Everful

Wholesale travel bottles

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Travel Bottles

Find the perfect pieces: vacuum flasks & thermoses, tumblers, mugs and more

All products in travel bottles

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Christmas Burlap Wine Bottle Cover Santa Claus Snowman Applique Embroidery Linen Gift Bag Holiday Table Decoration Ornament
Christmas Burlap Wine Bottle Cover Santa Claus Snowman Applique Embroidery Linen Gift Bag Holiday Table Decoration Ornament
like
Find Similar
Linen Christmas wine bottle cover with Santa Claus embroidery and Merry Christmas text - Cartoon Santa Claus Style
Christmas burlap wine bottle cover featuring snowman applique and red ribbon bow - Cartoon Snowman Style
Christmas Burlap Wine Bottle Cover Santa Claus Snowman Applique Embroidery Linen Gift Bag Holiday Table Decoration Ornament
-5%
$1.64
Mix MOQ : 2
Christmas Faceless Gnome Wine Bottle Cover Xmas Dining Table Decor Faceless Old Man Champagne Bottle Bag Holiday Gift Bag Home Party Decoration
Christmas Faceless Gnome Wine Bottle Cover Xmas Dining Table Decor Faceless Old Man Champagne Bottle Bag Holiday Gift Bag Home Party Decoration
like
Find Similar
Christmas gnome wine bottle cover in grey felt with snowflake embroidery and wood buttons - G-jt142 Gray Faceless Old Man Bottle Cover
Christmas gnome wine bottle cover in red felt with snowflake embroidery and white beard - G-jt143 Red Faceless Old Man Bottle Cover
Christmas Faceless Gnome Wine Bottle Cover Xmas Dining Table Decor Faceless Old Man Champagne Bottle Bag Holiday Gift Bag Home Party Decoration
-4%
$1.59
No MOQ
Christmas Wine Bottle Covers Linen Gnome Faceless Plaid Table Decor Gift Bags Drawstring Xmas Party
Christmas Wine Bottle Covers Linen Gnome Faceless Plaid Table Decor Gift Bags Drawstring Xmas Party
like
Find Similar
Detail of Christmas gnome wine bottle cover with red plaid and Merry Christmas text - Red & Black Plaid Gnome Bottle Bag
Detail of Christmas gnome wine gift bag with drawstring and Home For The Holidays print - Black & White Plaid Gnome Bottle Bag
Christmas Wine Bottle Covers Linen Gnome Faceless Plaid Table Decor Gift Bags Drawstring Xmas Party
$0.81
No MOQ
Christmas Wine Bottle Covers Plaid Fabric Drawstring Merry Embroidery Holiday Dining Table Party Decor Novelty Bags
Christmas Wine Bottle Covers Plaid Fabric Drawstring Merry Embroidery Holiday Dining Table Party Decor Novelty Bags
like
Find Similar
Plaid Christmas wine bottle cover with Merry embroidery for festive table decoration - Red and White Plaid Wine Bottle Cover
Plaid Christmas wine bottle cover with Merry embroidery in cozy holiday festive setting - Black and White Plaid Wine Bottle Cover
Christmas Wine Bottle Covers Plaid Fabric Drawstring Merry Embroidery Holiday Dining Table Party Decor Novelty Bags
$1.73
Mix MOQ : 2
Free Shipping
Plaid Woven Drawstring Storage Pouch Portable Fabric Organizer Bag For Travel Cosmetics Sundries Minimalist Style
Plaid Woven Drawstring Storage Pouch Portable Fabric Organizer Bag For Travel Cosmetics Sundries Minimalist Style
like
Find Similar
Detail of blue and green checkered woven drawstring pouch with cotton cords on a desk - Coated Green Plaid
Detail of blue checkerboard knit drawstring pouch with woven label on flat lay background - Coated Blue Plaid
Plaid Woven Drawstring Storage Pouch Portable Fabric Organizer Bag For Travel Cosmetics Sundries Minimalist Style
-13%
$0.60
No MOQ
Poland National Emblem White Eagle Keychain Alloy Glass Cabochon Polish Flag Souvenir Key Ring For Travel Gift Bag Charm
Poland National Emblem White Eagle Keychain Alloy Glass Cabochon Polish Flag Souvenir Key Ring For Travel Gift Bag Charm
like
Find Similar
Poland emblem key ring with silver eagle and national flag on a circular pendant - Silver
Vintage bronze Poland national emblem keychain featuring a white eagle and POLAND text - Antique Bronze
Poland National Emblem White Eagle Keychain Alloy Glass Cabochon Polish Flag Souvenir Key Ring For Travel Gift Bag Charm
-9%
$0.47
No MOQ
Christmas Wine Bottle Covers Fabric Santa Snowman Reindeer Print Holiday Party Dining Table Decoration Warm Wishes
Christmas Wine Bottle Covers Fabric Santa Snowman Reindeer Print Holiday Party Dining Table Decoration Warm Wishes
like
Find Similar
3 options
Christmas Wine Bottle Covers Fabric Santa Snowman Reindeer Print Holiday Party Dining Table Decoration Warm Wishes
$0.58
No MOQ
