Day Gift Packaging Favors Pearlescent Paper Boxes
Hollow Heart Shaped Love Paper Candy Box With Ribbon For Wedding Party Valentine Day Gift Packaging Favors Pearlescent Paper Boxes
like
Find Similar
White heart-shaped paper candy box with purple Love text and ribbon for weddings - White
Pink heart-shaped gift box with Love script and ribbon on a decorative plate - Pink
Heart shaped tiffany blue gift box with love text and silk ribbon bow for candies - Tiffany Blue
Detail of pink heart-shaped laser-cut favor box with Love text and red silk ribbon bow - Pearlescent Red
+3
Hollow Heart Shaped Love Paper Candy Box With Ribbon For Wedding Party Valentine Day Gift Packaging Favors Pearlescent Paper Boxes
$0.13
Mix MOQ : 50
White Laser Cut Candy Box Pearlescent Paper Hollow Butterfly Mr Mrs Wedding Party Favor Gift Box Ribbon Packaging
White Laser Cut Candy Box Pearlescent Paper Hollow Butterfly Mr Mrs Wedding Party Favor Gift Box Ribbon Packaging
like
Find Similar
Elegant white laser-cut gift box with floral patterns and a translucent ribbon bow - Hollow Floral Style (XTH-94)
Detail of white laser-cut pearlescent favor box with rose patterns and organza ribbon - Rose Hollow Style (XTH-102)
Laser cut white Mr & Mrs wedding candy box with butterfly design and ribbon bow - Couple Silhouette Style (XTH-26)
Elegant laser-cut heart pattern white gift box with white ribbon bow for wedding - Heart Floral Style (XTH-31)
+5
White Laser Cut Candy Box Pearlescent Paper Hollow Butterfly Mr Mrs Wedding Party Favor Gift Box Ribbon Packaging
$0.12-0.17
Mix MOQ : 50
Elegant Laser Cut Cross Gift Boxes Pearl Paper Hollow Candy Box With Gold Liner For Religious Wedding Baptism Party Celebration
Elegant Laser Cut Cross Gift Boxes Pearl Paper Hollow Candy Box With Gold Liner For Religious Wedding Baptism Party Celebration
like
Find Similar
Elegant laser cut black and gold hollow cross paper favor box for religious events - Black + Gold
White and gold laser-cut square gift box with hollow cross and floral vine patterns - White+Gold
Pink pearl paper gift box with laser-cut cross design and gold lining for baptism - Pink + Gold
Laser-cut navy blue and gold wedding favor box with cross and vine hollow pattern - Blue + Gold
+2
Elegant Laser Cut Cross Gift Boxes Pearl Paper Hollow Candy Box With Gold Liner For Religious Wedding Baptism Party Celebration
$0.21
No MOQ
Laser Cut Thank You Hollow Favor Boxes European Style Wedding Candy Gift Paper Box With Ribbon For Thanksgiving Party
Laser Cut Thank You Hollow Favor Boxes European Style Wedding Candy Gift Paper Box With Ribbon For Thanksgiving Party
like
Find Similar
White laser-cut thank you gift box with floral patterns and a silver ribbon bow - White
Macro shot of white laser-cut 'Thank You' favor box with floral patterns and silver ribbon - Starry White
Close-up of champagne gold laser-cut Thank You gift box with ribbon and floral patterns - Jewelry Cream Star
Pink laser-cut thank you gift box with floral pattern and white organza ribbon bow - Pink
+8
Laser Cut Thank You Hollow Favor Boxes European Style Wedding Candy Gift Paper Box With Ribbon For Thanksgiving Party
$0.13
Mix MOQ : 50
Square Cardboard Gift Boxes With Heart Shaped Window Colorful Heart Patterns Romantic Valentine Day Treat Packaging Boxes
Square Cardboard Gift Boxes With Heart Shaped Window Colorful Heart Patterns Romantic Valentine Day Treat Packaging Boxes
like
Find Similar
Pink striped square gift box with heart patterns and bronze cutout, 10x10x7.5cm - White Striped Hearts
White square gift box with colorful hearts and golden cutout lid, size 10x10x7.5 cm - White Colorful Heart
Pink square gift box with heart prints and window, size 10x10x7.5cm for Valentine - Pink Heart
Brown square gift box with red heart pattern and window, size 10x10x7.5cm for Valentine - LOVE YOU Red Hearts
+2
Square Cardboard Gift Boxes With Heart Shaped Window Colorful Heart Patterns Romantic Valentine Day Treat Packaging Boxes
-8%
$0.11
Mix MOQ : 10
 · 
25 sold recently
Laser Cut Hollow Wedding Favor Candy Box Elegant Floral Pattern Pearl Paper Gift Box With Ribbon For Party Engagement
Laser Cut Hollow Wedding Favor Candy Box Elegant Floral Pattern Pearl Paper Gift Box With Ribbon For Party Engagement
like
Find Similar
Elegant white laser-cut wedding favor box with floral patterns and a satin ribbon bow - 5*5*8CM / White
Detail view of light blue laser-cut wedding candy box with elegant floral hollow pattern - 5*5*8CM / Pearl Pale Blue
Laser-cut light blue wedding favor box with floral patterns and matching ribbon bow - 5*5*8CM / Tiffany Blue
Macro view of laser-cut floral patterns on pink pearlescent wedding favor box with ribbon - 5*5*8CM / Pink
+4
Laser Cut Hollow Wedding Favor Candy Box Elegant Floral Pattern Pearl Paper Gift Box With Ribbon For Party Engagement
