Everful

Wholesale travel bottles

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Travel Bottles

Find the perfect pieces: vacuum flasks & thermoses, tumblers, mugs and more

All products in travel bottles

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Corduroy Quilted Makeup Bag Large Capacity Tulip Flower Cosmetic Organizer Portable Toiletry Storage Pouch For Women
Corduroy Quilted Makeup Bag Large Capacity Tulip Flower Cosmetic Organizer Portable Toiletry Storage Pouch For Women
like
Find Similar
Beige quilted corduroy cosmetic bag with pink handle and floral zipper charm - Square Bag / Beige
Pink corduroy makeup bag with blue flower applique and pleated handle strap - Wristlet / Pink
Beige corduroy makeup bag with pink tulip embroidery and side handle loop detail - Wristlet / Beige
Light blue corduroy makeup bag with pink floral plush detail and pleated top handle - Wristlet / Sky Blue
+4
Corduroy Quilted Makeup Bag Large Capacity Tulip Flower Cosmetic Organizer Portable Toiletry Storage Pouch For Women
$1.67-2.59
No MOQ
 · 
38 views
Quilted Cosmetic Bag Polyester Bow Embroidery Portable Travel Makeup Pouch Zipper Organizer For Women
Quilted Cosmetic Bag Polyester Bow Embroidery Portable Travel Makeup Pouch Zipper Organizer For Women
like
Find Similar
Quilted black makeup bag with pink bow embroidery on a vanity with cosmetics - 16x9x9cm / Black
Pink quilted lipstick storage bag with black embroidery and silver zipper for travel - 16x9x9cm / Pink
Quilted cream cosmetic bag with black embroidery and silver zipper for makeup storage - 16x9x9cm / Beige
Light blue quilted lipstick pouch with black embroidery and zipper for women - 16x9x9cm / Light Blue
Quilted Cosmetic Bag Polyester Bow Embroidery Portable Travel Makeup Pouch Zipper Organizer For Women
$1.67
Mix MOQ : 3
House Shaped Makeup Bag Quilted Nylon Large Capacity Handheld Travel Toiletry Organizer Cute Portable Cosmetic Case
House Shaped Makeup Bag Quilted Nylon Large Capacity Handheld Travel Toiletry Organizer Cute Portable Cosmetic Case
like
Find Similar
Detail of house-shaped toiletry bag with blue quilted roof texture and yellow button handle - Blue Roof
Quilted house shaped makeup bag with pink and blue dopamine colors for travel - Pink Roof
Detail of house-shaped travel makeup bag with red checkered accents and sturdy top handle - White Roof
Cute house-shaped travel makeup bag with large capacity and portable red and blue handle - Red Roof
House Shaped Makeup Bag Quilted Nylon Large Capacity Handheld Travel Toiletry Organizer Cute Portable Cosmetic Case
-4%
$4.62
No MOQ
Plush Makeup Bag Jacquard Bowknot Pattern Portable Travel Toiletry Pouch Zipper Closure Cosmetic Storage Case
Plush Makeup Bag Jacquard Bowknot Pattern Portable Travel Toiletry Pouch Zipper Closure Cosmetic Storage Case
like
Find Similar
Close-up of pink plush makeup bag with red 3D embroidered bow patterns and brand label - Pink Base Red Bow Large / 26x18cm
Detail of pink faux fur makeup bag with red bow pattern and metal zip on a wooden tray - Pink Base Red Bow Medium Pillow Bag / 17x14x11cm
Close-up of a pink plush cosmetic bag with red heart patterns and a floral gold zipper - Pink Base Red Bow Small / 17x14cm
Detail of soft pink plush makeup bag with 3D bow pattern and H&R BAG brand label - Pink Base Pink Bow Large / 26x18cm
+5
Plush Makeup Bag Jacquard Bowknot Pattern Portable Travel Toiletry Pouch Zipper Closure Cosmetic Storage Case
$2.25-3.11
No MOQ
Travel Refillable Toiletry Containers For Shampoo Lotion Spray Cream Clear Storage Bag Plastic Leak-Proof Portable
Travel Refillable Toiletry Containers For Shampoo Lotion Spray Cream Clear Storage Bag Plastic Leak-Proof Portable
like
Find Similar
