Everful

Wholesale travel bottles

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Travel Bottles

Find the perfect pieces: vacuum flasks & thermoses, tumblers, mugs and more

All products in travel bottles

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Floral Lace Cosmetic Bag Jacquard Texture Portable Travel Skincare Storage Pouch Zipper Closure Sweet Pastoral Style Women
Floral Lace Cosmetic Bag Jacquard Texture Portable Travel Skincare Storage Pouch Zipper Closure Sweet Pastoral Style Women
like
Find Similar
Floral mesh cosmetic bag in beige with yellow flower patterns and size dimensions - Pillow Bag / Beige
Pink floral lace makeup pouch with silver petal zipper and brand label, 14x10cm size - Small Flat Bag / Pink
Beige floral mesh makeup bag with lace details and dimensions for daily skincare storage - Hexagonal Bag / Beige
Pink floral lace makeup bag in hexagonal shape with zipper closure weighing 62g - Hexagonal Bag / Pink
+5
Floral Lace Cosmetic Bag Jacquard Texture Portable Travel Skincare Storage Pouch Zipper Closure Sweet Pastoral Style Women
$1.50-2.31
No MOQ
Quilted Cotton Makeup Bag Floral Print Large Capacity Portable Cosmetic Pouch Travel Toiletry Storage Zippered Organizer
Quilted Cotton Makeup Bag Floral Print Large Capacity Portable Cosmetic Pouch Travel Toiletry Storage Zippered Organizer
like
Find Similar
Macro detail of floral quilted makeup bag with zipper and logo tag showing craftsmanship - Blue Rose
Detail of quilted cotton floral makeup bag with a vintage label in a decorative basket - Pink Rose
Detail of blue floral quilted cotton makeup bag showing diamond texture and label - Vintage Blue Rose
Floral quilted cotton makeup bag with blue puppy print and zipper in white mesh basket - Blue Cat
Quilted Cotton Makeup Bag Floral Print Large Capacity Portable Cosmetic Pouch Travel Toiletry Storage Zippered Organizer
$2.74
No MOQ
 · 
10 views
Bread Dog Pattern Quilted Cotton Cosmetic Bag Portable Large Capacity Makeup Organizer Pouch Travel Toiletry Wash Bag
Bread Dog Pattern Quilted Cotton Cosmetic Bag Portable Large Capacity Makeup Organizer Pouch Travel Toiletry Wash Bag
like
Find Similar
Detailed view of white quilted bread dog makeup bag with top handle and zipper closure - Bread Dog - [Makeup Bag]
Detail of cream quilted makeup bag featuring cartoon puppy patterns and zipper closure - Bread Dog - [Clutch Bag]
White quilted cosmetic bag with cute cartoon bread dog print and pink floral charm - Bread Dog - [Octagon Storage Bag]
NewBread Dog Pattern Quilted Cotton Cosmetic Bag Portable Large Capacity Makeup Organizer Pouch Travel Toiletry Wash Bag
-5%
$2.05-3.42
No MOQ
Cute Cartoon Cat Embroidery Denim Makeup Bag Large Capacity Travel Cosmetic Pouch Portable Handheld Toiletry Storage Case
Cute Cartoon Cat Embroidery Denim Makeup Bag Large Capacity Travel Cosmetic Pouch Portable Handheld Toiletry Storage Case
like
Find Similar
Close-up of the cat embroidery and Jolly House text on blue denim makeup bag - Cowboy Cat
NewCute Cartoon Cat Embroidery Denim Makeup Bag Large Capacity Travel Cosmetic Pouch Portable Handheld Toiletry Storage Case
$3.60
No MOQ
Floral Jacquard Makeup Bag Cotton Rose Pattern Cosmetic Pouch Travel Toiletry Organizer With Canvas Lining Women
Floral Jacquard Makeup Bag Cotton Rose Pattern Cosmetic Pouch Travel Toiletry Organizer With Canvas Lining Women
like
Find Similar
2 options
NewFloral Jacquard Makeup Bag Cotton Rose Pattern Cosmetic Pouch Travel Toiletry Organizer With Canvas Lining Women
$2.39-3.11
No MOQ
Corduroy Cosmetic Bag Checkerboard Floral Makeup Pouch Zipper Toiletries Organizer Handheld Travel Storage Women Ins Style
Corduroy Cosmetic Bag Checkerboard Floral Makeup Pouch Zipper Toiletries Organizer Handheld Travel Storage Women Ins Style
like
Find Similar
Detail of checkered corduroy cosmetic bag with side handle and Wild Flower label - Light Brown Checkerboard
Close-up of corduroy toiletry bag with orange tulips and Wild Flower patch design - Beige Tulip
Close-up of brown corduroy checkered makeup bag with woven handle and side logo - Dark Brown Checkerboard
Macro shot of a floral corduroy makeup bag on a wooden table for travel storage - Beige Red Floral Tulip
+1
Corduroy Cosmetic Bag Checkerboard Floral Makeup Pouch Zipper Toiletries Organizer Handheld Travel Storage Women Ins Style
-12%
$2.00
No MOQ
Floral Print Canvas Makeup Bag Large Capacity Travel Cosmetic Pouch Aesthetic Korean Style Storage Organizer For Women
Floral Print Canvas Makeup Bag Large Capacity Travel Cosmetic Pouch Aesthetic Korean Style Storage Organizer For Women
like
Find Similar
Detail of floral canvas toiletry bag with zipper and logo on elegant cream background - White
Detailed close-up of a pink floral makeup bag with elegant blue patterns and brand tag - Light Pink
Floral Print Canvas Makeup Bag Large Capacity Travel Cosmetic Pouch Aesthetic Korean Style Storage Organizer For Women
$1.99
No MOQ
Floral Print Cotton Cosmetic Bag Aesthetic Bear Pattern Makeup Pouch Zipper Travel Organizer For Women Fresh Style
Floral Print Cotton Cosmetic Bag Aesthetic Bear Pattern Makeup Pouch Zipper Travel Organizer For Women Fresh Style