$0.13
Mix MOQ : 50
Laser Cut Moon Star Candy Favor Box Hollow Pearlescent Paper Gift Box With Ribbon For Wedding Party Eid Ramadan Mubarak Decor
Laser Cut Moon Star Candy Favor Box Hollow Pearlescent Paper Gift Box With Ribbon For Wedding Party Eid Ramadan Mubarak Decor
like
Find Similar
5 options
Laser Cut Moon Star Candy Favor Box Hollow Pearlescent Paper Gift Box With Ribbon For Wedding Party Eid Ramadan Mubarak Decor
$0.13
Mix MOQ : 50
Laser Cut Reindeer Christmas Tree Wedding Candy Box Pearl Paper Hollow Gift Box With Ribbon For Party Wedding Celebration
Laser Cut Reindeer Christmas Tree Wedding Candy Box Pearl Paper Hollow Gift Box With Ribbon For Party Wedding Celebration
like
Find Similar
Golden laser-cut reindeer gift box with ribbon for Christmas and wedding parties - Reflective Gold
Elegant laser-cut deer and forest gift box in dark grey with a sheer black ribbon bow - Silver Charcoal
Detail view of a laser-cut red paper candy box featuring reindeer silhouettes and a ribbon - Pearlescent Red
Silver laser-cut gift box featuring reindeer design and light blue satin ribbon bow - Reflective Silver
+7
Laser Cut Reindeer Christmas Tree Wedding Candy Box Pearl Paper Hollow Gift Box With Ribbon For Party Wedding Celebration
$0.13
Mix MOQ : 50
Laser Cut Wedding Candy Favor Box Heart Bird Pattern Pearlescent Paper Gift Box Ribbon For Engagement Party Decoration
Laser Cut Wedding Candy Favor Box Heart Bird Pattern Pearlescent Paper Gift Box Ribbon For Engagement Party Decoration
like
Find Similar
White laser-cut house wedding favor box with ribbon, heart and bird patterns - White
Pink hollow-out wedding favor box with LOVE pattern and silk ribbon bow detail - Pink
Close-up of red laser-cut candy box with LOVE text and elegant ribbon bow detail - Pearlescent Red
Detail of laser-cut hollow candy box with golden organza ribbon and bird floral patterns - Gold
+4
Laser Cut Wedding Candy Favor Box Heart Bird Pattern Pearlescent Paper Gift Box Ribbon For Engagement Party Decoration
$0.13
Mix MOQ : 50
Christmas Laser Cut Candy Boxes Hollow Reindeer Snowflake Patterns Pearlescent Paper Gift Boxes With Satin Ribbon For Party
Christmas Laser Cut Candy Boxes Hollow Reindeer Snowflake Patterns Pearlescent Paper Gift Boxes With Satin Ribbon For Party
like
Find Similar
White laser-cut Christmas gift box with reindeer and snowflake patterns and white ribbon - White / 5*5*8CM
Detailed laser-cut reindeer and snowflake patterns on gold gift box with ribbon - Gold / 5*5*8CM
Green laser-cut Christmas candy box with reindeer patterns and a matching ribbon bow - Dark Green / 5*5*8CM
Red laser-cut Christmas candy box with reindeer and snowflake patterns and silk ribbon - Pearlescent Red / 5*5*8CM
+2
Christmas Laser Cut Candy Boxes Hollow Reindeer Snowflake Patterns Pearlescent Paper Gift Boxes With Satin Ribbon For Party
$0.13
Mix MOQ : 50
White Butterfly Laser Cut Hollow Candy Box With Satin Ribbon And Thank You Tag For Wedding Party Favor Chocolate Gift Box
White Butterfly Laser Cut Hollow Candy Box With Satin Ribbon And Thank You Tag For Wedding Party Favor Chocolate Gift Box
like
Find Similar
Elegant white laser-cut butterfly favor box with translucent ribbon and thank you tag - White
White Butterfly Laser Cut Hollow Candy Box With Satin Ribbon And Thank You Tag For Wedding Party Favor Chocolate Gift Box
$0.15
Mix MOQ : 50
European Hollow Rose Crown Candy Boxes Pearlescent Paper Gift Box For Wedding Party Favor Chocolate Packaging Case
European Hollow Rose Crown Candy Boxes Pearlescent Paper Gift Box For Wedding Party Favor Chocolate Packaging Case
like
Find Similar
Elegant gold hollow crown gift box with rose pattern for wedding and party favors - Reflective Gold
Detail of laser-cut purple paper candy box with crown handle and hollow rose patterns - Dark Purple
European style crown wedding favor box with white laser-cut rose hollow paper pattern - White
Pink hollow rose and crown favor box for weddings with laser cut paper detail - Pearlescent Red
+3
European Hollow Rose Crown Candy Boxes Pearlescent Paper Gift Box For Wedding Party Favor Chocolate Packaging Case
-5%
$0.16
Mix MOQ : 50
Laser Cut Hollow Cross Candy Box Paper Ribbon Wedding Baptism Communion Party Favor Gift Treat Packaging Box
Laser Cut Hollow Cross Candy Box Paper Ribbon Wedding Baptism Communion Party Favor Gift Treat Packaging Box
like
Find Similar
Laser-cut white wedding favor box with hollow cross design and elegant organza ribbon bow - White
Detail of laser-cut cross pattern and white organza ribbon on elegant candy box - Ivory
Pink laser-cut favor box with hollow cross design and white silk ribbon for weddings - Pink
Close-up of light blue laser-cut cross favor box with delicate organza ribbon on porcelain - Tiffany Blue