Graduation Wine Bottle Labels Waterproof PVC Graduation Party Stickers Mortarboard Congrats Celebration Decor
Graduation Wine Bottle Labels Waterproof PVC Graduation Party Stickers Mortarboard Congrats Celebration Decor
like
Find Similar
4-pack of black and white graduation bottle labels with congrats motifs and graduation caps - Congrats She Did It Style (QT1311-1)
Set of 4 white Master's Degree graduation wine bottle labels with black text and cap - Master's Degree Congratulations Style (QT1311-2)
White graduation bottle stickers with gold tassel mortarboard and congratulatory text - Graduation Congratulations Style (QT1311-3)
Graduation Wine Bottle Labels Waterproof PVC Graduation Party Stickers Mortarboard Congrats Celebration Decor
$0.72
Mix MOQ : 2
Free Shipping
Christmas Wine Bottle Cover Santa Snowman Reindeer Striped Burlap Drawstring Gift Bag Xmas Dinner Table Party Decorations
Christmas Wine Bottle Cover Santa Snowman Reindeer Striped Burlap Drawstring Gift Bag Xmas Dinner Table Party Decorations
like
Find Similar
Red and white striped Christmas wine bottle bag with a cute 3D Santa Claus figure - Santa Claus
Christmas wine bottle cover featuring a green white striped bag and snowman embroidery - Snowman
Christmas reindeer wine bottle cover with red and white stripes and embroidery details - Elk Style
Christmas Wine Bottle Cover Santa Snowman Reindeer Striped Burlap Drawstring Gift Bag Xmas Dinner Table Party Decorations
$1.93
Mix MOQ : 2
Free Shipping
Christmas Gnome Wine Bottle Cover Festive Decoration Polyester Cloth Faceless Doll Hat Ornament For Xmas Holiday Party Table Decor
Christmas Gnome Wine Bottle Cover Festive Decoration Polyester Cloth Faceless Doll Hat Ornament For Xmas Holiday Party Table Decor
like
Find Similar
Christmas wine bottle cover with red felt gnome hat and grey faux fur beard decor - Red
Close-up of a gray Christmas gnome wine bottle topper with felt hat and faux fur beard - Gray
Detail of white felt hat and grey faux fur beard on Christmas gnome wine bottle cover - White
Christmas Gnome Wine Bottle Cover Festive Decoration Polyester Cloth Faceless Doll Hat Ornament For Xmas Holiday Party Table Decor
$0.34
Mix MOQ : 20
Christmas Wine Bottle Cover Decoration Mini Santa Hat Scarf Set Plaid Fabric Wine Bottle Ornaments For Holiday Party Table Decor
Christmas Wine Bottle Cover Decoration Mini Santa Hat Scarf Set Plaid Fabric Wine Bottle Ornaments For Holiday Party Table Decor
like
Find Similar
Christmas wine bottle decor set with red scarf and red-black checkered mini hat - Plaid Pointed Hat + Red Scarf
Christmas wine bottle decor set with red top hat and red black buffalo plaid scarf - Red Top Hat + Plaid Scarf
Christmas red and black plaid knitted mini hat and scarf set for wine bottle decor - Plaid Pointed Hat + Plaid Scarf Set
Christmas Wine Bottle Cover Decoration Mini Santa Hat Scarf Set Plaid Fabric Wine Bottle Ornaments For Holiday Party Table Decor
$1.10
Mix MOQ : 2
Free Shipping
Christmas Knitted Striped Wine Bottle Cover Santa Reindeer Snowman Pattern Festive Party Table Decor Gift Bottle Sleeve
Christmas Knitted Striped Wine Bottle Cover Santa Reindeer Snowman Pattern Festive Party Table Decor Gift Bottle Sleeve
like
Find Similar
Detail of red and white striped knitted wine bottle cover with a Santa Claus patch ornament - Santa Claus Style
Christmas knitted wine bottle cover with red white stripes and a 3D snowman patch - Snowman Style
Detail of red and white striped knitted Christmas wine bottle cover with reindeer motif - Reindeer Style
Christmas Knitted Striped Wine Bottle Cover Santa Reindeer Snowman Pattern Festive Party Table Decor Gift Bottle Sleeve
$2.07
No MOQ
Christmas Wine Bottle Cover Polyester Printed Santa Claus Snowman Reindeer Pattern Festive Holiday Party Table Decor
Christmas Wine Bottle Cover Polyester Printed Santa Claus Snowman Reindeer Pattern Festive Holiday Party Table Decor
like
Find Similar
Christmas wine bottle cover with Santa Claus print and golden ribbon on festive red fabric - Santa Claus
Christmas wine bottle cover featuring snowman design on blue snowflake gradient background - Snowman
Christmas wine bottle cover with reindeer and snow landscape print and gold ribbon tie - Elk
Christmas Wine Bottle Cover Polyester Printed Santa Claus Snowman Reindeer Pattern Festive Holiday Party Table Decor
$0.52
Mix MOQ : 2
Waterproof PVC Vinyl DIY Decorative Stickers Graffiti Decals For Scrapbooking Laptop Water Bottle Phone Case Kids Adults
