Everful

Wholesale travel bottles

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Travel Bottles

Find the perfect pieces: vacuum flasks & thermoses, tumblers, mugs and more

Popular collections in travel bottles

All products in travel bottles

filterShow filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Autumn Linen Throw Pillow Covers Farmhouse Decorative Cushion Case For Sofa Living Room Fall Harvest Home Decor
Autumn Linen Throw Pillow Covers Farmhouse Decorative Cushion Case For Sofa Living Room Fall Harvest Home Decor
like
Find Similar
Linen pillowcase with autumn watercolor pumpkin, orange, and cinnamon spice print - Pumpkin Citrus Style (YMF47-1)
Linen pillowcase with Home Sweet Home text and autumn fruit prints on white background - Home Sweet Home Style (YMF47-2)
Linen pillow cover with Happy Fall y'all text and autumn pine cone prints - Happy Fall y'all Style (YMF47-3)
Linen pillowcase with autumn botanical prints and berries for sofa decor - Harvest Bottle Floral Style (YMF47-4)
Autumn Linen Throw Pillow Covers Farmhouse Decorative Cushion Case For Sofa Living Room Fall Harvest Home Decor
$1.15
Mix MOQ : 2
Vintage Throw Pillow Covers Linen Decorative Pillowcases Mystic Moon Phase Moth Pattern For Sofa Home Decor Square
Vintage Throw Pillow Covers Linen Decorative Pillowcases Mystic Moon Phase Moth Pattern For Sofa Home Decor Square
like
Find Similar
Linen pillow cover with moth and moon child print in bohemian vintage style - Moth Moon Phase Style (YMW50-1)
Linen pillow cover with vintage hourglass design and BE HERE NOW print on white background - Vintage Hourglass Style (YMW50-2)
Linen Halloween pillow case with magic potion bottle print and You Are Made Of Magic text - Potion Bottle Style (YMW50-3)
Linen Halloween pillow cover with Mystic Moon and crystal ball astrological print - Astrology Crystal Ball Style (YMW50-4)
Vintage Throw Pillow Covers Linen Decorative Pillowcases Mystic Moon Phase Moth Pattern For Sofa Home Decor Square
$1.24
Mix MOQ : 2
Valentine's Day Placemats Romantic Heart Print Linen Polyester Heat Resistant Mats For Dining Room Restaurant Table Decoration
Valentine's Day Placemats Romantic Heart Print Linen Polyester Heat Resistant Mats For Dining Room Restaurant Table Decoration
like
Find Similar
Linen rectangle placemat with red rose heart lock and key print for Valentine table decor - Heart Lock Rose Style (VPM016-1)
Linen placemat with red surface and Hugs & Kisses print with checkered bow - Red Hugs & Kisses Style (VPM016-2)
Linen placemat with Valentine heart balloons and red roses for kitchen table decor - Rose Heart Bottle Style (VPM016-3)
Linen placemat with Home Sweet Home text and black white plaid bow for Valentine decor - Red Home Sweet Home Style (VPM016-4)
+33
Valentine's Day Placemats Romantic Heart Print Linen Polyester Heat Resistant Mats For Dining Room Restaurant Table Decoration
$0.97-3.89
Mix MOQ : 2
Independence Day Linen Throw Pillow Cover 4th Of July American Flag Stars Stripes Truck Decorative Cushion Case Sofa Home Decor
Independence Day Linen Throw Pillow Cover 4th Of July American Flag Stars Stripes Truck Decorative Cushion Case Sofa Home Decor
like
Find Similar
Detail of linen pillow cover with floral wreath and God Bless America print - God Bless America Floral (23YM9-1)
Detail of linen pillowcase featuring a watercolor floral bouquet in a blue glass vase - Blue Glass Vase Floral (23YM9-2)
Close-up of linen pillowcase with blue bicycle, flowers and American flag elements - Blue Bicycle Patriotic Illustration (23YM9-3)
Linen Independence Day pillow cover featuring LAND That I Love floral print and stars - Land That I Love Floral (23YM9-4)
+26
Independence Day Linen Throw Pillow Cover 4th Of July American Flag Stars Stripes Truck Decorative Cushion Case Sofa Home Decor
$1.15
Mix MOQ : 2
Floral Peach Skin Polyester Cushion Cover Watercolor Flower Dog Animal Art Square Pillowcase French Vintage Decor
Floral Peach Skin Polyester Cushion Cover Watercolor Flower Dog Animal Art Square Pillowcase French Vintage Decor
like
Find Similar
Close-up of floral pillowcase with pink roses and iron basket print on fabric - Standard Square / Vintage Rose Basket Style ((1)DM219)
Close-up of pink watercolor flowers and Love One Another scripture text on pillowcase - Standard Square / Pink Flower Scripture Style ((2)DM219)
Floral watercolor throw pillow case featuring vintage books and pink roses print - Standard Square / Vintage Books and Rose Style ((3)DM219)
Floral watercolor throw pillow case featuring pink roses in a blue bottle with bow - Standard Square / Blue Bottle Pink Rose Style ((4)DM219)
+13
Floral Peach Skin Polyester Cushion Cover Watercolor Flower Dog Animal Art Square Pillowcase French Vintage Decor
$1.24
Mix MOQ : 3
Butterfly Moon Mystic Mushroom Hanging Tapestry Polyester Cotton Wall Art With Wood Pole And Tassels Astrology Decor
Butterfly Moon Mystic Mushroom Hanging Tapestry Polyester Cotton Wall Art With Wood Pole And Tassels Astrology Decor
like
Find Similar
Detail of moon and mushroom tapestry with wood rod and black tassels decoration - 35x50cm / Personified Crescent Moon Mushroom (Style-1)
Detail of artistic butterfly and moon tapestry with wooden rod and black tassel accents - 35x50cm / Double Butterfly Crescent Leaves (Style-2)
Detail of mystic sun and moon tapestry with wooden rod and black bottom tassels - 35x50cm / Star Moon Glass Sphere Plants (Style-3)
Detail of wooden hanging rod and black tassels on a celestial moon bottle tapestry - 35x50cm / Star Moon Potion Bottle (Style-4)
+1
Butterfly Moon Mystic Mushroom Hanging Tapestry Polyester Cotton Wall Art With Wood Pole And Tassels Astrology Decor
$2.85
Mix MOQ : 2
Christmas Tapestry Wall Hanging Polyester Peach Skin Digital Print Festive Snowflake Tree Pattern Home Decor With Nails And Clips
Christmas Tapestry Wall Hanging Polyester Peach Skin Digital Print Festive Snowflake Tree Pattern Home Decor With Nails And Clips
like
Find Similar
Christmas tree wall tapestry with fireplace and gift boxes in modern living room - 95x73cm (With Installation Kit) / Fireplace Christmas Tree (Style-1)
Christmas tree wall tapestry with Merry Christmas text on dark wood background - 95x73cm (With Installation Kit) / Wood Texture Christmas Tree (Style-2)
Close-up of Merry Christmas reindeer tapestry with gold glitter details in a cozy living room - 95x73cm (With Installation Kit) / Golden Reindeer Red Background (Style-3)