+6
Laser Cut Hollow Cross Candy Box Paper Ribbon Wedding Baptism Communion Party Favor Gift Treat Packaging Box
$0.13
Mix MOQ : 50
Heart Shaped Laser Cut Hollow Candy Box Wedding Favor Gift Packaging With Ribbon Love Pattern Pearl Paper Chocolate Box
Heart Shaped Laser Cut Hollow Candy Box Wedding Favor Gift Packaging With Ribbon Love Pattern Pearl Paper Chocolate Box
like
Find Similar
White heart-shaped laser cut wedding favor box with LOVE pattern and white ribbon bow - White
Elegant white heart-shaped hollow gift box with LOVE laser-cut design and white ribbon - Ivory
Blue heart-shaped laser-cut wedding favor box with LOVE hollow pattern and ribbon - Teal Blue
European style purple hollow heart favor box with LOVE pattern and silk ribbon - Deep purple
+1
Heart Shaped Laser Cut Hollow Candy Box Wedding Favor Gift Packaging With Ribbon Love Pattern Pearl Paper Chocolate Box
$0.14
Mix MOQ : 50
Laser Cut Happy Birthday Candy Box Pearlescent Paper House Shape Gift Box With Ribbon For Birthday Party Favor Supplies
Laser Cut Happy Birthday Candy Box Pearlescent Paper House Shape Gift Box With Ribbon For Birthday Party Favor Supplies
like
Find Similar
Close-up of laser-cut Happy Birthday favor box in white paper with organza ribbon - White
Detailed laser-cut pink Happy Birthday favor box with white ribbon and balloon patterns - Pink
Detail of laser-cut Happy Birthday candy box with balloon patterns and white ribbon bow - Jewelry Cream Star
Light blue hollowed Happy Birthday candy box with ribbon bow and star patterns - Tiffany Blue
+6
Laser Cut Happy Birthday Candy Box Pearlescent Paper House Shape Gift Box With Ribbon For Birthday Party Favor Supplies
$0.13
Mix MOQ : 50
Cartoon Animal Paper Gift Box With Clear Window Foldable Packaging Bag For Candy Socks Party Favor Cat Dog Rabbit Pattern
Cartoon Animal Paper Gift Box With Clear Window Foldable Packaging Bag For Candy Socks Party Favor Cat Dog Rabbit Pattern
like
Find Similar
Cute French Bulldog cartoon pattern paper gift box with circular window for candy packaging - French Bulldog / 10.5x16x5.5cm
Cute cartoon animal themed folding paper gift box with clear window for candy - Old English Sheepdog / 10.5x16x5.5cm
Cute pink rabbit-shaped folding paper gift box for candy and small party favors - Rabbit / 10.5x16x5.5cm
Cute orange cat themed triangular folding paper gift box with round transparent window - Cat / 10.5x16x5.5cm
Cartoon Animal Paper Gift Box With Clear Window Foldable Packaging Bag For Candy Socks Party Favor Cat Dog Rabbit Pattern
$0.12
No MOQ
European Style Laser Cut Hollow Wedding Candy Box Heart Pattern Ribbon Favor Gift Packaging For Party Celebration Decoration
European Style Laser Cut Hollow Wedding Candy Box Heart Pattern Ribbon Favor Gift Packaging For Party Celebration Decoration
like
Find Similar
Elegant red laser-cut wedding favor box with floral patterns and a matching silk ribbon - Pearlescent Red
Detail of silver laser-cut wedding candy box with heart patterns and light blue ribbon bow - Reflective Silver
White laser-cut wedding favor box with hollow heart vine patterns and white chiffon ribbon - White
Detail of pink laser-cut wedding favor box with heart patterns and satin ribbon bow - Pink
+6
European Style Laser Cut Hollow Wedding Candy Box Heart Pattern Ribbon Favor Gift Packaging For Party Celebration Decoration
$0.13
Mix MOQ : 50
Laser Cut LOVE Hollow Candy Box European Pearlescent Paper Wedding Favor Chocolate Gift Box With Ribbon For Party Valentine's Day
Laser Cut LOVE Hollow Candy Box European Pearlescent Paper Wedding Favor Chocolate Gift Box With Ribbon For Party Valentine's Day
like
Find Similar
Detailed view of hollowed floral pattern and Love text on white wedding favor box - White
Pink LOVE hollowed-out glitter candy gift box with heart accents and white ribbon bow - Pink
Sky blue hollow Love wedding favor box with decorative ribbon and laser cut patterns - Tiffany Blue
Macro shot of white laser-cut wedding candy box with gold LOVE text and ribbon bow - Ivory
+4
Laser Cut LOVE Hollow Candy Box European Pearlescent Paper Wedding Favor Chocolate Gift Box With Ribbon For Party Valentine's Day
$0.13
Mix MOQ : 50
Mr & Mrs Laser Cut Wedding Favor Box With Ribbon Elegant European Hollow Candy Gift Packaging Case For Engagement Party
Mr & Mrs Laser Cut Wedding Favor Box With Ribbon Elegant European Hollow Candy Gift Packaging Case For Engagement Party
like
Find Similar
Silver laser-cut Mr & Mrs wedding favor box with white ribbon for chocolates - Reflective Silver
White laser-cut Mr & Mrs wedding candy box with a delicate white organza ribbon bow - White
Pink laser-cut wedding favor box with Mr & Mrs silhouette and white ribbon bow - Pink
Red laser-cut wedding candy box featuring Mr & Mrs silhouettes and a matching ribbon - Red