Waterproof PVC Vinyl DIY Decorative Stickers Graffiti Decals For Scrapbooking Laptop Water Bottle Phone Case Kids Adults
like
Find Similar
Detailed view of various cute cartoon bird stickers with vibrant colors and white edges - Cartoon Birds Theme (T01041116)
Waterproof vinyl Y2K vaporwave stickers with retro computer and fashion girl patterns - T01041098
Waterproof PVC Vinyl DIY Decorative Stickers Graffiti Decals For Scrapbooking Laptop Water Bottle Phone Case Kids Adults
$0.29
Mix MOQ : 10
Christmas Wine Bottle Cover Red Fabric Champagne Bottle Sleeve Cartoon Santa Snowman Printed Xmas Dining Table Decorations
Christmas Wine Bottle Cover Red Fabric Champagne Bottle Sleeve Cartoon Santa Snowman Printed Xmas Dining Table Decorations
like
Find Similar
Red Christmas wine gift bag with Santa illustration and elegant gold ribbon drawstring - 3-Character Print (G-JT133)
Red Christmas wine bottle cover with Santa claus pattern and gold ribbon drawstring - 4-Character Print (G-JT134)
Christmas Wine Bottle Cover Red Fabric Champagne Bottle Sleeve Cartoon Santa Snowman Printed Xmas Dining Table Decorations
-5%
$0.52
No MOQ
Romantic Heart Valentine Stickers For Wedding Gift Decoration Love Couple Rose Cupid Waterproof Vinyl Decal For Laptop Water Bottle Helmet
Romantic Heart Valentine Stickers For Wedding Gift Decoration Love Couple Rose Cupid Waterproof Vinyl Decal For Laptop Water Bottle Helmet
like
Find Similar
50pcs romantic Valentine's Day stickers with hearts, cupid, and roses for gift decoration - Valentine's Day Series (T01042210)
Romantic Heart Valentine Stickers For Wedding Gift Decoration Love Couple Rose Cupid Waterproof Vinyl Decal For Laptop Water Bottle Helmet
$0.86
Mix MOQ : 2
Realistic Forest Animal Stickers Waterproof Circular Vinyl Decals For Laptop Water Bottle Scrapbooking Notebook Decor Kids Gift
Realistic Forest Animal Stickers Waterproof Circular Vinyl Decals For Laptop Water Bottle Scrapbooking Notebook Decor Kids Gift
like
Find Similar
Close-up of 50 waterproof animal stickers with realistic forest wildlife illustrations - Realistic Forest Animal Collection (T01042590)
Realistic Forest Animal Stickers Waterproof Circular Vinyl Decals For Laptop Water Bottle Scrapbooking Notebook Decor Kids Gift
$0.86
Mix MOQ : 5
Christmas Wine Bottle Cover Faux Fur Collar Plaid Herringbone Decor With Wooden Buttons For Holiday Dinner Party Decoration
Christmas Wine Bottle Cover Faux Fur Collar Plaid Herringbone Decor With Wooden Buttons For Holiday Dinner Party Decoration
like
Find Similar
Christmas wine bottle cover featuring red and green plaid fabric with brown faux fur collar - Big Pom Pom Red Plaid Style (G-JT101)
Brown herringbone wine bottle cover with faux fur collar and decorative wood buttons - Coarse Hemp Rope Gray Style (G-JT102)
NewChristmas Wine Bottle Cover Faux Fur Collar Plaid Herringbone Decor With Wooden Buttons For Holiday Dinner Party Decoration
$1.33
Mix MOQ : 10
Halloween Wine Bottle Cover Plaid Cloth With Faux Fur Wood Button Hemp Rope Decoration Pumpkin Bat Wine Bottle Bag For Party Decor
Halloween Wine Bottle Cover Plaid Cloth With Faux Fur Wood Button Hemp Rope Decoration Pumpkin Bat Wine Bottle Bag For Party Decor
like
Find Similar
Halloween wine bottle cover with yellow plaid pattern and bat charm, 18x13cm size - Yellow Plaid Style
Green plaid Halloween wine bottle cover with faux fur collar and pumpkin badge decor - Green Plaid Style
Halloween Wine Bottle Cover Plaid Cloth With Faux Fur Wood Button Hemp Rope Decoration Pumpkin Bat Wine Bottle Bag For Party Decor
$1.30
Mix MOQ : 2
Christmas Wine Bottle Covers Knitted Fabric Santa Elf Design With Bells And Belt Buckle For Holiday Table Decoration
Christmas Wine Bottle Covers Knitted Fabric Santa Elf Design With Bells And Belt Buckle For Holiday Table Decoration
like
Find Similar
Close-up of a Santa-themed knitted wine bottle cover with a black belt and gold buckle - Santa Claus Belt Style (G-JT37)
Detail of knitted Christmas wine bottle cover with belt and bells in a festive setting - Red and Green Striped Elf Style (G-JT38)
Christmas Wine Bottle Covers Knitted Fabric Santa Elf Design With Bells And Belt Buckle For Holiday Table Decoration
-5%
$1.86
No MOQ
Free Shipping
Christmas Wine Bottle Cover Knitted Santa Snowman Pattern Festive Dinner Party Table Decor Holiday Gift Sleeve
Christmas Wine Bottle Cover Knitted Santa Snowman Pattern Festive Dinner Party Table Decor Holiday Gift Sleeve
like