like
Find Similar
Detailed macro view of a floral bear pattern cotton makeup pouch held by a hand - Flower Bear
Floral cotton pouch held by a model, showing white fabric with delicate flower patterns - Floral Rhombus
Close-up of a floral cotton makeup bag with orange tulip patterns and drawstring closure - Cotton Tulip
Floral Print Cotton Cosmetic Bag Aesthetic Bear Pattern Makeup Pouch Zipper Travel Organizer For Women Fresh Style
$2.28
No MOQ
Floral Quilted Corduroy Makeup Bag Large Capacity Retro Cosmetic Pouch Toiletry Storage Organizer Case For Travel
Floral Quilted Corduroy Makeup Bag Large Capacity Retro Cosmetic Pouch Toiletry Storage Organizer Case For Travel
like
Find Similar
Detailed quilted floral makeup bag with brown handle and white embroidery texture - Makeup Bag / Grey Green
Close-up of quilted floral corduroy cosmetic bag with brown zipper and vintage camera - Clutch Bag / Grey Green
Detail of floral quilted corduroy makeup bag with embroidery label and brown zipper - Octagonal Pouch / Grey Green
Detail view of corduroy quilted floral makeup bag with Melody embroidered handle - Makeup Bag / Dark Green
+2
Floral Quilted Corduroy Makeup Bag Large Capacity Retro Cosmetic Pouch Toiletry Storage Organizer Case For Travel
-5%
$1.89-3.56
No MOQ
Linen Makeup Bag Cosmetic Pouch With Zipper And Wristlet Strap Cartoon Bird Heart Print Portable Multi-functional Organizer
Linen Makeup Bag Cosmetic Pouch With Zipper And Wristlet Strap Cartoon Bird Heart Print Portable Multi-functional Organizer
like
Find Similar
Canvas makeup bag featuring chick print and 'Perfect Together' quote with black handle - Perfect Together Style (xy-061-1) / With Strap
Canvas cosmetic bag with artistic tree of life print and black wristlet strap - Life Tree Style (xy-061-2) / With Strap
Canvas makeup bag with Valentine's day heart and rose patterns featuring a black zipper - Happy Valentines Style (xy-061-3) / With Strap
White canvas makeup bag with cute chick print, colorful bird illustration and heart patterns - Love Birds Style (xy-061-4) / With Strap
+4
Linen Makeup Bag Cosmetic Pouch With Zipper And Wristlet Strap Cartoon Bird Heart Print Portable Multi-functional Organizer
$1.33-1.38
No MOQ
Floral Cosmetic Bag Quilted Cotton Makeup Organizer Travel Toiletry Pouch Portable Retro Pastoral Style Handheld For Women
Floral Cosmetic Bag Quilted Cotton Makeup Organizer Travel Toiletry Pouch Portable Retro Pastoral Style Handheld For Women
like
Find Similar
Close-up of a floral quilted makeup bag with handle on a wooden surface with a Christmas tree - Cosmetic Bag - Flower Bush
Quilted floral makeup bag with top handle and vintage flower pattern on wooden table - Cosmetic Bag - Flower Vine
Detail of floral quilted cotton makeup bag with white zipper and branded woven label - Handbag - Flower Bush
Close-up of vintage floral quilted makeup bag with zipper and the jolly house label - Handbag - Flower Vine
+2
Floral Cosmetic Bag Quilted Cotton Makeup Organizer Travel Toiletry Pouch Portable Retro Pastoral Style Handheld For Women
-5%
$1.48-3.12
No MOQ
Red White Checkered Plush Makeup Bag Portable Travel Toiletry Organizer Zipper Square Pouch For Women
Red White Checkered Plush Makeup Bag Portable Travel Toiletry Organizer Zipper Square Pouch For Women
like
Find Similar
Detailed macro view of the soft red plaid plush fabric and Hello Kitty apple logo patch - Tofu Bag (Red Plaid)
Red White Checkered Plush Makeup Bag Portable Travel Toiletry Organizer Zipper Square Pouch For Women
$2.31
No MOQ
Leopard Print Canvas Makeup Bag Portable Zippered Cosmetic Storage Pouch Animal Pattern For Women Travel Home
Leopard Print Canvas Makeup Bag Portable Zippered Cosmetic Storage Pouch Animal Pattern For Women Travel Home
like
Find Similar
Mini leopard print canvas makeup bag with black zipper and little moon label - Large
Portable leopard print canvas cosmetic bag with zipper and cute bear charm detail - Small
Leopard Print Canvas Makeup Bag Portable Zippered Cosmetic Storage Pouch Animal Pattern For Women Travel Home
-5%
$2.08-2.35
Mix MOQ : 3
Gingham Quilted Cotton Makeup Bag Rhombus Pattern Cosmetic Pouch Travel Toiletry Storage Organizer For Personal Care
Gingham Quilted Cotton Makeup Bag Rhombus Pattern Cosmetic Pouch Travel Toiletry Storage Organizer For Personal Care
like
Find Similar
Close-up of green gingham quilted makeup bag with orange zipper and pink tassel detail - Green
Quilted purple plaid cosmetic bag with green zipper and blue tassel charm on shelf - Purple
Quilted blue checkered makeup bag with white grid pattern and bright yellow zipper - Blue
Detail of orange checkered quilted makeup bag showing soft fabric texture and yellow zipper - Orange
Gingham Quilted Cotton Makeup Bag Rhombus Pattern Cosmetic Pouch Travel Toiletry Storage Organizer For Personal Care
$3.01
No MOQ
Quilted Cosmetic Bag Heart Bear Pattern Polyester Travel Toiletry Organizer Makeup Pouch Zipper Closure For Women
Quilted Cosmetic Bag Heart Bear Pattern Polyester Travel Toiletry Organizer Makeup Pouch Zipper Closure For Women