7-piece travel toiletry set in mint green with bottles, comb and mirror in PVC bag - SY763-Green (50ml Empty Bottle + Mirror & Comb Set)
Pink 7-piece travel refillable bottle set including pump bottles and cream jars - SY760-Pink (50ml Empty Bottle + Cream Jar Set)
Green travel toiletry bottle set including spray bottles and jars in a clear pouch - SY760-Green (50ml Empty Bottle + Cream Jar Set)
Purple travel bottle set includes spray pump bottles and cream jars in a PVC storage bag - SY760-Purple (50ml Empty Bottle + Cream Jar Set)
+2
Travel Refillable Toiletry Containers For Shampoo Lotion Spray Cream Clear Storage Bag Plastic Leak-Proof Portable
-5%
$1.37-1.42
Mix MOQ : 3
 · 
347 sold recently
Top 5% Best Sellers
in Beauty Tools & Accessories
Quilted Cotton Makeup Bag Large Capacity Gingham Bow Print Toiletry Organizer Portable Zipper Cosmetic Pouch Women
Quilted Cotton Makeup Bag Large Capacity Gingham Bow Print Toiletry Organizer Portable Zipper Cosmetic Pouch Women
like
Find Similar
Pink checkered quilted makeup bag with red bows, 23x6x18cm large cosmetic storage bag - Pink Clutch Bag
Purple plaid makeup bag with pink bow pattern and metal zipper, 23x18x6cm size - Light Purple Clutch Bag
Yellow checkered quilted makeup bag with pink bow pattern and top zipper closure - Light Yellow Clutch Bag
Pink checkered barrel vanity bag with red bow pattern and top handle for toiletries - Pink Barrel Bag
+13
Quilted Cotton Makeup Bag Large Capacity Gingham Bow Print Toiletry Organizer Portable Zipper Cosmetic Pouch Women
$1.79-3.40
Mix MOQ : 2
 · 
32 sold recently
Jacquard Floral Makeup Bag Large Capacity Travel Cosmetic Storage Pouch Portable Canvas Organizer For Women Zippered Case
Jacquard Floral Makeup Bag Large Capacity Travel Cosmetic Storage Pouch Portable Canvas Organizer For Women Zippered Case
like
Find Similar
Floral jacquard cosmetic bag in light blue shown with makeup brushes on an elegant tray - Blue White Floral
Close-up of light blue floral jacquard makeup bag with woven label on a white tray - Green with Beige Flowers
Detail of pink floral jacquard makeup bag with H&R BAG label on a white tray - Purple with Blue Flowers
Jacquard Floral Makeup Bag Large Capacity Travel Cosmetic Storage Pouch Portable Canvas Organizer For Women Zippered Case
$2.82
No MOQ
 · 
24 views
Floral Succulent Makeup Bag Portable Zipper Cosmetic Pouch Linen Polyester Travel Toiletry Organizer For Women
Floral Succulent Makeup Bag Portable Zipper Cosmetic Pouch Linen Polyester Travel Toiletry Organizer For Women
like
Find Similar
Floral makeup bag with green succulent print, gold trim details, and side wristlet strap - Realistic Succulent Pattern (Style 1)
Portable makeup bag featuring green succulent leaf prints and a black wrist strap - Aloe Leaf Pattern (Style 2)
Floral makeup bag featuring green leaf prints and portable black wrist strap - Layered Green Leaves Pattern (Style 3)
Floral makeup bag with green leaf print, zipper closure and wrist strap for travel - Branching Green Plant Pattern (Style 4)
Floral Succulent Makeup Bag Portable Zipper Cosmetic Pouch Linen Polyester Travel Toiletry Organizer For Women
$1.44
No MOQ
Cute Big Eyes Mesh Makeup Bag PVC Oxford Cloth Transparent Travel Cosmetic Pouch Portable Organizer Zippered Storage Case
Cute Big Eyes Mesh Makeup Bag PVC Oxford Cloth Transparent Travel Cosmetic Pouch Portable Organizer Zippered Storage Case
like
Find Similar
Black mesh travel storage bag with large eye design for makeup and accessories - Small Black
Green mesh makeup organizer bag with cute eye embroidery stored in a canvas tote bag - Small Green
Compact orange mesh travel organizer pouch featuring large embroidered eyes design - Small Orange