+11
Mr & Mrs Laser Cut Wedding Favor Box With Ribbon Elegant European Hollow Candy Gift Packaging Case For Engagement Party
$0.12
Mix MOQ : 50
European Style Hollow Bird Heart Candy Box Laser Cut Pearlescent Paper Gift Box For Wedding Party Favor Chocolate Case
European Style Hollow Bird Heart Candy Box Laser Cut Pearlescent Paper Gift Box For Wedding Party Favor Chocolate Case
like
Find Similar
Elegant white birdcage gift box with hollow heart patterns and light purple satin ribbon - White
Detailed laser-cut bird and heart patterns on pearlescent white candy favor box - Ivory
Close-up of laser-cut birdcage candy box in gold mirror finish with silk ribbon bow - Reflective Gold
Detail of laser-cut bird and heart patterns on pearlescent gift box with blue ribbon - Reflective Silver
+6
European Style Hollow Bird Heart Candy Box Laser Cut Pearlescent Paper Gift Box For Wedding Party Favor Chocolate Case
$0.12
Mix MOQ : 50
Laser Cut Hollow Rose Flower Wedding Favor Box Pearlescent Paper Candy Chocolate Gift Box For Marriage Party Celebration
Laser Cut Hollow Rose Flower Wedding Favor Box Pearlescent Paper Candy Chocolate Gift Box For Marriage Party Celebration
like
Find Similar
Laser cut hollow rose wedding favor box in metallic gold with decorative pearls - Reflective Gold
Macro shot of silver laser-cut rose hollow gift box on a luxury ceramic plate - Reflective Silver
Detail of laser-cut rose hollow candy box on vintage plate with pearls and flowers - White
Detailed laser-cut white rose gift box with golden lining for wedding candy or chocolates - Ivory
+3
Laser Cut Hollow Rose Flower Wedding Favor Box Pearlescent Paper Candy Chocolate Gift Box For Marriage Party Celebration
$0.17
Mix MOQ : 50
Vintage Teapot Shape Paper Candy Box With Ribbon Bow Rose Floral Gold Stamping Gift Box For Wedding Party Favor Table Decor
Vintage Teapot Shape Paper Candy Box With Ribbon Bow Rose Floral Gold Stamping Gift Box For Wedding Party Favor Table Decor
like
Find Similar
Elegant pink teapot-shaped gift box with floral patterns and gold foil accents for parties. - Pink Gold Stamped
European style red teapot shaped paper candy box with floral patterns and ribbon - Red Bronzing
Mint green teapot-shaped paper candy box with floral patterns and white ribbon - Mint Green Gold
Elegant teapot shaped wedding favor box with vintage rose floral pattern and gold foil - Ivory White Bronzing
Vintage Teapot Shape Paper Candy Box With Ribbon Bow Rose Floral Gold Stamping Gift Box For Wedding Party Favor Table Decor
$0.17
Mix MOQ : 50
 · 
16 views
Laser Cut Butterfly Wedding Favor Boxes Pearlescent Paper Candy Gift Box For Chocolate Party Decorations Wedding Supplies
Laser Cut Butterfly Wedding Favor Boxes Pearlescent Paper Candy Gift Box For Chocolate Party Decorations Wedding Supplies
like
Find Similar
Light blue laser-cut candy box featuring 3D butterfly lid for wedding favors - Pearl Pale Blue
Elegant laser-cut cream butterfly gift box placed on a gold-rimmed white porcelain plate - Ivory
Elegant white laser-cut butterfly wedding favor box on a rustic dark wood surface - White
Elegant laser-cut pink butterfly paper candy box with intricate floral hollow design for weddings - Pink
+5
Laser Cut Butterfly Wedding Favor Boxes Pearlescent Paper Candy Gift Box For Chocolate Party Decorations Wedding Supplies
$0.13
Mix MOQ : 50
Laser Cut Hollow Candy Box Glitter Pearlescent Paper Gift Box With Satin Ribbon Cross Heart Favors For Wedding Party
Laser Cut Hollow Candy Box Glitter Pearlescent Paper Gift Box With Satin Ribbon Cross Heart Favors For Wedding Party
like
Find Similar
Golden glitter wedding candy box with laser-cut cross design and organza ribbon bow - Glitter Golden Yellow
Silver glitter laser-cut house-shaped wedding candy gift box with blue ribbon bow - Silver Glitter
Sparkly red glitter wedding favor box with cross cutout and elegant organza ribbon - Glitter Red
Laser Cut Hollow Candy Box Glitter Pearlescent Paper Gift Box With Satin Ribbon Cross Heart Favors For Wedding Party
$0.17
Mix MOQ : 50
Elegant Laser Cut Pearl Paper Wedding Favor Boxes Hollow Love Design Candy Chocolate Gift Packaging Box For Marriage Party Decor
Elegant Laser Cut Pearl Paper Wedding Favor Boxes Hollow Love Design Candy Chocolate Gift Packaging Box For Marriage Party Decor
like
Find Similar
Elegant gold laser-cut wedding favor box with Love script, displayed on a white plate - Reflective Gold
Silver laser-cut hollow Love favor box for weddings with metallic finish and floral pattern - Reflective Silver
Pink laser-cut wedding candy box with gold mirror accents and elegant Love engraving - White
Pink laser-cut candy box with gold accents and Love engraving for wedding gifts - Pink
+3