like
Find Similar
Detailed shot of white quilted cosmetic bag featuring 3D bear pattern and soft texture - Creamy White
Detailed close-up of light pink quilted makeup bag featuring a May Rabbit woven label - Pink
Detail view of black quilted fabric makeup bag with white May Rabbit brand label - Black
Close-up of a lavender quilted cosmetic bag with a cute bear pattern and logo label - Purple
+1
Quilted Cosmetic Bag Heart Bear Pattern Polyester Travel Toiletry Organizer Makeup Pouch Zipper Closure For Women
$3.16
No MOQ
Cow Print Plush Makeup Bag Soft Zipper Cosmetic Pouch Travel Storage Organizer Portable Handbag
Cow Print Plush Makeup Bag Soft Zipper Cosmetic Pouch Travel Storage Organizer Portable Handbag
like
Find Similar
Plush cow print coin purse with Time to Party label and beige zipper closure - Cow Print Plush Makeup Bag
Cow Print Plush Makeup Bag Soft Zipper Cosmetic Pouch Travel Storage Organizer Portable Handbag
-4%
$2.44
No MOQ
 · 
29 sold recently
Nylon Makeup Bag Pink Bows Large Capacity Portable Travel Toiletry Case Organizer For Women Ins Style Black
Nylon Makeup Bag Pink Bows Large Capacity Portable Travel Toiletry Case Organizer For Women Ins Style Black
like
Find Similar
Cute black cosmetic bag with pink bows and large capacity for skincare storage - Storage Tube (Cream Pink Bow)
NewNylon Makeup Bag Pink Bows Large Capacity Portable Travel Toiletry Case Organizer For Women Ins Style Black
$4.90
No MOQ
Floral Quilted Cotton Makeup Bag Clutch Octagon Pouch Pink Large Capacity Portable Travel Toiletry Organizer For Women Sweet
Floral Quilted Cotton Makeup Bag Clutch Octagon Pouch Pink Large Capacity Portable Travel Toiletry Organizer For Women Sweet
like
Find Similar
Pink floral quilted cosmetic bag with large capacity and beige zipper handle - Pink Bouquet - Cosmetic Bag (Large)
Quilted pink makeup bag with floral patterns and a sleek ribbon zipper pull - Pink Bouquet - Octagonal Bag (Small)
Quilted floral makeup bag with pink flower pattern and large capacity for travel storage - Pink Bouquet - Handbag (Medium)
Floral Quilted Cotton Makeup Bag Clutch Octagon Pouch Pink Large Capacity Portable Travel Toiletry Organizer For Women Sweet
-5%
$2.05-3.43
No MOQ
 · 
17 views
French Pastoral Floral Makeup Bag Cotton Canvas Zipper Cosmetic Storage Pouch Portable Travel Handbag Clutch Phone Case
French Pastoral Floral Makeup Bag Cotton Canvas Zipper Cosmetic Storage Pouch Portable Travel Handbag Clutch Phone Case
like
Find Similar
Floral makeup pouch on vanity with candles, showing retro aesthetic and fabric texture - Orange Pink Floral
Detail of light green floral canvas pouch with daisy patterns and white Suakka brand tag - Blue Green Floral
French Pastoral Floral Makeup Bag Cotton Canvas Zipper Cosmetic Storage Pouch Portable Travel Handbag Clutch Phone Case
-4%
$2.71
No MOQ
Makeup Train Case PU Leather LED Mirror Waterproof Portable Cosmetic Organizer Adjustable Dividers Travel For Women
Makeup Train Case PU Leather LED Mirror Waterproof Portable Cosmetic Organizer Adjustable Dividers Travel For Women
like
Find Similar
Black leather large makeup bag with adjustable dividers and top handle 25x10x23cm - 25x23x10.5cm / Elegant Black (No Mirror)
Pink PU leather makeup box with golden zippers and adjustable dividers, 25x23x10.5cm - 25x23x10.5cm / Pink (No Mirror)
Black and white large makeup bag with adjustable dividers and dual zippers, 25x23x10.5cm - 25x23x10.5cm / Beige (No Mirror)
Portable makeup case with mirror and dividers in black and white finish, 25x23x10.5cm - 25x23x10.5cm / Beige (With Mirror)
+2
Makeup Train Case PU Leather LED Mirror Waterproof Portable Cosmetic Organizer Adjustable Dividers Travel For Women
$8.07-18.73
Mix MOQ : 2
Floral Corduroy Makeup Bag Vintage Portable Cosmetic Storage Pouch Travel Toiletry Wash Bag With Zipper For Women
Floral Corduroy Makeup Bag Vintage Portable Cosmetic Storage Pouch Travel Toiletry Wash Bag With Zipper For Women
like
Find Similar
Detail view of a floral corduroy makeup bag on a desk with glasses and a laptop - Little Red Flower
Close-up of floral embroidery on corduroy cosmetic bag with lifestyle props - Beige Wind Flower
Detailed close-up of vintage corduroy makeup bag with floral print in office setting - Brown Daisy
Floral Corduroy Makeup Bag Vintage Portable Cosmetic Storage Pouch Travel Toiletry Wash Bag With Zipper For Women
$1.99
No MOQ
Celestial Sun Moon Print Makeup Bag Linen Fabric Cosmetic Pouch With Wrist Strap Portable Toiletry Organizer For Women
Celestial Sun Moon Print Makeup Bag Linen Fabric Cosmetic Pouch With Wrist Strap Portable Toiletry Organizer For Women
like
Find Similar
Cream canvas cosmetic bag featuring yellow sun and moon prints with black wrist strap - 17*25cm (Linen) with Strap / Celestial Sun Moon Pattern (Style 1)
Celestial Sun Moon Print Makeup Bag Linen Fabric Cosmetic Pouch With Wrist Strap Portable Toiletry Organizer For Women
$1.44
No MOQ
Quilted Cotton Checkerboard Cosmetic Bag Portable Toiletry Storage Pouch With Contrast Zipper Handle For Women Travel
Quilted Cotton Checkerboard Cosmetic Bag Portable Toiletry Storage Pouch With Contrast Zipper Handle For Women Travel