Find Similar
Christmas snowman knitted wine bottle cover with red berry and white stripe neck detail - Snowman / White
Knitted Santa Claus wine bottle cover with red wool and white faux fur trim decor - Santa Claus / Red
Christmas Wine Bottle Cover Knitted Santa Snowman Pattern Festive Dinner Party Table Decor Holiday Gift Sleeve
$1.96
Mix MOQ : 2
Vintage Travel Theme Watercolor Stickers For Scrapbooking DIY Photo Album Decorative Adhesive World Landmarks Stickers Journaling
Vintage Travel Theme Watercolor Stickers For Scrapbooking DIY Photo Album Decorative Adhesive World Landmarks Stickers Journaling
like
Find Similar
1 option
Vintage Travel Theme Watercolor Stickers For Scrapbooking DIY Photo Album Decorative Adhesive World Landmarks Stickers Journaling
$0.61
No MOQ
Magic Forest Animal Cartoon Stickers Watercolor Fairytale World Decorative Decals For Water Bottle Guitar Notebook Scrapbook
Magic Forest Animal Cartoon Stickers Watercolor Fairytale World Decorative Decals For Water Bottle Guitar Notebook Scrapbook
like
Find Similar
56Pcs watercolor magic forest animal stickers for kids scrapbook and water bottle decor - Magic Forest Animal Collection (T01042805)
Magic Forest Animal Cartoon Stickers Watercolor Fairytale World Decorative Decals For Water Bottle Guitar Notebook Scrapbook
$0.86
Mix MOQ : 2
Waterproof Fishing Stickers For Laptop Luggage Water Bottle Outdoor Graffiti Decals For Fishing Enthusiasts PVC Decoration
Waterproof Fishing Stickers For Laptop Luggage Water Bottle Outdoor Graffiti Decals For Fishing Enthusiasts PVC Decoration
like
Find Similar
50-piece outdoor fishing graffiti stickers set for luggage and laptop decoration - Outdoor Fishing Graffiti Series
Waterproof Fishing Stickers For Laptop Luggage Water Bottle Outdoor Graffiti Decals For Fishing Enthusiasts PVC Decoration
$1.29
No MOQ
Creative Light Bulb Illustration Stickers Waterproof PVC Decorative Decals For Laptop Phone Journal Water Bottle Art Crafts
Creative Light Bulb Illustration Stickers Waterproof PVC Decorative Decals For Laptop Phone Journal Water Bottle Art Crafts
like
Find Similar
50pcs creative light bulb cartoon art stickers for DIY laptop and phone decoration - Creative Light Bulb World Cartoon Stickers
Creative Light Bulb Illustration Stickers Waterproof PVC Decorative Decals For Laptop Phone Journal Water Bottle Art Crafts
$0.95
No MOQ
Christmas Wine Bottle Covers Santa Claus And Snowman Design For Xmas Party Dining Table Decor Festive Fabric Ornaments
Christmas Wine Bottle Covers Santa Claus And Snowman Design For Xmas Party Dining Table Decor Festive Fabric Ornaments
like
Find Similar
Santa Claus wine bottle cover for Christmas party decor with red velvet and belt details - Santa Claus Wine Bottle Cover (CF180408)
Christmas snowman wine bottle cover with red sequin hat and green scarf decor - Snowman Wine Bottle Cover (CF180408)
Christmas Wine Bottle Covers Santa Claus And Snowman Design For Xmas Party Dining Table Decor Festive Fabric Ornaments
$2.88
Mix MOQ : 2
Free Shipping
Cute Rabbit Canvas Drawstring Bag Portable Storage Pouch For Travel Toiletries Makeup Stationery Organizer
Cute Rabbit Canvas Drawstring Bag Portable Storage Pouch For Travel Toiletries Makeup Stationery Organizer
like
Find Similar
Cute bunny lover canvas drawstring storage bag for travel and cosmetics organizing - Blue Pink
White canvas drawstring bag with cute rabbit print and brown cotton ropes on lace table - Antique Silver
Cute Rabbit Canvas Drawstring Bag Portable Storage Pouch For Travel Toiletries Makeup Stationery Organizer
-4%
$1.37
No MOQ
Portable Sanitary Napkin Storage Bag Plush Corduroy Pouch Small Travel Zipper Organizer Minimalist Square Cosmetic Bag
Portable Sanitary Napkin Storage Bag Plush Corduroy Pouch Small Travel Zipper Organizer Minimalist Square Cosmetic Bag
like
Find Similar
Detail of red plush storage pouch with pearl bow pendant and SOZAKKA logo tag - Sherpa / Plush Style (With Pearl Pendant) / Christmas Red
Detail of red corduroy storage pouch featuring a white label and faux pearl bow charm - Corduroy / Corduroy Style (With Pearl Pendant) / Corduroy Red
Portable Sanitary Napkin Storage Bag Plush Corduroy Pouch Small Travel Zipper Organizer Minimalist Square Cosmetic Bag
-5%
$1.89
No MOQ
Christmas Wine Bottle Cover Plaid Burlap Clothing Style Holiday Party Table Decor Nordic Festive Ornament
Christmas Wine Bottle Cover Plaid Burlap Clothing Style Holiday Party Table Decor Nordic Festive Ornament