Festive Merry Christmas tapestry with green pine branches and colorful ornaments over a sofa - 95x73cm (With Installation Kit) / Pine Branches & Balls (Style-4)
+36
Christmas Tapestry Wall Hanging Polyester Peach Skin Digital Print Festive Snowflake Tree Pattern Home Decor With Nails And Clips
$2.45-6.63
Mix MOQ : 2
Retro Wall Hanging Tapestry Polyester Peach Skin Vintage Tropical Plant Beach Print Background Decorative Aesthetic Room
Retro Wall Hanging Tapestry Polyester Peach Skin Vintage Tropical Plant Beach Print Background Decorative Aesthetic Room
like
Find Similar
Detail of vintage Paris wall tapestry featuring Eiffel Tower and retro car above sofa - 95x73cm / Paris Vintage Travel (Style 1)
Vintage Florida tapestry featuring a yellow classic car and palm trees over a sofa - 95x73cm / Florida Vintage Car (Style 2)
Detail of vintage Route 66 California wall tapestry hanging above a modern sofa - 95x73cm / California Route 66 (Style 3)
Detail of Route 66 wall tapestry with vintage yellow car and cactus in a living room - 95x73cm / New Mexico Route 66 (Style 4)
+76
Retro Wall Hanging Tapestry Polyester Peach Skin Vintage Tropical Plant Beach Print Background Decorative Aesthetic Room
$2.45-6.63
Mix MOQ : 2
Halloween Tapestry Wall Hanging Polyester Cotton Scroll Painting Monster Mouth Pumpkin Print With Tassel And Wood Pole
Halloween Tapestry Wall Hanging Polyester Cotton Scroll Painting Monster Mouth Pumpkin Print With Tassel And Wood Pole
like
Find Similar
Vertical Halloween hanging flag with bloody monster mouth print and pumpkin lantern detail - 32.5x130cm / Monster Mouth Purple Tone (Style 1)
Halloween tapestry hanging scroll with creepy monster mouth design and black tassels - 32.5x130cm / Ghost Forest Teal Tone (Style 2)
Vertical Halloween wall scroll featuring a green monster mouth and pumpkin design with tassels - 32.5x130cm / Green Monster Mouth Potion Bottle (Style 3)
Halloween Tapestry Wall Hanging Polyester Cotton Scroll Painting Monster Mouth Pumpkin Print With Tassel And Wood Pole
-5%
$3.97
Mix MOQ : 2
Nordic Tropical Coconut Tree Sunset Landscape Wall Hanging Tapestry Polyester Brushed Background Cloth For Home Decor
Nordic Tropical Coconut Tree Sunset Landscape Wall Hanging Tapestry Polyester Brushed Background Cloth For Home Decor
like
Find Similar
Nordic coconut tree tapestry with tropical sunset beach landscape on a white brick wall - 95x73 / Sunset Beach (Style 1)
Nordic wall tapestry with tropical coconut palm, sea waves and beach house design - 95x73 / Island Hut (Style 2)
Nordic wall hanging tapestry featuring tropical beach scenery with coconut trees - 95x73 / Tropical Beach (Style 3)
Tropical sunset palm tree wall tapestry in rectangular shape for home decor - 95x73 / Sunset Palm (Style 4)
+48
Nordic Tropical Coconut Tree Sunset Landscape Wall Hanging Tapestry Polyester Brushed Background Cloth For Home Decor
-4%
$2.33-6.30
Mix MOQ : 2
Elderly Couple Figurines Resin Grandpa And Grandma Statues Anniversary Wedding Gift Cake Topper Home Desktop Decor Love
Elderly Couple Figurines Resin Grandpa And Grandma Statues Anniversary Wedding Gift Cake Topper Home Desktop Decor Love
like
Find Similar
Smiling elderly couple in a blue classic car figurine with Forever license plate decor - Sweet Travel (Old Couple in Car)
Elderly Couple Figurines Resin Grandpa And Grandma Statues Anniversary Wedding Gift Cake Topper Home Desktop Decor Love
$3.69
No MOQ
Cute Cartoon Decorative Stickers Waterproof PET Transparent Self Adhesive For Journal Scrapbook DIY Planner Phone Case
Cute Cartoon Decorative Stickers Waterproof PET Transparent Self Adhesive For Journal Scrapbook DIY Planner Phone Case
like
Find Similar
Waterproof PET stickers set Institute of Deliciousness theme 4 sheets 100x150mm for scrapbooking - Yummy Lab
Travel fragments PET waterproof sticker set with four sheets of creative illustrations - Travel Fragments
Waterproof PET cartoon character sticker set with 4 sheets for journals and scrapbooking - Energy Up
Cute Creatures Fun Park PET waterproof sticker set with 4 sheets for journal scrapbooking - Cute Animal Park
Cute Cartoon Decorative Stickers Waterproof PET Transparent Self Adhesive For Journal Scrapbook DIY Planner Phone Case
-9%
$0.39
No MOQ
Cute Cartoon Animal PET Stickers Waterproof Decorative Decals For Scrapbooking Journaling Planner DIY Stationery
Cute Cartoon Animal PET Stickers Waterproof Decorative Decals For Scrapbooking Journaling Planner DIY Stationery
like
Find Similar
Waterproof PET cartoon otter sticker set Rat Adventure series for journals - Rat Adventure
Waterproof PET forest diary panda themed decorative stickers for journaling - Forest Diary
Forest Walk cartoon cat PET stickers sheet for journals with seasonal themes - Forest Walk
Simple Cat Life waterproof PET stickers with cute cartoon cat themes for journaling - Simple Cat Life
+2
Cute Cartoon Animal PET Stickers Waterproof Decorative Decals For Scrapbooking Journaling Planner DIY Stationery
$0.23
No MOQ
 · 
15 views
Pillow Case Cushion Cover Blue Hydrangea Floral Letter Print Linen Texture Decorative Home Sofa
Pillow Case Cushion Cover Blue Hydrangea Floral Letter Print Linen Texture Decorative Home Sofa
like
Find Similar
Linen cushion cover with blue hydrangea floral print on cream background for sofa - Blue Hydrangea Full Print (JYM730-1)
Linen texture square pillowcase in light blue with white Flowers fresh print design - Blue Background FLOWERS Print (JYM730-2)
Blue linen hydrangea pillow cover with BLOOM with grace print for sofa decor - Light Blue BLOOM Print (JYM730-3)
Linen cushion cover with blue hydrangea in glass vase on white background - Watercolor Hydrangea In Bottle (JYM730-4)
Pillow Case Cushion Cover Blue Hydrangea Floral Letter Print Linen Texture Decorative Home Sofa
$1.15
No MOQ
Summer Window Clings Static PVC Double Sided Cartoon Gnomes Ocean Lemon Beach Glass Decoration Waterproof Home Decor
Summer Window Clings Static PVC Double Sided Cartoon Gnomes Ocean Lemon Beach Glass Decoration Waterproof Home Decor
like
Find Similar
Set of 9 double-sided summer gnome window clings with tropical beach party theme stickers - Summer Gnomes (XJ23011)
Hello Summer window clings with 9 sheets of double-sided gnome beach static stickers - Hawaii Gnomes (XJ23001)
9-sheet summer lemon static window stickers set featuring cartoon gnomes and sun designs - Lemon Gnomes (XJ23002)