like
Find Similar
Close-up of quilted orange grid toiletry bag with cotton tassel and stitched brand label - Orange
Quilted green and white checkered makeup bag with vibrant orange zipper and long fringe - Green
Detail of navy blue plaid quilted makeup bag with handle and double yellow zippers - Blue
Detail of purple quilted cosmetic bag with contrast green zipper and blue puller - Purple
+1
Quilted Cotton Checkerboard Cosmetic Bag Portable Toiletry Storage Pouch With Contrast Zipper Handle For Women Travel
-4%
$3.43
No MOQ
Quilted Cotton Makeup Bag Stripe Polka Dot Travel Cosmetic Organizer Pouch Zipper Storage Case For Women Girls
Quilted Cotton Makeup Bag Stripe Polka Dot Travel Cosmetic Organizer Pouch Zipper Storage Case For Women Girls
like
Find Similar
Quilted cotton striped cosmetic bag with handle and colorful polka dot pattern - Large Handheld
Quilted cotton makeup bag with colorful stripes and polka dots for travel storage - M
Quilted cotton cosmetic bag with yellow polka dots and red stripes on a wooden desk - Pencil Case
Quilted Cotton Makeup Bag Stripe Polka Dot Travel Cosmetic Organizer Pouch Zipper Storage Case For Women Girls
-5%
$1.48-3.12
No MOQ
Cute Cartoon Cat Print Canvas Makeup Bag With Zipper And Wristlet Strap Portable Cosmetic Pouch For Travel Daily Use
Cute Cartoon Cat Print Canvas Makeup Bag With Zipper And Wristlet Strap Portable Cosmetic Pouch For Travel Daily Use
like
Find Similar
Canvas makeup bag with black cat illustration and HAPPY EVERY DAY text on off-white fabric - Cartoon Cat (Style 1) / 17x25cm (Fine Linen) with Webbing
Cute Cartoon Cat Print Canvas Makeup Bag With Zipper And Wristlet Strap Portable Cosmetic Pouch For Travel Daily Use
-4%
$1.37
No MOQ
Floral Canvas Makeup Bag Small Toiletry Pouch Cosmetic Storage Clutch With Zipper And Tether For Women
Floral Canvas Makeup Bag Small Toiletry Pouch Cosmetic Storage Clutch With Zipper And Tether For Women
like
Find Similar
Floral canvas mini makeup bag in mint green with pink zipper and Sozakka label - Pink Floral
Floral canvas cosmetic pouch with blue flower pattern and Sozakka woven label - Blue Floral
Floral Canvas Makeup Bag Small Toiletry Pouch Cosmetic Storage Clutch With Zipper And Tether For Women
-5%
$1.89
No MOQ
Linen Makeup Bag Heart Printed XOXO Cosmetic Pouch With Zipper And Wristlet For Travel Valentine Gift
Linen Makeup Bag Heart Printed XOXO Cosmetic Pouch With Zipper And Wristlet For Travel Valentine Gift
like
Find Similar
Portable heart print makeup bag with zipper and hand strap on white background - Black Vine Heart Style (款式1)
Cream canvas cosmetic bag with red I Heart U print and sturdy black zipper handle - Beige I Heart U Style (款式2)
Black canvas cosmetic bag with red heart pattern and portable wrist strap - Black Spiral Heart Style (款式3)
Portable cream canvas cosmetic bag with red heart pattern and XOXO print for women - Beige XOXO Heart Style (款式4)
NewLinen Makeup Bag Heart Printed XOXO Cosmetic Pouch With Zipper And Wristlet For Travel Valentine Gift
-4%
$1.37
No MOQ
Plush Makeup Bag Large Capacity Soft Lamb Wool Cosmetic Pouch With Handle Travel Wash Organizer For Women Girls Cute
Plush Makeup Bag Large Capacity Soft Lamb Wool Cosmetic Pouch With Handle Travel Wash Organizer For Women Girls Cute
like
Find Similar
Black plush cosmetic bag with pink zipper and soft handle for portable storage - Black
Plush Makeup Bag Large Capacity Soft Lamb Wool Cosmetic Pouch With Handle Travel Wash Organizer For Women Girls Cute
$4.29
Mix MOQ : 2
Quilted Cotton Cosmetic Bag Travel Makeup Toiletry Pouch Floral Bear Pattern Cute Style Portable Organizer
Quilted Cotton Cosmetic Bag Travel Makeup Toiletry Pouch Floral Bear Pattern Cute Style Portable Organizer
like
Find Similar
Quilted floral bear makeup bag with large capacity and ribbon zipper handle for travel - Purple Floral Teddy Bear Cosmetic Bag
Detailed macro view of quilted makeup bag with purple floral print and teddy bear patterns - Purple Floral Teddy Bear Handheld Pouch
Quilted floral teddy bear makeup bag with 'today, mood' label and top zipper - Purple Floral Teddy Bear Octagonal Pouch
Quilted Cotton Cosmetic Bag Travel Makeup Toiletry Pouch Floral Bear Pattern Cute Style Portable Organizer
-5%
$2.19-3.81
No MOQ
Quilted Floral Patchwork Cosmetic Bag Polyester Portable Travel Toiletry Makeup Organizer Pouch For Women
Quilted Floral Patchwork Cosmetic Bag Polyester Portable Travel Toiletry Makeup Organizer Pouch For Women
like
Find Similar
Quilted floral makeup bag with light blue pattern and large capacity for travel - Patchwork Floral (Octagonal Bag)
Quilted Floral Patchwork Cosmetic Bag Polyester Portable Travel Toiletry Makeup Organizer Pouch For Women
$2.16
No MOQ
Quilted Plaid Cosmetic Bag Cotton Large Capacity Portable Travel Toiletry Organizer Handbag With Handle Zipper Closure
Quilted Plaid Cosmetic Bag Cotton Large Capacity Portable Travel Toiletry Organizer Handbag With Handle Zipper Closure
like
Find Similar
Detailed view of quilted cotton cosmetic bag featuring green plaid pattern and logo label - Verdant