like
Find Similar
Linen Christmas wine bottle cover with black and white plaid design and small bell - Black and White Grid Burlap Wine Bottle Cover
Christmas Wine Bottle Cover Plaid Burlap Clothing Style Holiday Party Table Decor Nordic Festive Ornament
$1.41
No MOQ
Knitted Christmas Wine Bottle Cover Santa Reindeer Snowflake Pattern With Pompom Drawstring Decoration Holiday Party Dinner Table Ornament
Knitted Christmas Wine Bottle Cover Santa Reindeer Snowflake Pattern With Pompom Drawstring Decoration Holiday Party Dinner Table Ornament
like
Find Similar
Christmas reindeer and snowflake knit wine bottle cover with red pom-poms and drawstring - Red Reindeer
Knitted Christmas wine bottle cover with snowflakes and white pompoms on red and green - Green
Knitted Santa suit wine bottle cover with red fabric and white pom-pom detail - Red Santa Claus Style
Knitted Christmas Wine Bottle Cover Santa Reindeer Snowflake Pattern With Pompom Drawstring Decoration Holiday Party Dinner Table Ornament
$1.73
Mix MOQ : 2
Knitted Christmas Wine Bottle Covers Santa Claus Snowman Reindeer Patterns Polyester Festive Table Party Decoration Bottle Decor
Knitted Christmas Wine Bottle Covers Santa Claus Snowman Reindeer Patterns Polyester Festive Table Party Decoration Bottle Decor
like
Find Similar
Knitted snowman wine bottle cover with red nose and holly leaf decoration - Snowman
Festive knitted reindeer wine bottle cover with 3D nose and antlers for Christmas decor - Elk
Knitted Santa Claus wine bottle cover with red hat and white beard for Christmas decor - Santa Claus
Knitted Christmas Wine Bottle Covers Santa Claus Snowman Reindeer Patterns Polyester Festive Table Party Decoration Bottle Decor
$1.50
Mix MOQ : 3
Christmas Wine Bottle Cover Knitted Woolen Yarn Santa Claus Snowman Reindeer Bottle Decoration Festive Table Decor Gift
Christmas Wine Bottle Cover Knitted Woolen Yarn Santa Claus Snowman Reindeer Bottle Decoration Festive Table Decor Gift
like
Find Similar
3 options
Christmas Wine Bottle Cover Knitted Woolen Yarn Santa Claus Snowman Reindeer Bottle Decoration Festive Table Decor Gift
$1.67
Mix MOQ : 2
Christmas Gnome Wine Bottle Cover Fabric Faceless Old Man Holiday Dining Table Decoration Hat And Bottle Sleeve Gift
Christmas Gnome Wine Bottle Cover Fabric Faceless Old Man Holiday Dining Table Decoration Hat And Bottle Sleeve Gift
like
Find Similar
Christmas gnome wine bottle cover with red tall hat and white beard for holiday decor - Red
Christmas gnome wine bottle cover with grey felt hat and white beard on festive background - Gray
Detail of Christmas gnome wine bottle cover featuring green felt fabric and wooden buttons - Green
Christmas Gnome Wine Bottle Cover Fabric Faceless Old Man Holiday Dining Table Decoration Hat And Bottle Sleeve Gift
$2.16
Mix MOQ : 10
Christmas Wine Bottle Covers Stripe Plaid Dress Design With Faux Fur Collar Wood Buttons Festive Dinner Table Decor Xmas Gift
Christmas Wine Bottle Covers Stripe Plaid Dress Design With Faux Fur Collar Wood Buttons Festive Dinner Table Decor Xmas Gift
like
Find Similar
Brown herringbone wine bottle cover with faux fur collar and decorative wooden buttons - Stripe Style
Christmas wine bottle cover featuring red and green plaid dress with brown faux fur collar - Grid Style
NewChristmas Wine Bottle Covers Stripe Plaid Dress Design With Faux Fur Collar Wood Buttons Festive Dinner Table Decor Xmas Gift
$1.21
No MOQ
Christmas Gnome Wine Bottle Cover Buffalo Plaid Faceless Doll Gift Bag For Holiday Dining Table Party Decoration
Christmas Gnome Wine Bottle Cover Buffalo Plaid Faceless Doll Gift Bag For Holiday Dining Table Party Decoration
like
Find Similar
Christmas gnome wine bottle cover with red buffalo plaid hat and white faux fur beard - Black and Red Plaid
Christmas gnome wine bottle cover with black and white plaid hat and white faux fur beard - Black and White Plaid
Christmas Gnome Wine Bottle Cover Buffalo Plaid Faceless Doll Gift Bag For Holiday Dining Table Party Decoration
$1.33
Mix MOQ : 2
Free Shipping
Christmas Wine Bottle Cover Santa Claus Climbing Chimney Burlap Bag Red Black Plaid Drawstring Festive Party Table Decoration
Christmas Wine Bottle Cover Santa Claus Climbing Chimney Burlap Bag Red Black Plaid Drawstring Festive Party Table Decoration
like
Find Similar
Christmas burlap wine bottle bag with red black plaid and Santa stops here print - Red And Black Plaid Wine Set