Detail view of 9-sheet summer beach static window clings with 134 pieces of 20x30cm PVC decals - Summer Travel (XJ23003)
+3
Summer Window Clings Static PVC Double Sided Cartoon Gnomes Ocean Lemon Beach Glass Decoration Waterproof Home Decor
-5%
$2.24
No MOQ
Summer Window Clings PVC Static Double Sided Waterproof Reusable Cartoon Gnome Ocean Beach Tropical Decor Glass Mirror
Summer Window Clings PVC Static Double Sided Waterproof Reusable Cartoon Gnome Ocean Beach Tropical Decor Glass Mirror
like
Find Similar
Set of 9 double-sided summer gnome window clings with tropical beach party theme stickers - Beach Gnomes 9 Sheets Set (XJ23011)
Detailed set of 9 summer beach theme static window stickers with tropical gnomes and fruit - Summer Theme 9 Sheets Set (XJ23005)
9 sheets of ocean world window clings with 134 pieces of whales and sea turtles - Ocean World 9 Sheets Set (XJ23004)
Detail view of 9 sheets Hawaiian summer gnome static window clings with size and usage info - Hawaii Gnomes 9 Sheets Set (XJ23001)
+3
Summer Window Clings PVC Static Double Sided Waterproof Reusable Cartoon Gnome Ocean Beach Tropical Decor Glass Mirror
$2.45
No MOQ
Resin Nail Art Charms Mixed Butterfly Flower Snake Feather Shapes For DIY Manicure Decoration Colorful Flatback Accessories
Resin Nail Art Charms Mixed Butterfly Flower Snake Feather Shapes For DIY Manicure Decoration Colorful Flatback Accessories
like
Find Similar
Detailed view of six-color gradient nail art feathers with gold leaf in a clear storage box - 3D Feather Style (A002)
Close-up of 3D glitter butterfly nail art charms in a 6-grid transparent storage box - Butterfly Silhouette Style (A003)
Detail of 11x7.5mm milk bottle nail art charms in a 6-grid transparent organizer box - Cartoon Milk Bottle Style (A004)
Macro view of 9.2mm resin flower nail art charms in a six-grid transparent storage box - 3D Five-Petal Flower Style (A005)
Resin Nail Art Charms Mixed Butterfly Flower Snake Feather Shapes For DIY Manicure Decoration Colorful Flatback Accessories
$0.40-0.58
Mix MOQ : 3
Decorative Gold Foil Flakes Metallic Fragments For Cake Topper Dessert Food Decoration Nail Art DIY Painting Crafts
Decorative Gold Foil Flakes Metallic Fragments For Cake Topper Dessert Food Decoration Nail Art DIY Painting Crafts
like
Find Similar
Silver decorative metallic foil flakes in a jar for cake art and nail design - Small Jar / Silver
Detailed view of a 2g bottle of edible gold flakes for cake decorating and DIY crafts - Large Jar / Gold Leaf
Jar of 2g decorative silver flakes for cake topping, nail art, and edible painting - Large Jar / Silver Foil
Jar of 2g decorative rose gold flakes for cake topping and edible art decoration - Large Jar / Rose Gold Foil
+6
NewDecorative Gold Foil Flakes Metallic Fragments For Cake Topper Dessert Food Decoration Nail Art DIY Painting Crafts
$0.43-0.75
No MOQ
5D Relief Nail Art Stickers With Rhinestones And Artificial Pearls Sweet Candy Style Self Adhesive Manicure Decals For Women DIY Decor
5D Relief Nail Art Stickers With Rhinestones And Artificial Pearls Sweet Candy Style Self Adhesive Manicure Decals For Women DIY Decor
like
Find Similar
Colorful rhinestone nail art stickers set with multi-shape crystal gems for DIY manicures - Candy Soda Glitter Style(CO-407)
Colorful candy gemstone nail art stickers with glitter rhinestones for manicure decoration - Multicolor 3D Gemstone Style(CO-406)
Colorful diamond nail stickers with 3D heart and bow designs on pearly white nails - Heart and Bow Rhinestone Style(CO-408)
Macro shot of 3D nail art stickers Co-415 with colorful rhinestones on grey ombre nails - Irregular Gold Foil Luxury Style(CO-415 Gold)
+5
5D Relief Nail Art Stickers With Rhinestones And Artificial Pearls Sweet Candy Style Self Adhesive Manicure Decals For Women DIY Decor
$0.86
Mix MOQ : 2
Stereoscopic Embossed Nail Art Stickers Interstellar Astronaut Planet Star Heart Decals Self Adhesive Manicure DIY
Stereoscopic Embossed Nail Art Stickers Interstellar Astronaut Planet Star Heart Decals Self Adhesive Manicure DIY
like
Find Similar
5D embossed space theme nail art stickers featuring astronauts, planets, and stars - TS-924 Space Travel-Embossed
5D embossed celestial nail stickers with gold stars and moon in TS-1020 galaxy design - TS-1020 Silent Starry River-Embossed
Stereoscopic Embossed Nail Art Stickers Interstellar Astronaut Planet Star Heart Decals Self Adhesive Manicure DIY
$1.30
No MOQ
Free Shipping
Cute Cartoon Black Cat Enamel Pin Alloy Brooch Glass Jar Plant Mushroom Skull Badge Kawaii Jewelry For Backpack Clothing
Cute Cartoon Black Cat Enamel Pin Alloy Brooch Glass Jar Plant Mushroom Skull Badge Kawaii Jewelry For Backpack Clothing
like
Find Similar
Cartoon enamel pin featuring a black cat in a bottle with green leaves and pink plant - Cat in Jar with Monstera / Colorful
Cartoon light bulb enamel pin with black cats and mushrooms, alloy drip oil brooch badge - Cat in Light Bulb with Mushroom / Colorful
Cartoon enamel pin featuring a black cat in a glass bottle with pink flowers and green leaves - Cat in Round Bottle with Flower / Colorful
Enamel pin featuring a black cat, skull, and tropical plants in a bottle shape - Cat in Flask with Skull / Colorful
Cute Cartoon Black Cat Enamel Pin Alloy Brooch Glass Jar Plant Mushroom Skull Badge Kawaii Jewelry For Backpack Clothing
-9%
$0.47
No MOQ
 · 
54 sold recently
Free Shipping
Silicone Mold DIY Craft Multi Cavity Heart Smiley Face Flower Pattern For Baking Resin Chocolate Fondant Decorating
Silicone Mold DIY Craft Multi Cavity Heart Smiley Face Flower Pattern For Baking Resin Chocolate Fondant Decorating
like
Find Similar
Light blue 9-cavity silicone craft mold for DIY jewelry with heart and flower patterns - Multi-Shape Combination Style (Heart/Travel Tag/Flower) / Light Blue
Silicone cookie mold for DIY crafts with 4-hole smiley face and letter designs, 9cm size - Smiley Face Biscuit Style (BW Letters) / Light Blue
Silicone Mold DIY Craft Multi Cavity Heart Smiley Face Flower Pattern For Baking Resin Chocolate Fondant Decorating
$0.78-0.98
Mix MOQ : 2
Geometric Silicone Mold Wave Triangle Irregular Shape For DIY Handmade Soap Candle Resin Gypsum Baking Craft
Geometric Silicone Mold Wave Triangle Irregular Shape For DIY Handmade Soap Candle Resin Gypsum Baking Craft
like
Find Similar
Detail of wavy rectangular silicone mold showing dimensions 9.2x5.8x2.9cm and 83g weight - Wave Rectangular Style(1)