Detailed view of pink and yellow quilted cotton cosmetic bag with handle and zipper - Yellow Pink
Quilted Plaid Cosmetic Bag Cotton Large Capacity Portable Travel Toiletry Organizer Handbag With Handle Zipper Closure
-5%
$3.97
No MOQ
 · 
10 views
Waterproof PVC Transparent Toiletry Bag Portable Travel Makeup Organizer Zippered Clear Cosmetic Pouch For Women
Waterproof PVC Transparent Toiletry Bag Portable Travel Makeup Organizer Zippered Clear Cosmetic Pouch For Women
like
Find Similar
Four-piece set of transparent PVC waterproof toiletry bags for travel makeup storage - 30 Wire Mini Size 15*10.5*7 / Black
Three sizes of yellow waterproof PVC travel cosmetic storage bags with clear design - 15 Wire Small 15*7*10.5 / Yellow
Set of 3 blue waterproof PVC toiletry bags in large, medium, and small travel sizes - 15 Wire Medium 18*5.5*12.5 / Blue
Three-piece set of transparent pink waterproof PVC cosmetic bags in varying sizes - 15 Wire Medium 18*5.5*12.5 / Rose Red
+39
Waterproof PVC Transparent Toiletry Bag Portable Travel Makeup Organizer Zippered Clear Cosmetic Pouch For Women
-23%
$0.30-2.30
No MOQ
 · 
78% reordered
Top 3% Best Sellers
in Women Bags
Quilted Makeup Bag Cloud Heart Pattern Polyester Large Capacity Travel Toiletry Organizer Portable Zipper Pouch Women Sweet Style
Quilted Makeup Bag Cloud Heart Pattern Polyester Large Capacity Travel Toiletry Organizer Portable Zipper Pouch Women Sweet Style
like
Find Similar
Macro detail of a light blue quilted cloud makeup bag with zipper and logo patch - Quilted Cloud Light Blue
Detailed view of yellow quilted cloud cosmetic bag with zipper and logo patch - Quilted Cloud Yellow
Detail of pink quilted cloud cosmetic bag with brand label and secure top zipper closure - Quilted Cloud Pink
Close-up of quilted cloud texture on white cosmetic bag with fabric brand label - Quilted Cloud Milky White
Quilted Makeup Bag Cloud Heart Pattern Polyester Large Capacity Travel Toiletry Organizer Portable Zipper Pouch Women Sweet Style
$2.85
No MOQ
Floral Jacquard Canvas Cosmetic Bag Portable Toiletry Pouch Travel Makeup Organizer Aesthetic Sunflower Zip Storage Purse For Women
Floral Jacquard Canvas Cosmetic Bag Portable Toiletry Pouch Travel Makeup Organizer Aesthetic Sunflower Zip Storage Purse For Women
like
Find Similar
Floral jacquard portable makeup bag with yellow patterns and H&R BAG logo for lipsticks - Gray Green Large
Vintage jacquard makeup bag with gray and yellow floral patterns and 'H&R BAG' label - Gray Green Small
Floral Jacquard Canvas Cosmetic Bag Portable Toiletry Pouch Travel Makeup Organizer Aesthetic Sunflower Zip Storage Purse For Women
$2.62-3.11
No MOQ
Quilted Large Capacity Cosmetic Bag Floral Gingham Corduroy Makeup Storage Travel Pouch Organizer For Women
Quilted Large Capacity Cosmetic Bag Floral Gingham Corduroy Makeup Storage Travel Pouch Organizer For Women
like
Find Similar
Light blue floral quilted makeup bag with zipper and handle shown by model - Blue Floral Quilted
Pink and white checkered quilted large makeup organizer bag with decorative ribbons - Pink Plaid
Quilted Large Capacity Cosmetic Bag Floral Gingham Corduroy Makeup Storage Travel Pouch Organizer For Women
$3.16-4.18
No MOQ
Christmas Gingerbread Man Print Makeup Bag Portable Linen Toiletry Storage Pouch With Zipper And Wrist Strap For Women Travel
Christmas Gingerbread Man Print Makeup Bag Portable Linen Toiletry Storage Pouch With Zipper And Wrist Strap For Women Travel
like
Find Similar
Christmas gingerbread man pattern makeup bag with zipper closure and wrist strap - Fine Hemp / Gingerbread Man Pattern (Style 1) / 17*25cm (With Strap)
Christmas Gingerbread Man Print Makeup Bag Portable Linen Toiletry Storage Pouch With Zipper And Wrist Strap For Women Travel
-4%
$1.37
No MOQ
Cute Cartoon Bear Embroidered Sherpa Fleece Cosmetic Bag Portable Travel Toiletry Pouch Soft Teddy Fleece Organizer
Cute Cartoon Bear Embroidered Sherpa Fleece Cosmetic Bag Portable Travel Toiletry Pouch Soft Teddy Fleece Organizer
like
Find Similar
Detailed embroidery on white teddy fleece cosmetic bag featuring a cute cartoon bear motif - Bear Embroidery Handbag / White
Close-up of brown Sherpa storage bag with pink Why Bear embroidery and cute bear pattern - Bear Embroidery Handbag / Brown
Cute Cartoon Bear Embroidered Sherpa Fleece Cosmetic Bag Portable Travel Toiletry Pouch Soft Teddy Fleece Organizer
$1.44
No MOQ
Quilted Corduroy Floral Makeup Bag Portable Cosmetic Storage Pouch With Handle Zipper Closure Travel Toiletry Organizer
Quilted Corduroy Floral Makeup Bag Portable Cosmetic Storage Pouch With Handle Zipper Closure Travel Toiletry Organizer
like
Find Similar
Quilted floral corduroy cosmetic bag with top handle and blue floral print on white cotton - Makeup Bag
Quilted corduroy floral makeup bag with floral print and top zipper closure - Clutch Bag
Detail of floral corduroy makeup bag featuring quilted fabric and brand label - Octagonal Pouch
Quilted Corduroy Floral Makeup Bag Portable Cosmetic Storage Pouch With Handle Zipper Closure Travel Toiletry Organizer
-5%
$1.93-3.38
No MOQ