Santa Claus chimney burlap wine bottle bag with black plaid trim and red silk ribbon - Black And White Plaid Wine Set
Christmas Wine Bottle Cover Santa Claus Climbing Chimney Burlap Bag Red Black Plaid Drawstring Festive Party Table Decoration
$1.59
Mix MOQ : 2
Christmas Wine Bottle Cover Linen Plaid Cloth Bags With Snowflake Decor Drawstring Gift Bags For Xmas Table Party Decor
Christmas Wine Bottle Cover Linen Plaid Cloth Bags With Snowflake Decor Drawstring Gift Bags For Xmas Table Party Decor
like
Find Similar
Christmas burlap wine bottle cover with red black buffalo plaid and snowflake decor - Plaid Style
Christmas burlap wine bottle cover with red plaid pattern and snowflake decorations - Burlap Style
NewChristmas Wine Bottle Cover Linen Plaid Cloth Bags With Snowflake Decor Drawstring Gift Bags For Xmas Table Party Decor
-5%
$0.75
No MOQ
Kawaii Cartoon Food Stickers Waterproof Vinyl Decals For Laptop Suitcase Water Bottle Scrapbooking DIY Stickers Decoration
Kawaii Cartoon Food Stickers Waterproof Vinyl Decals For Laptop Suitcase Water Bottle Scrapbooking DIY Stickers Decoration
like
Find Similar
Cute cartoon food stickers for scrapbooking featuring snacks and drinks on white background - Food Theme (T01042042)
Kawaii Cartoon Food Stickers Waterproof Vinyl Decals For Laptop Suitcase Water Bottle Scrapbooking DIY Stickers Decoration
$0.86
Mix MOQ : 2
Christmas Wine Bottle Cover Mini Hat And Scarf Decoration Non Woven Fabric Soft Red White Party Table Home Decor Accessory
Christmas Wine Bottle Cover Mini Hat And Scarf Decoration Non Woven Fabric Soft Red White Party Table Home Decor Accessory
like
Find Similar
Miniature red felt Christmas wine bottle set including a festive hat and scarf set - Red & White
Christmas Wine Bottle Cover Mini Hat And Scarf Decoration Non Woven Fabric Soft Red White Party Table Home Decor Accessory
-4%
$0.41
No MOQ
Summer Beverage Bottle 3D Embossed Nail Stickers Cute Cartoon Cola Soda Fruit Juice DIY Nail Art Decoration YT5988
Summer Beverage Bottle 3D Embossed Nail Stickers Cute Cartoon Cola Soda Fruit Juice DIY Nail Art Decoration YT5988
like
Find Similar
Cute cartoon summer soda and juice bottle embossed nail stickers with watermelon icons - Embossed Style (YT5988)
Summer Beverage Bottle 3D Embossed Nail Stickers Cute Cartoon Cola Soda Fruit Juice DIY Nail Art Decoration YT5988
$0.72
No MOQ
Free Shipping
Gothic Aesthetic Witch Skull Potion Stickers Waterproof PVC Decals For Laptop Luggage Skateboard Water Bottle Guitar
Gothic Aesthetic Witch Skull Potion Stickers Waterproof PVC Decals For Laptop Luggage Skateboard Water Bottle Guitar
like
Find Similar
Set of 50 spooky aesthetic stickers featuring witch potions, skulls, and gothic art themes - 50 Sheets/Pack
Gothic Aesthetic Witch Skull Potion Stickers Waterproof PVC Decals For Laptop Luggage Skateboard Water Bottle Guitar
-10%
$0.86
No MOQ
Vintage National Park PVC Waterproof Vinyl Stickers Retro Nature Landscape Decals For Laptop Guitar Luggage Travel Decoration
Vintage National Park PVC Waterproof Vinyl Stickers Retro Nature Landscape Decals For Laptop Guitar Luggage Travel Decoration
like
Find Similar
50 pieces of waterproof retro National Park stickers for laptop and guitar decoration - Global National Park Badge Collection (FE260)
Close-up of vintage national park stickers featuring Blue Mountains and Glacier motifs - Vintage Travel Landscape Collection (FE261)
Vintage National Park PVC Waterproof Vinyl Stickers Retro Nature Landscape Decals For Laptop Guitar Luggage Travel Decoration
$0.84
No MOQ
Christmas Wine Bottle Cover Gnome Christmas Tree Design Knit Cloth Faux Fur Decorative Party Table Decor
Christmas Wine Bottle Cover Gnome Christmas Tree Design Knit Cloth Faux Fur Decorative Party Table Decor
like
Find Similar
Festive gnome wine bottle cover decoration on a red plaid tablecloth with tree background - Male Style (Beard Gnome)
Christmas Wine Bottle Cover Gnome Christmas Tree Design Knit Cloth Faux Fur Decorative Party Table Decor
$3.11
Mix MOQ : 2
Christmas Wine Bottle Cover Burlap Linen Drawstring Gift Bag Buffalo Check Santa Claus Chimney Holiday Party Decoration
Christmas Wine Bottle Cover Burlap Linen Drawstring Gift Bag Buffalo Check Santa Claus Chimney Holiday Party Decoration
like
Find Similar
Linen Christmas wine bottle bag with red drawstring and Santa Claus Stops Here print - Black and White Plaid Burlap Santa Climbing Chimney Style
Christmas Wine Bottle Cover Burlap Linen Drawstring Gift Bag Buffalo Check Santa Claus Chimney Holiday Party Decoration