Detailed view of flexible silicone mold for triangular geometric soap and resin crafts - Triangle Style(2)
Detailed view of fan-shaped silicone mold with product dimensions and blue soap sample - Fan Shape Style(3)
Detail view of wave triangle silicone mold for resin art with size and weight annotations - Irregular Wave Edge Style(4)
+1
Geometric Silicone Mold Wave Triangle Irregular Shape For DIY Handmade Soap Candle Resin Gypsum Baking Craft
-5%
$1.12-1.78
Mix MOQ : 2
Birthday Letters And Animal Shape Silicone Mold For Cake Decoration DIY Fondant Baking Tool Flexible Non-Stick
Birthday Letters And Animal Shape Silicone Mold For Cake Decoration DIY Fondant Baking Tool Flexible Non-Stick
like
Find Similar
Pink silicone mold with happy birthday duckling for DIY cake toppers and baking - Duck HAPPY Style (1)
Silicone happy birthday monster letter mold for DIY fondant cake baking and chocolate - MONSTER Letters Style (2)
Silicone happy birthday dog bone mold for fondant and DIY baking with size 10x7.6x0.9cm - Bone Dog Happy Birthday Style (3)
Pink fitness themed silicone mold with 10kg kettlebell and bottle shapes for DIY baking - Fitness Bottle Kettlebell Style (4)
Birthday Letters And Animal Shape Silicone Mold For Cake Decoration DIY Fondant Baking Tool Flexible Non-Stick
-6%
$0.30-1.24
Mix MOQ : 2
Silicone Mold DIY Embossed Flower Daisy Snowflake Four-leaf Clover Candle Holder Vase Resin Soap Crafting Tool Ornament
Silicone Mold DIY Embossed Flower Daisy Snowflake Four-leaf Clover Candle Holder Vase Resin Soap Crafting Tool Ornament
like
Find Similar
Egg-shaped silicone mold for snowflake embossed candles or crafts with dimension markers - Snowflake Bottle
Daisy relief floral silicone mold for DIY resin candles and vases 7.2cm diameter - Sunflower Bottle
Silicone daisy sphere candle mold for DIY crafts with 3D embossed floral patterns - Daisy Bottle
Spherical clover embossed silicone mold for DIY resin candle holders and vases - Clover Bottle
+1
Silicone Mold DIY Embossed Flower Daisy Snowflake Four-leaf Clover Candle Holder Vase Resin Soap Crafting Tool Ornament
-4%
$3.29-4.11
Mix MOQ : 5
DIY Diamond Painting Keychain Kit Halloween Theme Acrylic Rhinestone Suncatcher Wind Chime Pendant Gnomes Pumpkins Ghosts Handmade Craft Gift
DIY Diamond Painting Keychain Kit Halloween Theme Acrylic Rhinestone Suncatcher Wind Chime Pendant Gnomes Pumpkins Ghosts Handmade Craft Gift
like
Find Similar
DIY Halloween pumpkin diamond keychain set with orange crystal wind chime charms - Demon Pumpkin Style
DIY Halloween keychain set with diamond painted Highland cow pendants and colorful beads - Halloween Highland Cow Style
5D DIY Halloween diamond painting kit featuring 3 white ghost keychains with colorful beads - White Ghost Style
DIY Halloween diamond painting keychain set with pumpkin, skull and bat pendants - Skull Bat Style
+25
DIY Diamond Painting Keychain Kit Halloween Theme Acrylic Rhinestone Suncatcher Wind Chime Pendant Gnomes Pumpkins Ghosts Handmade Craft Gift
$1.44
Mix MOQ : 50
 · 
10 views
DIY Diamond Painting Acrylic Ornament With Resin Rhinestones Desktop Decoration Handmade Craft Home Decor Sparkling
DIY Diamond Painting Acrylic Ornament With Resin Rhinestones Desktop Decoration Handmade Craft Home Decor Sparkling
like
Find Similar
DIY colorful spring birds and flower acrylic diamond painting stand with tool kit - Perfume Bottle
DIY 5D diamond painting kit featuring a lotus acrylic stand with vibrant colorful rhinestones - Lotus
DIY 5D diamond painting acrylic stand set featuring a purple butterfly and moon design - Moon Butterfly
DIY 5D diamond painting kit featuring a peacock acrylic stand and colorful rhinestone gems - Peacock
+7
DIY Diamond Painting Acrylic Ornament With Resin Rhinestones Desktop Decoration Handmade Craft Home Decor Sparkling
$5.76
Mix MOQ : 50
Rotating Photo Frame Double Sided Wooden Desktop Ornament With Mini Decorative Lamp And Resin Figurine Home Decor
Rotating Photo Frame Double Sided Wooden Desktop Ornament With Mini Decorative Lamp And Resin Figurine Home Decor
like
Find Similar
Modern 6-inch rotating wooden photo frame with cactus art and leaf-shaped LED night light - Green Shadow Double Sided - Light Coffee With Light
Modern 6-inch rotating wooden picture frame in natural wood finish with miniature figurines - Double Sided Vertical - Couple Style
Rotating wood photo frame with cartoon figures and hanging bulb ornament for 4x6 photos - Double Sided Vertical - Lovers Style
Rotating wood photo frame with 6-inch insert, night light, and cute rabbit figurine - Double Sided Vertical - Little Rabbit
+11
Rotating Photo Frame Double Sided Wooden Desktop Ornament With Mini Decorative Lamp And Resin Figurine Home Decor
$4.76-5.42
Mix MOQ : 2
Cute Cartoon Mushroom Enamel Pins Kawaii Mushroom Brooches Alloy Badges For Backpacks Jackets Hats Novelty Jewelry
Cute Cartoon Mushroom Enamel Pins Kawaii Mushroom Brooches Alloy Badges For Backpacks Jackets Hats Novelty Jewelry
like
Find Similar
Cartoon enamel pin of a mushroom-headed character playing a mint green guitar - CC2254-Rock Guitar Mushroom
Cute mushroom angel enamel pin with brown cap and pink spots on a white background - CC2255-Backpack Travel Mushroom
Cute mushroom enamel pin with teal spotted cap and green base cartoon badge accessory - CC2256-Winking Cute Mushroom
Cartoon enamel pin featuring a yellow leopard print mushroom character with a blue body - CC2258-Leopard Bow Mushroom
Cute Cartoon Mushroom Enamel Pins Kawaii Mushroom Brooches Alloy Badges For Backpacks Jackets Hats Novelty Jewelry
-7%
$0.58
No MOQ
 · 
65 sold recently
Free Shipping
Cartoon Creative 3D Earphone Cases Soft Silicone Protective Covers Shockproof Novelty Design For Wireless Earbuds
Cartoon Creative 3D Earphone Cases Soft Silicone Protective Covers Shockproof Novelty Design For Wireless Earbuds
like
Find Similar
3D cartoon dinosaur silicone case for AirPods in bean green with yellow fins - Cute Green Dragon + Carabiner / Airpods 3rd Gen
Silicone case for AirPods Pro in Nintendo Switch handheld game console style design - Game Console + Carabiner / AirPods Pro
Silicone AirPods case featuring Snorlax Pokemon character with matching finger ring strap - Snorlax + Ring / AirPods 1/2 Gen
Soot Sprite black silicone case for AirPods with large eyes and metallic carabiner - Coal Briquettes + Carabiners / AirPods 1/2 Gen
+388