Checkerboard Plaid Cosmetic Bag Plush Large Capacity Travel Toiletry Organizer Portable Zipper Makeup Pouch Women
Checkerboard Plaid Cosmetic Bag Plush Large Capacity Travel Toiletry Organizer Portable Zipper Makeup Pouch Women
like
Find Similar
Detail of red and white checkered plush makeup bag with waffle texture and zipper - Red Check
Detail of green and beige checkered waffle makeup bag with soft fleece texture and zipper - Dark Green Plaid
Checkerboard Plaid Cosmetic Bag Plush Large Capacity Travel Toiletry Organizer Portable Zipper Makeup Pouch Women
$2.56
No MOQ
Quilted Cotton Makeup Bag Pouch Cute Rabbit Floral Print Portable Travel Cosmetic Storage Organizer For Women Girls
Quilted Cotton Makeup Bag Pouch Cute Rabbit Floral Print Portable Travel Cosmetic Storage Organizer For Women Girls
like
Find Similar
Quilted beige cosmetic bag featuring cute purple rabbit prints and top handle detail - Lace Purple Rabbit - [Cosmetic Bag]
Detailed close-up of quilted floral rabbit makeup bag with a soft cotton zipper strap - Lace Purple Rabbit - [Octagonal Bag]
Detail of quilted bunny floral makeup bag with lace trim and vintage woven label - Lace Purple Rabbit - [Pouch]
Quilted Cotton Makeup Bag Pouch Cute Rabbit Floral Print Portable Travel Cosmetic Storage Organizer For Women Girls
-4%
$1.99-3.44
No MOQ
Floral Plaid Polka Dot Cotton Canvas Makeup Bag Women Cosmetic Organizer Zipper Travel Toiletry Storage Pouch Bag
Floral Plaid Polka Dot Cotton Canvas Makeup Bag Women Cosmetic Organizer Zipper Travel Toiletry Storage Pouch Bag
like
Find Similar
Blue plaid makeup bag with floral print, simple wish label, and metal zipper closure - Blue and White Small Grid Floral
Detailed top view of blue checkered canvas makeup bag with small red grid accents - Blue and White Large Grid with Red Line
Close-up of white fabric pouch with colorful polka dots and simple wish cloth label - White Base Colorful Dots
Flat lay of vintage floral cloth makeup bag with simple wish label on a wooden table - Dark Blue Striped Floral
Floral Plaid Polka Dot Cotton Canvas Makeup Bag Women Cosmetic Organizer Zipper Travel Toiletry Storage Pouch Bag
$4.70
No MOQ
Quilted Checkered Cosmetic Bag Large Capacity Plaid Makeup Pouch Travel Toiletry Organizer Handbag For Women Student
Quilted Checkered Cosmetic Bag Large Capacity Plaid Makeup Pouch Travel Toiletry Organizer Handbag For Women Student
like
Find Similar
Quilted plaid makeup bag with pink and yellow checks stored in a metal basket - Pink and Yellow Plaid Quilted Diamond Handbag
Quilted Checkered Cosmetic Bag Large Capacity Plaid Makeup Pouch Travel Toiletry Organizer Handbag For Women Student
-4%
$2.88
No MOQ
Rainbow Heart Makeup Bag Fine Linen Cosmetic Pouch With Wristlet Follow The Dream Print Travel Toiletry Organizer Women
Rainbow Heart Makeup Bag Fine Linen Cosmetic Pouch With Wristlet Follow The Dream Print Travel Toiletry Organizer Women
like
Find Similar
Beige canvas makeup bag with sequin rainbow heart and Follow The Dream print - 17*25cm (Linen) with Strap / Beige Rainbow Heart Follow The Dream
Rainbow Heart Makeup Bag Fine Linen Cosmetic Pouch With Wristlet Follow The Dream Print Travel Toiletry Organizer Women
-4%
$1.37
No MOQ
Smiley Face Corduroy Makeup Bag Large Capacity Travel Cosmetic Pouch Zipper Toiletry Organizer Cute College Style
Smiley Face Corduroy Makeup Bag Large Capacity Travel Cosmetic Pouch Zipper Toiletry Organizer Cute College Style
like
Find Similar
Detail of corduroy toiletry bag with smiley embroidery and makeup accessories - Beige
Detail of pink corduroy makeup bag with black smiley face print and silver metal zipper - Pink
Corduroy smiley face makeup bag in eight colors with makeup accessories on white fabric - Khaki
Gray corduroy cosmetic bag with black smiley faces shown with Vogue magazine and makeup tools - Gray
+4
Smiley Face Corduroy Makeup Bag Large Capacity Travel Cosmetic Pouch Zipper Toiletry Organizer Cute College Style
$1.67
No MOQ
Plaid Makeup Bag Polyester Large Capacity Travel Portable Bow Ruffle Cute Sweet Style For Women
Plaid Makeup Bag Polyester Large Capacity Travel Portable Bow Ruffle Cute Sweet Style For Women
like
Find Similar
Sweet plaid makeup bag with blue bow embroidery and ruffle details in vibrant checks - Red Plaid with Bow
Pink plaid cosmetic bag featuring a blue bow embroidery and light blue zipper closure - Pink Plaid with Bow
Plaid Makeup Bag Polyester Large Capacity Travel Portable Bow Ruffle Cute Sweet Style For Women
$2.16
Mix MOQ : 2
Free Shipping
Quilted Cotton Makeup Bag Cute Cartoon Floral Print Cosmetic Pouch Zipper Closure Portable Travel Storage Organizer For Women
Quilted Cotton Makeup Bag Cute Cartoon Floral Print Cosmetic Pouch Zipper Closure Portable Travel Storage Organizer For Women
like
Find Similar
Close-up of quilted cotton makeup bag featuring vintage floral prints and zip closure - Large Cosmetic Bag
Detail view of quilted cotton makeup bag with cute floral characters and woven label - Small Touch-up Pouch
Handheld view of quilted cotton makeup bag with colorful cartoon prints and zipper - Trapezoid Storage Bag