Elegant Laser Cut Pearl Paper Wedding Favor Boxes Hollow Love Design Candy Chocolate Gift Packaging Box For Marriage Party Decor
$0.18
Mix MOQ : 50
Laser Cut Hollow Wedding Candy Box With Ribbon European Style Pearlescent Paper Gift Box For Party Chocolate Packaging
Laser Cut Hollow Wedding Candy Box With Ribbon European Style Pearlescent Paper Gift Box For Party Chocolate Packaging
like
Find Similar
9 options
Laser Cut Hollow Wedding Candy Box With Ribbon European Style Pearlescent Paper Gift Box For Party Chocolate Packaging
$0.13
Mix MOQ : 50
Laser Cut Heart Love Wedding Favor Candy Boxes With Ribbon And Thank You Tags Rose Floral Gift Box For Wedding Party Favor
Laser Cut Heart Love Wedding Favor Candy Boxes With Ribbon And Thank You Tags Rose Floral Gift Box For Wedding Party Favor
like
Find Similar
Macro shot of white laser-cut wedding favor box with Love heart and silk bow detail - White
Detail of white laser-cut favor box with Love motif and thank you tag with ribbon - Ivory
Pink hollowed heart Love candy gift box with rose pattern and thank you tag for weddings - Pink
Detail of golden laser-cut wedding favor box with Love motif and thank you tag - Gold
+6
Laser Cut Heart Love Wedding Favor Candy Boxes With Ribbon And Thank You Tags Rose Floral Gift Box For Wedding Party Favor
$0.14
Mix MOQ : 50
Laser Cut Heart Lace Wedding Favor Candy Boxes With Ribbon Elegant Cardstock Gift Packaging Box For Wedding Party Decor
Laser Cut Heart Lace Wedding Favor Candy Boxes With Ribbon Elegant Cardstock Gift Packaging Box For Wedding Party Decor
like
Find Similar
White laser-cut heart pattern candy box with a delicate white chiffon ribbon bow - White
Macro shot of white laser-cut heart favor box with elegant lace pattern and ribbon - Ivory
Pink laser-cut wedding candy box with heart patterns and elegant silk ribbon bow - Pink
Close-up of yellow laser-cut gift box with hollow heart pattern and ribbon bow - Gold
+5
Laser Cut Heart Lace Wedding Favor Candy Boxes With Ribbon Elegant Cardstock Gift Packaging Box For Wedding Party Decor
$0.13
Mix MOQ : 50
Laser Cut Heart Rose Wedding Candy Box Ribbon Bow Hollow Paper Gift Box For Chocolate Favors Pink White Gold Silver Party Decor
Laser Cut Heart Rose Wedding Candy Box Ribbon Bow Hollow Paper Gift Box For Chocolate Favors Pink White Gold Silver Party Decor
like
Find Similar
Pink heart-shaped hollow rose candy box with laser cut design and ribbon bow - Pink
Laser cut heart shaped wedding favor box with hollow rose patterns and white ribbon bow - White
Hollow rose heart gift box with elegant red ribbon bow for wedding and party favors - Pearlescent Red
Elegant black heart-shaped laser-cut gift box with rose pattern and silk ribbon bow - Black Khaki
+6
Laser Cut Heart Rose Wedding Candy Box Ribbon Bow Hollow Paper Gift Box For Chocolate Favors Pink White Gold Silver Party Decor
$0.13
Mix MOQ : 50
European Style Laser Cut Hollow Vine Leaf Pearl Paper Favor Box Elegant Wedding Party Candy Gift Packaging Box
European Style Laser Cut Hollow Vine Leaf Pearl Paper Favor Box Elegant Wedding Party Candy Gift Packaging Box
like
Find Similar
Elegant white laser-cut leaf wedding candy box with luxury gold foil mirror lid finish - White + Gold
Navy blue laser cut wedding gift box with gold liner and vine leaf patterns - Royal Blue + Gold
Elegant black and gold laser cut vine pattern square wedding favor candy gift box - Black + Gold
Elegant red wedding favor box with gold laser-cut vine patterns and square shape - Pearl Red + Gold
+2
European Style Laser Cut Hollow Vine Leaf Pearl Paper Favor Box Elegant Wedding Party Candy Gift Packaging Box
-4%
$0.21
Mix MOQ : 50
Laser Cut Wedding Favor Boxes Pearlescent Paper Candy Gift Box With Ribbon Thank You Tags For Baptism Party Decoration
Laser Cut Wedding Favor Boxes Pearlescent Paper Candy Gift Box With Ribbon Thank You Tags For Baptism Party Decoration
like
Find Similar
Detailed laser-cut white gift box featuring floral patterns and Thank You hang tag - 5*5cm / White
Detail of white hollow-out wedding favor box with ribbon and gold Thank You tag - 5*5cm / Ivory
Close-up of pink laser-cut wedding favor box with ribbon and Thank You tag - 5*5cm / Pink
Macro detail of laser-cut wedding favor box in light blue with groom and bride silhouette - 5*5cm / Pearl Pale Blue
+6
Laser Cut Wedding Favor Boxes Pearlescent Paper Candy Gift Box With Ribbon Thank You Tags For Baptism Party Decoration
$0.14
Mix MOQ : 50
Laser Cut Angel Candy Box Pearlescent Paper Favor Gift Box With Ribbon For Wedding Party Baptism Birthday Celebration
Laser Cut Angel Candy Box Pearlescent Paper Favor Gift Box With Ribbon For Wedding Party Baptism Birthday Celebration
like
Find Similar
Elegant white laser-cut angel candy box with silver ribbon for wedding and party favors - White