Cartoon Creative 3D Earphone Cases Soft Silicone Protective Covers Shockproof Novelty Design For Wireless Earbuds
$0.46-1.21
No MOQ
 · 
27 sold recently
Humorous Enamel Pins Alloy Brooch Cartoon Badges For Clothes Backpacks Creative Laundry Detergent Spray Can Fries Gift
Humorous Enamel Pins Alloy Brooch Cartoon Badges For Clothes Backpacks Creative Laundry Detergent Spray Can Fries Gift
like
Find Similar
Funny enamel pin featuring a Bullshit REMOVER detergent bottle design in blue and pink - Bullshit REMOVER Laundry Detergent
Cartoon spray bottle enamel pin in sky blue and pink with repellent text design - Fuokboi REPELLENT Spray Bottle
French fries box enamel brooch with Fries Before Guys slogan and yellow details - FRIES BEFORE GUYS French Fries
Creative spray can enamel pin featuring Bitch Spray artistic text with colorful design - BITCH SPRAY Paint Can
+1
Humorous Enamel Pins Alloy Brooch Cartoon Badges For Clothes Backpacks Creative Laundry Detergent Spray Can Fries Gift
-19%
$0.42
No MOQ
 · 
47 sold recently
Nordic Morandi Ceramic Vase Matte Frosted Abstract Geometric Shape Modern Minimalist Home Office Desktop Ornament
Nordic Morandi Ceramic Vase Matte Frosted Abstract Geometric Shape Modern Minimalist Home Office Desktop Ornament
like
Find Similar
Nordic ceramic vase HP698-BG in beige with handcrafted texture and double handles - HP698-BG Beige / Beige
Morandi light green ceramic vase with a matte finish, sized 13.5cm by 22.5cm - HP699-YG Yellow Green Long Neck Bottle / Yellow-Green
Abstract ceramic vase in matte beige pink with 21cm height and artistic curved design - HP700-KHK Khaki 8-Shape / Khaki
Modern matte grey ceramic wall-mounted vase with organic shape 15cm x 20.5cm - HP701-GYGN Gray Green Slanted Mouth / Grey Green
+1
Nordic Morandi Ceramic Vase Matte Frosted Abstract Geometric Shape Modern Minimalist Home Office Desktop Ornament
$8.36-19.02
Mix MOQ : 2
Mini Vase Incense Holder Zinc Alloy Copper Plated Miniature Desktop Ornament Gourd Shape Vintage Chinese Style Decor
Mini Vase Incense Holder Zinc Alloy Copper Plated Miniature Desktop Ornament Gourd Shape Vintage Chinese Style Decor
like
Find Similar
Macro shot of a golden brass gourd incense holder showing 17.2g weight on a scale - Bottle A / Gourd Shape
Bottle B / Round Belly Shape
Miniature gold Ruyi vase incense holder weighing 18.0g on a digital scale - Bottle C / Long Neck Shape
Miniature gold Ruyi vase incense holder made of copper, 17.9g desktop ornament - Bottle D / Pure Water Bottle Shape
Mini Vase Incense Holder Zinc Alloy Copper Plated Miniature Desktop Ornament Gourd Shape Vintage Chinese Style Decor
$0.39
No MOQ
 · 
16 views
Vintage Camping Hanging Banner Pennant Flag Canvas Poster Wood Pole Retro Outdoor Tent RV Decoration Adventure Mural
Vintage Camping Hanging Banner Pennant Flag Canvas Poster Wood Pole Retro Outdoor Tent RV Decoration Adventure Mural
like
Find Similar
Detail of vintage canvas camping flag with wood poles in an outdoor forest campsite - LYDQ-1001/Hand-drawn Camping Elements
Detail of navy blue camping pennant banner with mountain sun design and wanderlust text - LYDQ-1002/Wanderlust Mountain Illustration
Camping banner with mountain design hanging outdoors near a cozy campfire setup - LYDQ-1003/Welcome To Our Campfire
Outdoor camping flag with vintage traveler adventure print and wooden hanging rod - LYDQ-1004/Traveller Road Adventures
+15
Vintage Camping Hanging Banner Pennant Flag Canvas Poster Wood Pole Retro Outdoor Tent RV Decoration Adventure Mural
$2.80
No MOQ
Psychedelic Alien Astronaut Mushroom Wall Tapestry Polyester Aesthetic Trippy Hippie Hanging Cloth For Bedroom Dorm Room Decor
Psychedelic Alien Astronaut Mushroom Wall Tapestry Polyester Aesthetic Trippy Hippie Hanging Cloth For Bedroom Dorm Room Decor
like
Find Similar
Detail of retro sci-fi tapestry featuring a UFO beam over blue mountains on white wall - 73X95CM/Brushed Fabric / GT105-2 Psychedelic UFO
Detail of sci-fi tapestry featuring an astronaut and alien in a space-themed bedroom - 73X95CM/Brushed Fabric / GT105-3 Space Bus
Detail of bohemian tapestry featuring an astronaut and alien in a cosmic space truck - 73X95CM/Brushed Fabric / GT105-4 Moon Travel
Close-up of bohemian tie-dye tapestry featuring a green alien in an indoor home setting - 73X95CM/Brushed Fabric / GT318-4 Tie-dye Alien
+86
Psychedelic Alien Astronaut Mushroom Wall Tapestry Polyester Aesthetic Trippy Hippie Hanging Cloth For Bedroom Dorm Room Decor
-5%
$2.66-21.10
No MOQ
Christmas Table Runner Polyester Jacquard Snowflake Tree Pattern Tassels For Dining Room Party Holiday Decor
Christmas Table Runner Polyester Jacquard Snowflake Tree Pattern Tassels For Dining Room Party Holiday Decor
like
Find Similar
Christmas tree and snowflake jacquard table runner with tassels on a rustic wooden table - 35x120 / White Geometric Snowflake + Red Tassel (Hand Wash Only)
Christmas tree table runner with green base, red plaid borders and tassels for holiday decor - 35x120 / Green Tower Tree + Red Tassel (Hand Wash Only)
Christmas table runner with dark green festive prints, red diamond borders and tassels - 35x120 / Green Five Stars + Green Tassel (Hand Wash Only)
Beige Christmas table runner with red plaid borders, reindeer and tree embroidery - 35x120 / White Tower Tree + Red Tassel (Hand Wash Only)
+68
Christmas Table Runner Polyester Jacquard Snowflake Tree Pattern Tassels For Dining Room Party Holiday Decor
$6.34-16.71
No MOQ
Miniature Christmas Decorations Dollhouse Accessories Wood Resin Plastic Ornaments DIY Micro Landscape Snow Scene Festive Decor
Miniature Christmas Decorations Dollhouse Accessories Wood Resin Plastic Ornaments DIY Micro Landscape Snow Scene Festive Decor
like
Find Similar
Miniature white artificial snow powder in PE bag, 13g pack for DIY Christmas decor - No.1 - 13g White Artificial Snow Powder Bag
Miniature white wooden snowflake ornament 3cm for DIY Christmas dollhouse decor - No.3 - 3cm Wooden Snowflake Ornament
Miniature white wooden snowflake ornament for Christmas DIY crafts and 3cm snow decor - No.4 - 3cm Thick Wooden Snowflake
Miniature resin snowflake ornament with glitter finish for DIY Christmas tree decor - No.5 - 2.8cm Resin Glitter Snowflake
+97
Miniature Christmas Decorations Dollhouse Accessories Wood Resin Plastic Ornaments DIY Micro Landscape Snow Scene Festive Decor
-91%
$0.05-2.08
No MOQ
 · 
102 sold recently
Artificial Snow Powder For Flower Bouquet Decoration DIY Christmas Spray Frost Effect Realistic PE Material Winter Party