Quilted cotton floral mini pouch with simple wish label and blue tassel zipper handle - Flat Coin Purse
Quilted Cotton Makeup Bag Cute Cartoon Floral Print Cosmetic Pouch Zipper Closure Portable Travel Storage Organizer For Women
$2.42-4.70
No MOQ
Free Shipping
Large Capacity Plush Checkerboard Cosmetic Bag Soft Travel Makeup Organizer Pouch With Star Zipper
Large Capacity Plush Checkerboard Cosmetic Bag Soft Travel Makeup Organizer Pouch With Star Zipper
like
Find Similar
Purple checkered plush cosmetic bag with a silver star pendant zipper puller - Purple Pillow Bag
White plush checkerboard cosmetic bag with elegant diamond texture and silver zipper detail - White Pillow Bag
Pink plush cosmetic bag with checkered texture and silver star zipper pull - Pink Pillow Bag
Beige plush checkered cosmetic bag with textured bubble design and silver zipper detail - Brown Pillow Bag
Large Capacity Plush Checkerboard Cosmetic Bag Soft Travel Makeup Organizer Pouch With Star Zipper
$3.57
Mix MOQ : 2
 · 
13 views
Plush Heart Makeup Bag Lamb Wool Cosmetic Pouch Sanitary Napkin Storage For Travel Portable Zipper Organizer Women
Plush Heart Makeup Bag Lamb Wool Cosmetic Pouch Sanitary Napkin Storage For Travel Portable Zipper Organizer Women
like
Find Similar
Three heart-embossed plush makeup bags in white, pink, and rose for travel storage - 14*5*14cm / Pink
Plush Heart Makeup Bag Lamb Wool Cosmetic Pouch Sanitary Napkin Storage For Travel Portable Zipper Organizer Women
-10%
$1.76
Mix MOQ : 3
Floral Print Makeup Bag Large Capacity Canvas Cosmetic Pouch Zipper Closure Bow Paisley Polka Dot Pattern Organizer For Women
Floral Print Makeup Bag Large Capacity Canvas Cosmetic Pouch Zipper Closure Bow Paisley Polka Dot Pattern Organizer For Women
like
Find Similar
Floral makeup bag with blue bow prints and brand label in a stylish lifestyle setting - Beige with Blue Bow
Close-up of pink checkered cosmetic bag with bow patterns and silver zipper detail - Pink Gingham Bow
Detail of purple plaid makeup bag with pink bow decoration on a vanity desk - Purple Gingham Bow
Detailed close-up of a black and white polka dot canvas storage bag with Sozakka brand label - Black Vertical Polka Dot
Floral Print Makeup Bag Large Capacity Canvas Cosmetic Pouch Zipper Closure Bow Paisley Polka Dot Pattern Organizer For Women
-4%
$1.62
No MOQ
Quilted Cotton Cosmetic Bag Yellow Gingham Strawberry Print Large Capacity Travel Toiletry Storage Pouch For Women
Quilted Cotton Cosmetic Bag Yellow Gingham Strawberry Print Large Capacity Travel Toiletry Storage Pouch For Women
like
Find Similar
Three-piece quilted cotton cosmetic bag set with strawberry pattern and yellow plaid design - Large / Yellow Strawberry Gingham 3-Piece Set
Quilted Cotton Cosmetic Bag Yellow Gingham Strawberry Print Large Capacity Travel Toiletry Storage Pouch For Women
$1.96-3.75
Mix MOQ : 3
Quilted Makeup Bag Large Capacity Floral Bear Print Portable Cosmetic Pouch Travel Toiletry Storage Organizer Women
Quilted Makeup Bag Large Capacity Floral Bear Print Portable Cosmetic Pouch Travel Toiletry Storage Organizer Women
like
Find Similar
Quilted cotton makeup bag with floral bear pattern and metal zipper closure - White Base Floral
Quilted cotton makeup bag featuring red cherry prints and Jimena brand woven label - White with Cherries
Quilted makeup bag with brown bear and colorful floral patterns on cream fabric - Flower Bear
Quilted cotton makeup bag featuring red floral and yellow plaid patterns with a zipper - Red Small Flowers
Quilted Makeup Bag Large Capacity Floral Bear Print Portable Cosmetic Pouch Travel Toiletry Storage Organizer Women
-5%
$2.05
No MOQ
Plaid Cosmetic Bag Polyester Canvas Grid Pattern Zipper Travel Toiletry Organizer Pouch For Women Sweet Korean Style
Plaid Cosmetic Bag Polyester Canvas Grid Pattern Zipper Travel Toiletry Organizer Pouch For Women Sweet Korean Style
like
Find Similar
Flat lay of plaid canvas makeup bag with embroidered patch and travel accessories - White
Flat lay of pink checkered fabric pouch with label on white desk with accessories - Pink
Detailed view of light blue checkered makeup bag with embroidered patches and bow - Light Blue
Detail of green seersucker plaid makeup bag with textured fabric and woven logo patch - Fruit Green
+2
Plaid Cosmetic Bag Polyester Canvas Grid Pattern Zipper Travel Toiletry Organizer Pouch For Women Sweet Korean Style
-5%
$1.89
No MOQ
Corduroy Makeup Bag Tulip Flower Print Portable Travel Cosmetic Pouch Zipper Storage Case For Women
Corduroy Makeup Bag Tulip Flower Print Portable Travel Cosmetic Pouch Zipper Storage Case For Women
like
Find Similar
Detail of beige corduroy makeup bag with purple tulip floral print and zipper - Purple Small Flowers
Close-up of corduroy makeup bag featuring yellow tulips and Time to Party woven label - Orange Small Flowers
Close-up of beige corduroy pouch featuring red tulip patterns and stitched fabric label - Red Small Flowers
Corduroy Makeup Bag Tulip Flower Print Portable Travel Cosmetic Pouch Zipper Storage Case For Women
$2.48
No MOQ
 · 
18 views
Quilted Cotton Makeup Bag Blue Floral Large Capacity Travel Toiletry Organizer With Handle Double Zipper For Women