-5%
$1.51
No MOQ
Christmas Gnome Wine Bottle Covers Knitted Faceless Doll Tomte Swedish Holiday Table Decor Long Beard Handmade Party Gift
Christmas Gnome Wine Bottle Covers Knitted Faceless Doll Tomte Swedish Holiday Table Decor Long Beard Handmade Party Gift
like
Find Similar
Christmas gnome wine bottle cover in gray and red striped knit hat with long brown beard - Knitted Style A (Red Gray Striped Hat)
Christmas Gnome Wine Bottle Covers Knitted Faceless Doll Tomte Swedish Holiday Table Decor Long Beard Handmade Party Gift
-5%
$1.42
No MOQ
Christmas Mini Wine Bottle Decoration Non-woven Fabric Hat And Scarf For Festive Dining Party Table Decor
Christmas Mini Wine Bottle Decoration Non-woven Fabric Hat And Scarf For Festive Dining Party Table Decor
like
Find Similar
Christmas mini wine bottle hat and scarf set for festive holiday home dinner table decor - Red Scarf Wine Set (Hat + Scarf) / Red/White
Christmas Mini Wine Bottle Decoration Non-woven Fabric Hat And Scarf For Festive Dining Party Table Decor
$0.52
No MOQ
Christmas Stickers PVC Waterproof Cartoon Holiday Decoration Decals For Laptop Water Bottle Luggage Phone Scrapbooking
Christmas Stickers PVC Waterproof Cartoon Holiday Decoration Decals For Laptop Water Bottle Luggage Phone Scrapbooking
like
Find Similar
50pcs waterproof Christmas cartoon stickers with Santa Claus and Reindeer patterns - 50PCS Christmas Set H-1312
Christmas Stickers PVC Waterproof Cartoon Holiday Decoration Decals For Laptop Water Bottle Luggage Phone Scrapbooking
-10%
$0.88
No MOQ
 · 
15 views
Christmas Wine Bottle Cover Set Handmade Fabric Santa Claus Snowman Reindeer Pattern Miniature Sweater And Hat For Holiday Party Table Decoration Xmas Gift
Christmas Wine Bottle Cover Set Handmade Fabric Santa Claus Snowman Reindeer Pattern Miniature Sweater And Hat For Holiday Party Table Decoration Xmas Gift
like
Find Similar
3 options
Christmas Wine Bottle Cover Set Handmade Fabric Santa Claus Snowman Reindeer Pattern Miniature Sweater And Hat For Holiday Party Table Decoration Xmas Gift
-4%
$1.37
No MOQ
Vintage Travel Postage Stamp Stickers Waterproof PVC Vinyl Decals For Luggage Laptop Guitar Aesthetic DIY Scrapbooking Decoration Set
Vintage Travel Postage Stamp Stickers Waterproof PVC Vinyl Decals For Luggage Laptop Guitar Aesthetic DIY Scrapbooking Decoration Set
like
Find Similar
50pcs vintage travel stamp graffiti stickers for luggage and guitar decoration - Vintage Travel Postage Stamp Sticker Set
Vintage Travel Postage Stamp Stickers Waterproof PVC Vinyl Decals For Luggage Laptop Guitar Aesthetic DIY Scrapbooking Decoration Set
$1.24
No MOQ
France Travel Theme Stickers Waterproof PVC Decals For Suitcase Laptop Phone Scrapbooking Paris Eiffel Tower Art
France Travel Theme Stickers Waterproof PVC Decals For Suitcase Laptop Phone Scrapbooking Paris Eiffel Tower Art
like
Find Similar
50pcs waterproof French themed stickers featuring Eiffel Tower and Paris travel elements - France Travel Theme
France Travel Theme Stickers Waterproof PVC Decals For Suitcase Laptop Phone Scrapbooking Paris Eiffel Tower Art
$0.96
No MOQ
American Football Players Stickers Waterproof PVC Cartoon Graffiti Athletic Sports Decals For Laptop Water Bottle Decor
American Football Players Stickers Waterproof PVC Cartoon Graffiti Athletic Sports Decals For Laptop Water Bottle Decor
like
Find Similar
Pack of 50 colorful American football stickers for water bottles and laptop decoration - Football Graffiti Style
NewAmerican Football Players Stickers Waterproof PVC Cartoon Graffiti Athletic Sports Decals For Laptop Water Bottle Decor
$0.95
Mix MOQ : 2
Baby Theme Spring Press Cookie Cutters Plastic Fondant Cake Molds Baby Bottle Rocking Horse Carriage Onesie Shape Baking Tools
Baby Theme Spring Press Cookie Cutters Plastic Fondant Cake Molds Baby Bottle Rocking Horse Carriage Onesie Shape Baking Tools
like
Find Similar
Baby-themed 4-piece plastic cookie mold set featuring baby bottle horse and stroller - Baby Theme Style
Baby Theme Spring Press Cookie Cutters Plastic Fondant Cake Molds Baby Bottle Rocking Horse Carriage Onesie Shape Baking Tools
$1.12
No MOQ
Cartoon Hamster Graffiti Stickers Waterproof PVC Matte Decals For Laptop Suitcase Water Bottle DIY Cute Animal Decorations
Cartoon Hamster Graffiti Stickers Waterproof PVC Matte Decals For Laptop Suitcase Water Bottle DIY Cute Animal Decorations
like
Find Similar