Artificial Snow Powder For Flower Bouquet Decoration DIY Christmas Spray Frost Effect Realistic PE Material Winter Party
like
Find Similar
DIY Christmas red roses decorated with fine and coarse artificial snow powder effects - Coarse Snow Spray 4 Bottles 280ml
Fine white PE artificial snow powder for professional Christmas DIY decor and displays - Fine White Snow 100g
Artificial ice crush heavy snow powder for Christmas DIY strawberry rose decoration - Coarse White Snow 100g
Pink roses and orchids with pearls in pink matte wrapping paper for DIY decoration - Matte Flamingo Pink 450ml
+18
Artificial Snow Powder For Flower Bouquet Decoration DIY Christmas Spray Frost Effect Realistic PE Material Winter Party
$0.81-8.36
Mix MOQ : 2
Artificial Snow Powder Spray Glitter Sequins For DIY Christmas Rose Flower Decoration Ice Frost Effect Plastic Materials
Artificial Snow Powder Spray Glitter Sequins For DIY Christmas Rose Flower Decoration Ice Frost Effect Plastic Materials
like
Find Similar
DIY Christmas red roses decorated with fine and coarse artificial snow powder effects - Snow Spray Coarse Snow/4 Bottles 280ml
Fine white PE artificial snow powder for professional Christmas DIY decor and displays - Fine Snow White/100g
Artificial ice crush heavy snow powder for Christmas DIY strawberry rose decoration - Coarse Snow White/100g
Pink roses and orchids with pearls in pink matte wrapping paper for DIY decoration - Matte Flamingo Pink/450ml
+18
Artificial Snow Powder Spray Glitter Sequins For DIY Christmas Rose Flower Decoration Ice Frost Effect Plastic Materials
$0.81-8.36
Mix MOQ : 2
 · 
13 views
Christmas Cake Decoration Accessories Mini Knit Wool Hats Cupcake Liners Toppers Stickers Jars Festive Baking Supplies
Christmas Cake Decoration Accessories Mini Knit Wool Hats Cupcake Liners Toppers Stickers Jars Festive Baking Supplies
like
Find Similar
Transparent plastic pudding cup with bear-shaped lid for Christmas cake decorations - 7.5cm Bear Head Empty Jar
100ml clear glass pudding jar with plastic lid, height 7cm for Christmas desserts - 100ml Transparent Milk Bottle
Five small pink apple-shaped birthday candles in a white ceramic dish, 5pcs pack - Small Cherry Pink Candles 5 Pcs
5-pack cherry shaped birthday candles with 2.4cm wax design for cake decoration - Small Cherry Red Candles 5 Pcs
+3
Christmas Cake Decoration Accessories Mini Knit Wool Hats Cupcake Liners Toppers Stickers Jars Festive Baking Supplies
-6%
$0.16-2.14
Mix MOQ : 3
 · 
12 views
Christmas Tree LED Night Light Ceramic Frosted Glowing Tabletop Ornament Battery Operated Festive Home Decor Gift
Christmas Tree LED Night Light Ceramic Frosted Glowing Tabletop Ornament Battery Operated Festive Home Decor Gift
like
Find Similar
Conical black reindeer Christmas lamp with warm LED light and snowflake cutout patterns - Cone / Black
Dark green frosted Christmas LED candle with tree cutouts and warm glowing light effect - Short Candle Shape / Green
Black LED Christmas candle with reindeer cutout and warm glow on snowy background - Short Candle Shape / Black
Red Christmas LED candle lamp with hollow tree pattern and festive bokeh effect - Short Candle Shape / Red
+15
Christmas Tree LED Night Light Ceramic Frosted Glowing Tabletop Ornament Battery Operated Festive Home Decor Gift
$2.88-7.20
No MOQ
 · 
18 sold recently
Miniature Christmas Dollhouse Accessories Resin Plastic Candy Jar Gingerbread Man Snowman DIY Scene Decor Festive Figurines
Miniature Christmas Dollhouse Accessories Resin Plastic Candy Jar Gingerbread Man Snowman DIY Scene Decor Festive Figurines
like
Find Similar
Miniature resin gingerbread man charms for dollhouse decor and DIY crafts, 1.5cm size - Mini Gingerbread Man Set (2 Pcs)
Miniature resin gingerbread man figures with red Santa hats for Christmas dollhouse decor - Standing and Lying Gingerbread Man with Hat Set (2 Pcs)
Miniature Christmas resin figurine set featuring a vintage brown train and a tiny deer - Christmas Train and Reindeer Set (2 Pcs)
Miniature Christmas resin wreath and golden bell set for DIY dollhouse decoration - Wreath and Bells Set (2 Pcs)
+7
Miniature Christmas Dollhouse Accessories Resin Plastic Candy Jar Gingerbread Man Snowman DIY Scene Decor Festive Figurines
$0.35-8.62
Mix MOQ : 2
 · 
27 sold recently
Free Shipping
Mini Christmas Hat Red White Velvet Fabric Cutlery Holder Lollipop Decoration Holiday Table Accessory Ornament
Mini Christmas Hat Red White Velvet Fabric Cutlery Holder Lollipop Decoration Holiday Table Accessory Ornament
like
Find Similar
Close-up of mini red and white plush Christmas hat for wine bottles and cutlery decor - 4*7cm (Lollipop Hat)
Close-up of a red and white mini plush Christmas hat on a green festive background - 6*12cm (Wine Bottle Hat/Cutlery Set)
Mini Christmas Hat Red White Velvet Fabric Cutlery Holder Lollipop Decoration Holiday Table Accessory Ornament
$0.07-0.10
Mix MOQ : 2
Vintage Christmas LED Lantern Retro Antique Bronze Night Light With Santa Snowman Reindeer For Holiday Home Tabletop Decor
Vintage Christmas LED Lantern Retro Antique Bronze Night Light With Santa Snowman Reindeer For Holiday Home Tabletop Decor
like
Find Similar
Vintage bronze Christmas lantern with a snowman figurine and warm white LED lights - Bronze Bottle Snowman
Bronze Christmas lantern with LED deer scene and warm lights for festive decor - Bronze Bottle Reindeer
Vintage bronze Christmas lantern with LED Santa scene and warm glowing lights - Bronze Bottle Christmas Tree Child
Vintage Christmas LED Lantern Retro Antique Bronze Night Light With Santa Snowman Reindeer For Holiday Home Tabletop Decor
$3.03
Mix MOQ : 2
Artificial Snow Spray Christmas Decoration Instant Foam For Flower Tree Window Winter Holiday Party Prop Novelty
Artificial Snow Spray Christmas Decoration Instant Foam For Flower Tree Window Winter Holiday Party Prop Novelty
like
Find Similar
Artificial snow spray for Christmas roses and flower bouquets in 250ml canister - Coarse Snow 6 Bottles 250ml/Bottle
Artificial fine snow spray 280ml for Christmas roses with white flake texture - Fine Snow 6 Bottles 280ml/Bottle
Christmas snow spray set with artificial red roses and decorative aerosol cans for holiday scene - 3 Coarse + 3 Fine Snow Bottles
Artificial Snow Spray Christmas Decoration Instant Foam For Flower Tree Window Winter Holiday Party Prop Novelty
$5.48
No MOQ