Close-up of red house-shaped gift box with hollow angel pattern and silk ribbon - Pearlescent Red
Detail of silver hollow candy box with angel and star cutouts and white organza ribbon - Reflective Silver
Golden hollow gift box with angel patterns and a matching organza ribbon bow - Reflective Gold
+9
Laser Cut Angel Candy Box Pearlescent Paper Favor Gift Box With Ribbon For Wedding Party Baptism Birthday Celebration
$0.12
Mix MOQ : 50
Laser Cut Star Of David Favor Boxes With Ribbon Hollow Out Paper Candy Gift Boxes For Hanukkah Jewish Wedding Party Celebration
Laser Cut Star Of David Favor Boxes With Ribbon Hollow Out Paper Candy Gift Boxes For Hanukkah Jewish Wedding Party Celebration
like
Find Similar
Elegant white laser cut Hanukkah favor box with Star of David and white ribbon bow - White
Close-up of laser-cut hexagonal star patterns on white pearlescent gift candy box - Ivory
Close-up of pink house-shaped paper gift box with hollow geometric cutout and white ribbon bow - Pink
Elegant gold laser cut Hanukkah gift box with hexagonal pattern and silk ribbon - Gold
+6
Laser Cut Star Of David Favor Boxes With Ribbon Hollow Out Paper Candy Gift Boxes For Hanukkah Jewish Wedding Party Celebration
$0.13
Mix MOQ : 50
Heart Shaped Laser Cut Candy Box With Ribbon LOVE Hollow Design Pearl Paper Gift Box For Wedding Party Favor Packaging
Heart Shaped Laser Cut Candy Box With Ribbon LOVE Hollow Design Pearl Paper Gift Box For Wedding Party Favor Packaging
like
Find Similar
Detail of white laser-cut wedding favor box featuring IN LOVE hollow heart pattern - White
Golden laser cut LOVE heart wedding favor box with matching ribbon for sweets and gifts - Reflective Gold
Detail of silver laser-cut heart candy box with LOVE lettering and white silk ribbon - Reflective Silver
Top view of pink heart-shaped paper gift box with laser-cut IN LOVE design and ribbon - Pink
+4
Heart Shaped Laser Cut Candy Box With Ribbon LOVE Hollow Design Pearl Paper Gift Box For Wedding Party Favor Packaging
$0.14
Mix MOQ : 50
Laser Cut Flower Candy Box European Wedding Party Favor Gift Box With Ribbon Pearlescent Paper Hollow Chocolate Packaging Case
Laser Cut Flower Candy Box European Wedding Party Favor Gift Box With Ribbon Pearlescent Paper Hollow Chocolate Packaging Case
like
Find Similar
Elegant white laser-cut wedding favor box with floral patterns and a sheer ribbon bow - White
Ivory laser-cut wedding favor box with intricate floral patterns and ribbon bow - Ivory
Detailed macro view of laser-cut pink wedding favor box with a satin ribbon and floral patterns - Pink
Detail of teal laser-cut candy box featuring hollow floral patterns and a sheer ribbon bow - Tiffany Blue
+6
Laser Cut Flower Candy Box European Wedding Party Favor Gift Box With Ribbon Pearlescent Paper Hollow Chocolate Packaging Case
$0.13
Mix MOQ : 50
Music Theme Laser Cut Favor Boxes Pearlescent Paper Gift Candy Box With Ribbon For Wedding Birthday Party Decorations
Music Theme Laser Cut Favor Boxes Pearlescent Paper Gift Candy Box With Ribbon For Wedding Birthday Party Decorations
like
Find Similar
Elegant red laser-cut birdcage wedding favor box with a delicate sheer ribbon bow. - 5*5*8CM / Red
Close-up detail of an elegant laser-cut bird favor box with a delicate white ribbon - 5*5*8CM / Ivory
Elegant pink laser-cut bird cage candy box with ribbon for romantic wedding party favors - 5*5*8CM / Pink
Flat-lay view of golden laser-cut wedding favor box with romantic bird cage patterns - 5*5*8CM / Yellow-Green
+3
Music Theme Laser Cut Favor Boxes Pearlescent Paper Gift Candy Box With Ribbon For Wedding Birthday Party Decorations
$0.12
Mix MOQ : 25
 · 
360 sold recently
Laser Cut Heart Shaped Candy Box With Ribbon Pearlescent Paper Hollow Gift Box For Wedding Party Valentine's Day Favor
Laser Cut Heart Shaped Candy Box With Ribbon Pearlescent Paper Hollow Gift Box For Wedding Party Valentine's Day Favor
like
Find Similar
Macro view of white heart-shaped laser-cut wedding favor box with organza ribbon - White
Laser-cut pink heart favor box with intricate floral patterns and soft ribbon detail - Pink
Macro shot of light blue heart-shaped laser-cut gift box with satin ribbon and chocolate - Light Blue
Golden laser-cut heart candy box with ribbon and floral patterns for Valentine's Day - Gold
+3
Laser Cut Heart Shaped Candy Box With Ribbon Pearlescent Paper Hollow Gift Box For Wedding Party Valentine's Day Favor
$0.14
Mix MOQ : 50
Laser Cut Christmas Tree Snowflake Candy Boxes Hollow Out Pearlescent Paper Wedding Gift Boxes With Ribbon Party Favor Packaging
Laser Cut Christmas Tree Snowflake Candy Boxes Hollow Out Pearlescent Paper Wedding Gift Boxes With Ribbon Party Favor Packaging
like
Find Similar
Elegant white laser-cut Christmas favor box with snowflake and tree patterns and silk ribbon - White