Quilted Cotton Makeup Bag Blue Floral Large Capacity Travel Toiletry Organizer With Handle Double Zipper For Women
like
Find Similar
Close-up of quilted floral cosmetic bag with blue flower patterns and soft cotton texture - Blue Flower
Quilted Cotton Makeup Bag Blue Floral Large Capacity Travel Toiletry Organizer With Handle Double Zipper For Women
-4%
$3.26
No MOQ
Plastic Liquid Pump Dispenser Bottle Press Type For Nail Polish Remover Alcohol Makeup Remover Vintage Square Embossed
Plastic Liquid Pump Dispenser Bottle Press Type For Nail Polish Remover Alcohol Makeup Remover Vintage Square Embossed
like
Find Similar
Pink macaron nail polish remover pump bottle with black press cap for salon tools - Pink Crown Pump Bottle
Pink macaron nail pump bottle with black press head for polish remover or alcohol - Pink
Creamy white rectangular nail liquid dispenser bottle with black cap and embossed frame - White
Purple rectangular nail polish remover pump bottle with black cap and embossed border - Purple
+2
Plastic Liquid Pump Dispenser Bottle Press Type For Nail Polish Remover Alcohol Makeup Remover Vintage Square Embossed
-4%
$0.63-1.87
No MOQ
 · 
24 sold recently
Pink Quilted Cotton Cosmetic Bag Sweet Bow Pattern Travel Toiletry Organizer Handheld Makeup Pouch Storage
Pink Quilted Cotton Cosmetic Bag Sweet Bow Pattern Travel Toiletry Organizer Handheld Makeup Pouch Storage
like
Find Similar
Close-up of pink quilted makeup bag with ribbon bow patterns and soft fabric texture - Pink Ribbon Bowknot Makeup Bag
Pink quilted makeup bag with ribbon bow patterns and a secure top zipper closure - Pink Ribbon Bowknot Hand Clutch Bag
Pink quilted cosmetic bag with ribbon bows on wooden desk from multiple angles - Pink Ribbon Bowknot Octagonal Bag
Pink Quilted Cotton Cosmetic Bag Sweet Bow Pattern Travel Toiletry Organizer Handheld Makeup Pouch Storage
$2.03-3.48
No MOQ
Heart Quilted Cotton Makeup Bag With Ribbon Bow And Lace Trim Pink Sweet Cosmetic Pouch For Women Travel Storage Organizer
Heart Quilted Cotton Makeup Bag With Ribbon Bow And Lace Trim Pink Sweet Cosmetic Pouch For Women Travel Storage Organizer
like
Find Similar
Detailed view of pink quilted heart pouch with satin bow and delicate lace trim - Pure Pink Sweetheart (Storage Bag)
Heart Quilted Cotton Makeup Bag With Ribbon Bow And Lace Trim Pink Sweet Cosmetic Pouch For Women Travel Storage Organizer
-4%
$2.74
No MOQ
Quilted Cotton Floral Cosmetic Bag Ribbon Bow Toiletry Wash Bag Portable Makeup Organizer For Women Girls
Quilted Cotton Floral Cosmetic Bag Ribbon Bow Toiletry Wash Bag Portable Makeup Organizer For Women Girls
like
Find Similar
Detailed view of quilted makeup bag with rose prints, zipper closure, and ribbon patterns - Medium Trapezoid / Pink Bow Rose
Detailed macro view of quilted floral makeup bag with pink bows and rose patterns - Small Rectangle / Pink Bow Rose
Quilted floral makeup bag with pink roses and blue ribbons on a cozy desk setup - Small Rectangle / Blue Bow Rose
Quilted Cotton Floral Cosmetic Bag Ribbon Bow Toiletry Wash Bag Portable Makeup Organizer For Women Girls
$1.59-2.19
No MOQ
Quilted Cotton Gingham Makeup Bag Large Capacity Travel Toiletry Organizer Handheld Cosmetic Pouch Fresh Sweet Style
Quilted Cotton Gingham Makeup Bag Large Capacity Travel Toiletry Organizer Handheld Cosmetic Pouch Fresh Sweet Style
like
Find Similar
Detail of red gingham quilted cotton makeup bag with a soft texture and white brand label - Red Berry Plaid Quilted Handbag
Detail of red gingham quilted makeup bag featuring diamond stitching and white cotton handle - Red Berry Plaid Quilted Wristlet Bag
Detailed macro of berry checkered quilted makeup bag with zipper and woven fabric label - Blueberry Plaid Quilted Handbag
Close-up of purple gingham quilted cotton makeup bag showing soft fabric texture and zipper - Blueberry Plaid Quilted Wristlet Bag
+1
Quilted Cotton Gingham Makeup Bag Large Capacity Travel Toiletry Organizer Handheld Cosmetic Pouch Fresh Sweet Style
-5%
$1.69-3.27
No MOQ
Cosmetic Bag Cotton Canvas Zipper Portable Large Capacity Travel Storage Pouch Vintage Floral Star Patterns For Women
Cosmetic Bag Cotton Canvas Zipper Portable Large Capacity Travel Storage Pouch Vintage Floral Star Patterns For Women
like
Find Similar
Blue denim clover pattern makeup bag held by a model in a cozy lifestyle setting - Light Blue Clover
Close-up of blue polka dot makeup bag with silver zipper and white fabric label - Light Blue Polka Dot
Close-up of navy canvas makeup bag with white stars and stylish woven label detail - Dark Blue Stars
Detail of dark blue floral canvas makeup bag held by hand in a cozy lifestyle setting - Dark Blue Clover
+1
NewCosmetic Bag Cotton Canvas Zipper Portable Large Capacity Travel Storage Pouch Vintage Floral Star Patterns For Women
$2.28
No MOQ
Go to

More in home & kitchen

Explore more in travel bottles

steelstrapalloysleevewallmetaldisplayshapedesignshoulder
plasticpetkidssquarewindowcare316 stainless steeladjustablegoldcover

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access