Artificial Snow Spray Christmas Decoration Floral Frost Effect Aerosol White Paint For Flowers Trees Party Supplies
Artificial Snow Spray Christmas Decoration Floral Frost Effect Aerosol White Paint For Flowers Trees Party Supplies
like
Find Similar
Christmas bouquet snow spray on red roses showing fine and coarse snow effects - Set of 4 Bottles / White Coarse and Fine Snow Mix Set
Red rose bouquet with realistic artificial snow spray texture for Christmas floral decor - Set of 4 Bottles / White Coarse Snow
Dark red spray painted roses for bouquets with a frosted snow effect finish - Set of 4 Bottles / White Fine Snow
Artificial Snow Spray Christmas Decoration Floral Frost Effect Aerosol White Paint For Flowers Trees Party Supplies
$5.19
No MOQ
 · 
14 views
Christmas Tree Hanging Ornaments Painted Glass Creative Food Fruit Vegetable Pendants Holiday Festive Party Decoration Novelty
Christmas Tree Hanging Ornaments Painted Glass Creative Food Fruit Vegetable Pendants Holiday Festive Party Decoration Novelty
like
Find Similar
Yellow lemon glass slice Christmas ornament with glitter finish and 7cm dimensions - Half-cut Lemon
Glittery pomegranate glass ornament in red orange gradient for Christmas tree decoration - Pomegranate
Glass strawberry Christmas ornament with 8x9cm size markers on white background - Strawberry
Watermelon shaped painted glass Christmas ornament with glitter finish and gold string - Watermelon Slice
+10
Christmas Tree Hanging Ornaments Painted Glass Creative Food Fruit Vegetable Pendants Holiday Festive Party Decoration Novelty
$5.71-19.83
Mix MOQ : 2
Free Shipping
Christmas Table Runner Polyester Jacquard Weaving Reindeer Snowman Pattern With Tassels Holiday Dining Decoration
Christmas Table Runner Polyester Jacquard Weaving Reindeer Snowman Pattern With Tassels Holiday Dining Decoration
like
Find Similar
Green Christmas table runner with snowman pattern and festive tassels in woven fabric - Green Box With Green Tassels (do Not Machine Wash) / 35x300cm
Green Christmas table runner with floral jacquard patterns and elegant hanging tassels - Green Plants + Green Tassels (do Not Machine Wash) / 35x300cm
Dark green Christmas table runner with jacquard snowman tree motifs and elegant tassels - Dark Green Christmas Tree With Green Tassels (do Not Machine Wash) / 35x300cm
Christmas table runner with green tassels, featuring festive tree and star patterns - Light Green Christmas Tree With Green Tassels (do Not Machine Wash) / 35x300cm
+316
Christmas Table Runner Polyester Jacquard Weaving Reindeer Snowman Pattern With Tassels Holiday Dining Decoration
$6.92-14.41
No MOQ
Christmas Glass Dome Ornament With LED Light Luminous Wood Base Hanging Pendant Night Light Desktop Festive Decor
Christmas Glass Dome Ornament With LED Light Luminous Wood Base Hanging Pendant Night Light Desktop Festive Decor
like
Find Similar
Luminous glass Christmas ornament with Santa and tree inside on wood base, 10cm height - Red Pillar Santa Front
Nordic Christmas glass dome lamp with Santa and LED light on a wooden base - Red Pillar Santa Side
Luminous glass Christmas ornament with wooden reindeer scenery and LED warm light inside - Blue Pillar Reindeer
Nordic glass snowman night light with LED tree and artificial snow decoration - Blue Pillar Snowman
+4
Christmas Glass Dome Ornament With LED Light Luminous Wood Base Hanging Pendant Night Light Desktop Festive Decor
-5%
$4.05-7.88
Mix MOQ : 2
Mini Paper Gift Boxes Candy Packaging Gold Stamping Ribbon Merci Pattern For Wedding Christmas Party Supplies
Mini Paper Gift Boxes Candy Packaging Gold Stamping Ribbon Merci Pattern For Wedding Christmas Party Supplies
like
Find Similar
Elegant black Christmas candy box with golden reindeer illustrations and glittery ribbon - Black Reindeer with Gold Ribbon
White Christmas gift box with polar bear illustration and golden glitter mesh ribbon - White Gift Bear with Gold Ribbon
White trapezoid gift box with gold star moon jar pattern and Merci gold ribbon - White Wishing Bottle with Gold Ribbon
Mini Paper Gift Boxes Candy Packaging Gold Stamping Ribbon Merci Pattern For Wedding Christmas Party Supplies
$0.17
Mix MOQ : 20
LED Light Up Christmas Hat Plush Santa Hats For Holiday Party Decoration Colorful Glow Adults Kids Soft Plush
LED Light Up Christmas Hat Plush Santa Hats For Holiday Party Decoration Colorful Glow Adults Kids Soft Plush
like
Find Similar
Classic red and white plush Christmas hat with LED lights for festive holiday party decor - Adult Single-Layer Plush
Red plush Christmas hat with warm glowing LED lights and soft white faux fur trim - Glowing Adult Style / Adult Warm White
Classic red plush Christmas hat with colorful LED lights and white fluffy trim - Glowing Adult Style / Adult Colorful Lights
Classic red plush Christmas hat with white LED lights for festive holiday party decor - Adult Double-Layer Plush
+13
LED Light Up Christmas Hat Plush Santa Hats For Holiday Party Decoration Colorful Glow Adults Kids Soft Plush
$0.37-3.89
No MOQ
 · 
12 views
Glowing LED Christmas Hat Long Plush Knit Santa Hats Festive Party Decor Costume Headwear For Adults And Children
Glowing LED Christmas Hat Long Plush Knit Santa Hats Festive Party Decor Costume Headwear For Adults And Children
like
Find Similar
Classic red plush Christmas hat with white LED lights for festive holiday party decor - Baby Double Layer Fleece / Red
Red plush Christmas hat with warm glowing LED lights and soft white faux fur trim - Adult Warm White Light / Red
Classic red plush Christmas hat with colorful LED lights and white fluffy trim - Adult Colorful Light / Red
Red and white knitted Christmas hat with LED lights and a white fuzzy pom-pom top - Knitted Style - Adult / Red
+32
Glowing LED Christmas Hat Long Plush Knit Santa Hats Festive Party Decor Costume Headwear For Adults And Children
-8%
$0.11-3.97
No MOQ
 · 
77 views
Christmas Tree Hanging Ornaments Rose Gold Plastic Glitter Festive Holiday Party Decor Trains Nutcracker Candy Shapes
Christmas Tree Hanging Ornaments Rose Gold Plastic Glitter Festive Holiday Party Decor Trains Nutcracker Candy Shapes
like
Find Similar
Champagne rose gold gift box Christmas tree ornaments in a 2-piece set with glitter finish - Gift Box Style/2 Pcs
Champagne gold acorn Christmas ornaments set of 2 in clear box with snowflake detail - Pine Cone Style/2 Pcs
Champagne gold Christmas bell ornaments in rose gold glossy and matte glitter finish - Bell Style/2 Pcs