50 pieces of cute cartoon hamster stickers for laptop and luggage waterproof decoration - Hamster Pattern
Cartoon Hamster Graffiti Stickers Waterproof PVC Matte Decals For Laptop Suitcase Water Bottle DIY Cute Animal Decorations
$1.13
No MOQ
Funny Cursed Emojis Stickers PVC Waterproof Cartoon Yellow Face Decals For Laptop Water Bottle Phone Case Scrapbooking Decor
Funny Cursed Emojis Stickers PVC Waterproof Cartoon Yellow Face Decals For Laptop Water Bottle Phone Case Scrapbooking Decor
like
Find Similar
Set of 60 waterproof yellow emoji stickers with funny cursed expressions for laptops - Emoji Collection
Funny Cursed Emojis Stickers PVC Waterproof Cartoon Yellow Face Decals For Laptop Water Bottle Phone Case Scrapbooking Decor
$0.95
No MOQ
Waterproof PVC Cartoon Stickers Cute Kawaii Stationery Decals For Laptop Water Bottle Journal Scrapbooking DIY Decorative Stickers
Waterproof PVC Cartoon Stickers Cute Kawaii Stationery Decals For Laptop Water Bottle Journal Scrapbooking DIY Decorative Stickers
like
Find Similar
50 pieces of cute cartoon stickers set with sun, house, and floral kawaii patterns - Q Version Assorted (OPQ021)
Waterproof PVC Cartoon Stickers Cute Kawaii Stationery Decals For Laptop Water Bottle Journal Scrapbooking DIY Decorative Stickers
$0.96
No MOQ
Vintage Japanese Stamp Stickers PVC Waterproof Decals Retro Travel Scrapbooking Material For Suitcase Laptop Diary Journal
Vintage Japanese Stamp Stickers PVC Waterproof Decals Retro Travel Scrapbooking Material For Suitcase Laptop Diary Journal
like
Find Similar
Set of 50 vintage travel stamp stickers featuring retro animals and floral art designs - Vintage Stamp Sticker Set
Vintage Japanese Stamp Stickers PVC Waterproof Decals Retro Travel Scrapbooking Material For Suitcase Laptop Diary Journal
$0.96
No MOQ
Gnome Christmas Wine Bottle Covers Red Reindeer Antler Green Christmas Tree Black Top Hat Festive Table Decorations
Gnome Christmas Wine Bottle Covers Red Reindeer Antler Green Christmas Tree Black Top Hat Festive Table Decorations
like
Find Similar
Christmas gnome wine bottle cover with black top hat and long white faux fur beard - Black Top Hat Style / 25.4cm / Black
Christmas gnome wine bottle cover with red hat, reindeer antlers and small golden bells - Red Antlers Style / 30.4cm / Red
Gnome Christmas Wine Bottle Covers Red Reindeer Antler Green Christmas Tree Black Top Hat Festive Table Decorations
$1.30
Mix MOQ : 2
Free Shipping
Christmas Knitted Wine Bottle Cover Santa Claus Elf Style Red Green White Stripe Bottle Decor For Party Table
Christmas Knitted Wine Bottle Cover Santa Claus Elf Style Red Green White Stripe Bottle Decor For Party Table
like
Find Similar
Knitted Santa-style Christmas wine bottle cover with red buttons and black belt detail - Red and White Santa Style
Christmas elf style knitted wine bottle cover with red green stripes and tiny bells - Red and Green Elf Style with Bells
Christmas Knitted Wine Bottle Cover Santa Claus Elf Style Red Green White Stripe Bottle Decor For Party Table
$1.64
No MOQ
Santa Claus Wine Bottle Cover With Long Beard Knitted Hat Christmas Party Table Decoration Chef Country Nordic Style
Santa Claus Wine Bottle Cover With Long Beard Knitted Hat Christmas Party Table Decoration Chef Country Nordic Style
like
Find Similar
Christmas Santa wine bottle cover with red striped knitted hat and long white beard - Red Long Hat Santa
Santa Claus wine bottle cover with long white beard and chef hat for Christmas decor - Chef Style Santa
Santa Claus Wine Bottle Cover With Long Beard Knitted Hat Christmas Party Table Decoration Chef Country Nordic Style
$3.89
Mix MOQ : 2
Plaid Crossbody Bag Polyester Ruched Shoulder Strap Portable Water Bottle Pouch Cute Casual Handbag For Students Women
Plaid Crossbody Bag Polyester Ruched Shoulder Strap Portable Water Bottle Pouch Cute Casual Handbag For Students Women
like
Find Similar
Quilted pastel plaid water bottle bag with ruffled adjustable shoulder strap and handle - Green
Portable plaid water bottle bag with yellow ruffled cloud strap and adjustable crossbody design - Khaki
Plaid Crossbody Bag Polyester Ruched Shoulder Strap Portable Water Bottle Pouch Cute Casual Handbag For Students Women
-4%
$4.63
No MOQ
Go to

More in home & kitchen

Explore more in travel bottles

steelstrapalloysleevewallmetaldisplayshapedesignshoulder
plasticpetkidssquarewindowcare316 stainless steeladjustablegoldcover

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access