Laser Cut Christmas Tree Snowflake Candy Boxes Hollow Out Pearlescent Paper Wedding Gift Boxes With Ribbon Party Favor Packaging
-7%
$0.12
Mix MOQ : 50
Elegant Laser Cut Hollow Candy Box With Ribbon Bow Floral Pattern Pearl Paper Gift Box For Wedding Party Favor Decoration
Elegant Laser Cut Hollow Candy Box With Ribbon Bow Floral Pattern Pearl Paper Gift Box For Wedding Party Favor Decoration
like
Find Similar
Elegant white laser-cut festive candy gift box with floral patterns and a ribbon bow - White
Elegant white laser-cut floral gift box with white satin ribbon and intricate pattern - Ivory
Pink laser-cut favor box with delicate floral patterns and a matching satin ribbon bow - Pink
Bright yellow laser-cut candy gift box with elegant floral patterns and ribbon - Gold
+6
Elegant Laser Cut Hollow Candy Box With Ribbon Bow Floral Pattern Pearl Paper Gift Box For Wedding Party Favor Decoration
$0.13
Mix MOQ : 50
European Style Crown Laser Cut Hollow Wedding Favor Candy Box With Ribbon Paper Gift Packaging Party Decoration Favor Box
European Style Crown Laser Cut Hollow Wedding Favor Candy Box With Ribbon Paper Gift Packaging Party Decoration Favor Box
like
Find Similar
Intricate laser-cut patterns on a white gift box with elegant organza ribbon bow - White
Close-up of laser-cut white favor box with intricate hollow patterns and silk ribbon bow - Ivory
Pink laser-cut crown favor box with white ribbon for wedding candy and small gifts - Pink
Macro shot of gold hollow-out candy box with pearlescent texture and organza ribbon bow - Gold
+6
European Style Crown Laser Cut Hollow Wedding Favor Candy Box With Ribbon Paper Gift Packaging Party Decoration Favor Box
$0.13
Mix MOQ : 50
Glitter Laser Cut Hollow Princess Girl Shape Favor Gift Box With Ribbon For Wedding Party Birthday Candy Packaging
Glitter Laser Cut Hollow Princess Girl Shape Favor Gift Box With Ribbon For Wedding Party Birthday Candy Packaging
like
Find Similar
Sparkly red princess dress favor box with laser cut hollow details and pink ribbon - Glitter Red
Golden glitter princess gown favor box with laser-cut rose hollow pattern and silk bow - Glitter Rose Gold
Elegant laser-cut silver glitter wedding favor box featuring a princess silhouette - Silver Glitter
Pink glitter princess dress gift box with laser-cut rose patterns and purple ribbon bow - Glitter Pink with Dark Purple Ribbon
+11
Glitter Laser Cut Hollow Princess Girl Shape Favor Gift Box With Ribbon For Wedding Party Birthday Candy Packaging
$0.18
Mix MOQ : 50
Laser Cut Hollow Wedding Favor Candy Box European Style Square Paper Gift Box For Wedding Party Chocolate Treats Packaging
Laser Cut Hollow Wedding Favor Candy Box European Style Square Paper Gift Box For Wedding Party Chocolate Treats Packaging
like
Find Similar
Laser-cut hollow gift box in black and gold finish for weddings and party favors - Black+Gold
Laser cut hollow wedding candy box with white floral pattern and gold inner liner - White + Gold
Elegant laser-cut floral favor box in pink and gold finish for weddings and parties - Pink & Gold
Navy blue and gold laser cut floral wedding favor box for candy and gifts - Blue + Gold
+2
Laser Cut Hollow Wedding Favor Candy Box European Style Square Paper Gift Box For Wedding Party Chocolate Treats Packaging
$0.21
Mix MOQ : 50
Laser Cut Wedding Favor Boxes Hollow Bride And Groom Silhouette Candy Box Pearl Paper Gift Box With Ribbon For Marriage Party
Laser Cut Wedding Favor Boxes Hollow Bride And Groom Silhouette Candy Box Pearl Paper Gift Box With Ribbon For Marriage Party
like
Find Similar
Detailed laser-cut white wedding favor box with bride and groom silhouette and ribbon - White
Detailed laser-cut wedding favor box with bride and groom silhouette and white ribbon bow - Starry White
Macro view of laser-cut wedding favor box featuring bride and groom silhouette detail - Jewelry Cream Star
Close-up of pink laser-cut wedding favor box with ribbon detail on a white ceramic plate - Pink
+6
Laser Cut Wedding Favor Boxes Hollow Bride And Groom Silhouette Candy Box Pearl Paper Gift Box With Ribbon For Marriage Party
$0.13
No MOQ
Christmas Cookie Gift Boxes With Clear PVC Window Square White Cardboard Candy Containers For Holiday Party Favors
Christmas Cookie Gift Boxes With Clear PVC Window Square White Cardboard Candy Containers For Holiday Party Favors
like
Find Similar
Set of four Christmas window candy boxes featuring Santa and Snowman designs - Mixed Christmas Window Styles
Christmas Cookie Gift Boxes With Clear PVC Window Square White Cardboard Candy Containers For Holiday Party Favors
$4.84
Mix MOQ : 10
Heart Shape Laser Cut Hollow Rose Flower Candy Box With Ribbon Elegant Pearl Paper Gift Box Wedding Party Valentine Decor