Champagne gold candy cane Christmas ornaments with rose gold stripes and size details - Candy Cane Style/4 Pcs
+13
Christmas Tree Hanging Ornaments Rose Gold Plastic Glitter Festive Holiday Party Decor Trains Nutcracker Candy Shapes
-5%
$1.37-3.42
No MOQ
Embroidery Patches Food Drink Cupcake Sushi Cocktail Ice Cream DIY Sew Iron On Applique For Clothes Bags
Embroidery Patches Food Drink Cupcake Sushi Cocktail Ice Cream DIY Sew Iron On Applique For Clothes Bags
like
Find Similar
Cupcake embroidered patch for clothing DIY decoration with 5.5cm height and precise stitching - Cupcake
Embroidered drink patch with straw and heart-eye smiley face for DIY clothing decor - Smiling Milkshake
White jar embroidery patch with Feelings text and pink cap for DIY clothing decoration - Feelings Pink Bottle
Pink milkshake embroidery patch for DIY clothing decor, size 2.9cm by 6.6cm - Tri-color Milkshake
+12
Embroidery Patches Food Drink Cupcake Sushi Cocktail Ice Cream DIY Sew Iron On Applique For Clothes Bags
$0.09-2.31
Mix MOQ : 10
 · 
187 sold recently
Free Shipping
Happy New Year Hanging Door Sign Glitter Paper Cardboard Ornament For Party Celebration Atmosphere Decoration
Happy New Year Hanging Door Sign Glitter Paper Cardboard Ornament For Party Celebration Atmosphere Decoration
like
Find Similar
Golden glitter Happy New Year clock hanging ornament with black ribbon and white dial - Clock Style
Festive black truck Happy New Year hanging ornament with gold glitter and champagne details - Car Style
New Year party door hanger featuring a black top hat design with Happy New Year text - Hat Style
Golden and green Happy New Year party hanging decoration on a clean white background - Wine Bottle Style
Happy New Year Hanging Door Sign Glitter Paper Cardboard Ornament For Party Celebration Atmosphere Decoration
$0.55
Mix MOQ : 5
Cartoon Baby Gift Wrapping Paper Kraft Paper For Newborn Birthday Full Moon Party DIY Cute Patterns
Cartoon Baby Gift Wrapping Paper Kraft Paper For Newborn Birthday Full Moon Party DIY Cute Patterns
like
Find Similar
Pink cartoon baby gift wrapping paper with crib and star patterns, size 50x70 cm - Pink - Crib
Pink cartoon baby gift wrapping paper with bottle and star patterns, size 50x70 cm - Pink - Milk Bottle
Pink baby gift wrapping paper with cartoon whale and rattle patterns in 50x70 cm size - Pink - Whale
Blue baby themed gift wrapping paper roll with bear and duck patterns 50x70 cm - Blue - Bear
+2
Cartoon Baby Gift Wrapping Paper Kraft Paper For Newborn Birthday Full Moon Party DIY Cute Patterns
-3%
$0.25
Mix MOQ : 2
 · 
14 views
Cartoon Animal Figure Blind Box Resin Panda Cat Desktop Ornament Creative Chinese Style Home Decor Gift
Cartoon Animal Figure Blind Box Resin Panda Cat Desktop Ornament Creative Chinese Style Home Decor Gift
like
Find Similar
Fantasy Island blind box set featuring 9 cute cartoon panda character figurines - Fantasy Island Series-Whole Set
Luminous cat party flower fairy phone stand blind box featuring translucent neon figures - Flower Fairy Magic Light-Whole Set
Bee King series cartoon bee figurines made of PVC for desk decor and gifts - Bee King Arrival-Whole Set
Cute yellow bear crystal ball music box collection with luminous cloud bases - Butter Bear Crystal Ball-Whole Set
+47
Cartoon Animal Figure Blind Box Resin Panda Cat Desktop Ornament Creative Chinese Style Home Decor Gift
$9.08-51.18
No MOQ
 · 
51 views
Free Shipping
Children Play Mat Area Rug Crystal Velvet Non-Slip Washable Cartoon Road Map Educational Carpet For Nursery Bedroom
Children Play Mat Area Rug Crystal Velvet Non-Slip Washable Cartoon Road Map Educational Carpet For Nursery Bedroom
like
Find Similar
Kids play rug with colorful road and transport patterns on soft beige background - 80x120cm / Crystal Velvet - City Roam
Neutral beige rectangle kids rug featuring urban road network and city traffic map - 80x120cm / Crystal Velvet - Town Track
Beige children's room rug featuring a cartoon animal band on soft plush material - 80x120cm / Crystal Velvet - Animal Orchestra
Light blue children's pirate treasure hunt board game play rug for kids' bedrooms - 80x120cm / Crystal Velvet - Pirate Adventure
+84
Children Play Mat Area Rug Crystal Velvet Non-Slip Washable Cartoon Road Map Educational Carpet For Nursery Bedroom
-5%
$7.88-163.99
No MOQ
 · 
20 views
Luminous Desktop Ornament Resin Crystal Miniature Landscape Figurine LED Glow Creative Desk Office Decoration Novelty
Luminous Desktop Ornament Resin Crystal Miniature Landscape Figurine LED Glow Creative Desk Office Decoration Novelty
like
Find Similar
Set of 12 creative lucky cat mini figurines with gold ingots for home desk decor - A125 Positive Energy Emotional Cat / Full Set (12pcs)
Little Kitten series set of 9 cat blind box resin figures for desk decoration - A139 Treasure Emotional Kittens (8 Items) / Full Set
Cute Siamese cat life series blind box figurines for desk decoration - A155 Siamese Cat's Life Revelation (6 Parts) / Full Set
Set of 9 cute mushroom cat night light figurines blind box in garden scene - -492 Poisonous Mushroom Exploration Diary (8 Entries) / Full Set
+125
Luminous Desktop Ornament Resin Crystal Miniature Landscape Figurine LED Glow Creative Desk Office Decoration Novelty
-5%
$1.19-43.04
No MOQ
Free Shipping
Cute Cartoon Cow Embroidery Patches Polyester Fabric DIY Sewing Appliques For Clothes Bags Decoration Animal Motif
Cute Cartoon Cow Embroidery Patches Polyester Fabric DIY Sewing Appliques For Clothes Bags Decoration Animal Motif
like
Find Similar
Daisy embroidery patch double-sided adhesive sheets CROWN #513L size 10x20cm - Embroidery Auxiliary Strong Adhesive Sheet
Cute cartoon cow embroidery patches in black and white for clothing and bag decoration - Set of 25Pcs
Variety set of cartoon cow embroidered patches in black and white for DIY clothing - Cute Cow Embroidery Assorted Set
Detailed view of cartoon cow embroidery patch showing 6.7x6cm dimensions and texture - Large Black and White Spotted Cow (No. 1)
+24
Cute Cartoon Cow Embroidery Patches Polyester Fabric DIY Sewing Appliques For Clothes Bags Decoration Animal Motif
$0.22-7.19
No MOQ
 · 
1 reviews
Free Shipping
Go to

More in home & kitchen

Explore more in travel bottles

steelstrapalloysleevewallmetaldisplayshapedesignshoulder
plasticpetkidssquarewindowcare316 stainless steeladjustablegoldcover

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access