Heart Shape Laser Cut Hollow Rose Flower Candy Box With Ribbon Elegant Pearl Paper Gift Box Wedding Party Valentine Decor
like
Find Similar
White heart-shaped laser-cut favor box with rose pattern, ribbon and gold chocolate - White
Pink heart-shaped laser-cut candy box with rose patterns and matching ribbon - Pink
Tiffany blue heart gift box with laser-cut roses and ribbon for wedding candy - Tiffany Blue
Elegant purple heart-shaped laser cut wedding favor box with a satin ribbon bow - Dark Purple
+6
Heart Shape Laser Cut Hollow Rose Flower Candy Box With Ribbon Elegant Pearl Paper Gift Box Wedding Party Valentine Decor
$0.13
Mix MOQ : 59
Laser Cut Hollow Rose Flower Candy Box Reflective Paper Wedding Favor Gift Boxes With Satin Ribbon For Valentine Party Decor
Laser Cut Hollow Rose Flower Candy Box Reflective Paper Wedding Favor Gift Boxes With Satin Ribbon For Valentine Party Decor
like
Find Similar
Golden laser-cut hollow rose wedding candy box with elegant ribbon bow decoration - Double Sided Reflective Gold
Elegant laser-cut silver wedding favor box with rose patterns and white ribbon bow - Double-Sided Reflective Silver
Holographic laser-cut wedding favor box with rose patterns and white satin ribbon bow - Laser Silver
Deep blue laser-cut hollow rose gift box with matching sheer organza ribbon - Reflective Dark Blue
+3
Laser Cut Hollow Rose Flower Candy Box Reflective Paper Wedding Favor Gift Boxes With Satin Ribbon For Valentine Party Decor
$0.17
Mix MOQ : 50
Heart Shaped Hollow Love Laser Cut Candy Box Floral Pearlescent Paper Gift Box With Ribbon For Wedding Valentine Day
Heart Shaped Hollow Love Laser Cut Candy Box Floral Pearlescent Paper Gift Box With Ribbon For Wedding Valentine Day
like
Find Similar
White heart-shaped laser cut wedding favor box with Love text and ribbon on wood - White
Pink heart-shaped laser-cut LOVE candy box with white ribbon for wedding gifts - Pink
Hollow heart-shaped gold wedding favor box with LOVE lettering and silk ribbon detail - Gold
Elegant white laser-cut LOVE candy box with delicate floral patterns and ribbon - Ivory
+6
Heart Shaped Hollow Love Laser Cut Candy Box Floral Pearlescent Paper Gift Box With Ribbon For Wedding Valentine Day
$0.14
Mix MOQ : 50
Laser Cut Hollow Wedding Candy Boxes Pearl Paper Floral Favor Gift Box For Chocolate Party Decorations Banquet Supplies
Laser Cut Hollow Wedding Candy Boxes Pearl Paper Floral Favor Gift Box For Chocolate Party Decorations Banquet Supplies
like
Find Similar
Elegant hollow-out golden rectangular gift box for wedding candy and chocolate packaging - Reflective Gold
Elegant hollow-out silver laser cut wedding favor candy box with European scroll pattern - Reflective Silver
Hollow laser-cut white wedding candy box with elegant gold lining for party favors - White
Hollow laser-cut pink wedding favor box with gold foil accents and floral pattern - Pink
+3
Laser Cut Hollow Wedding Candy Boxes Pearl Paper Floral Favor Gift Box For Chocolate Party Decorations Banquet Supplies
$0.18
Mix MOQ : 50
Laser Cut Heart Shaped Wedding Candy Box Hollow Out Flower Pearlescent Paper Gift Box With Ribbon For Valentine Party
Laser Cut Heart Shaped Wedding Candy Box Hollow Out Flower Pearlescent Paper Gift Box With Ribbon For Valentine Party
like
Find Similar
Elegant white laser-cut heart candy box with Love You text and white organza ribbon - White
Pink heart-shaped hollow favor box with I Love You laser cut design and ribbon - Pink
European gold heart laser-cut candy box with I LOVE YOU text and ribbon for weddings - Gold
Elegant white laser-cut heart wedding candy box with Love You text and ribbon - Ivory
+6
Laser Cut Heart Shaped Wedding Candy Box Hollow Out Flower Pearlescent Paper Gift Box With Ribbon For Valentine Party
$0.14
Mix MOQ : 50
It's A Girl Heart Shaped Candy Box Laser Cut Pearlescent Paper Baby Shower Favor Box With Ribbon Party Gift Packaging Box
It's A Girl Heart Shaped Candy Box Laser Cut Pearlescent Paper Baby Shower Favor Box With Ribbon Party Gift Packaging Box
like
Find Similar
Pink heart shaped favor box with 'IT'S A Girl' hollow design and ribbon for baby shower - White
Pink heart-shaped favor box with It's a Girl text and baby carriage hollow patterns - Pink
Macro shot of purple heart laser-cut favor box with IT'S A Girl text and organza ribbon - Dark Purple
Detail of teal laser-cut heart candy box with It's A Girl text and ribbon bow - Turquoise Green
+1
It's A Girl Heart Shaped Candy Box Laser Cut Pearlescent Paper Baby Shower Favor Box With Ribbon Party Gift Packaging Box
$0.13
Mix MOQ : 50
Go to

More in party supplies

Explore more in transparent gift boxes

partyplasticgoldartificialdiycakecardpetdisplaysmall
holidaystoragehomesanta clauskidsstorage boxtreesolid colorstylestar

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access