Pink mesh storage bag with cartoon eye patch for travel toiletries and makeup items - Small Pink
+4
Cute Big Eyes Mesh Makeup Bag PVC Oxford Cloth Transparent Travel Cosmetic Pouch Portable Organizer Zippered Storage Case
$2.16-2.45
No MOQ
 · 
32 views
Quilted Makeup Bag Puffer Cosmetic Pouch Waterproof PU Leather Travel Toiletry Storage Organizer Portable Lightweight
Quilted Makeup Bag Puffer Cosmetic Pouch Waterproof PU Leather Travel Toiletry Storage Organizer Portable Lightweight
like
Find Similar
Silver quilted padded makeup bag with horizontal metallic finish for travel cosmetics - Silver
Quilted black pouch with Soda Blue label, puffy horizontal stripes for travel skincare - Black
Macro view of white quilted puffer cosmetic bag with zipper and Soda Blue brand label - White
Quilted Makeup Bag Puffer Cosmetic Pouch Waterproof PU Leather Travel Toiletry Storage Organizer Portable Lightweight
$2.24
No MOQ
Butterfly Flower Print Makeup Bag Linen Zipper Cosmetic Pouch Portable Travel Toiletry Organizer For Women
Butterfly Flower Print Makeup Bag Linen Zipper Cosmetic Pouch Portable Travel Toiletry Organizer For Women
like
Find Similar
Light blue fabric cosmetic bag with blue butterfly and pink flower print with wristlet - Blue Butterfly Composition 1 (xy-073-1) / 17*25cm With Webbing
Blue makeup bag with butterfly floral print, featuring a zipper and portable hand strap - Blue Butterfly Composition 2 (xy-073-2) / 17*25cm With Webbing
Light blue cosmetic bag featuring a large watercolor butterfly and cherry blossoms - Blue Butterfly Composition 3 (xy-073-3) / 17*25cm With Webbing
Light blue canvas makeup bag with butterfly and flower print, zipper and wristlet strap - Blue Butterfly Composition 4 (xy-073-4) / 17*25cm With Webbing
+4
Butterfly Flower Print Makeup Bag Linen Zipper Cosmetic Pouch Portable Travel Toiletry Organizer For Women
-5%
$1.26-1.31
No MOQ
Large Capacity Makeup Bag PU Leather Waterproof Travel Toiletry Case Partitioned Portable Organizer For Cosmetics
Large Capacity Makeup Bag PU Leather Waterproof Travel Toiletry Case Partitioned Portable Organizer For Cosmetics
like
Find Similar
Pink PU leather square makeup bag with airplane logo and travel storage text - Pink
Elegant black PU leather travel toiletry bag with handle and TRAVEL embossed logo - Black
Light green PU leather travel makeup bag with top handle and double zipper closure - Green
Large Capacity Makeup Bag PU Leather Waterproof Travel Toiletry Case Partitioned Portable Organizer For Cosmetics
$3.03
No MOQ
Butterfly Moon Star Print Cosmetic Bag Polyester Linen Toiletry Pouch Wrist Strap Women Travel Organizer
Butterfly Moon Star Print Cosmetic Bag Polyester Linen Toiletry Pouch Wrist Strap Women Travel Organizer
like
Find Similar
Cosmetic bag with black and white butterfly print, moon and sun motifs, zip closure - 17x25cm / Butterfly Moon Star Print
Butterfly Moon Star Print Cosmetic Bag Polyester Linen Toiletry Pouch Wrist Strap Women Travel Organizer
-4%
$1.37
No MOQ
Cosmetic Bag Plush Makeup Organizer Soft Faux Fur Zipper Pouch Large Capacity Travel Toiletries Case For Women Girls
Cosmetic Bag Plush Makeup Organizer Soft Faux Fur Zipper Pouch Large Capacity Travel Toiletries Case For Women Girls
like
Find Similar
Close-up of light blue plush makeup bag with slogan label and soft focused background - Blue
Detail of soft brown plush pouch showing fluffy texture and minimalist brand label - Brown
Cosmetic Bag Plush Makeup Organizer Soft Faux Fur Zipper Pouch Large Capacity Travel Toiletries Case For Women Girls
-4%
$1.84
Mix MOQ : 2
 · 
35 views
Large Capacity Quilted Satin Cosmetic Bag With Butterfly Embossed Bow Decor Travel Portable Toiletry Makeup Organizer
Large Capacity Quilted Satin Cosmetic Bag With Butterfly Embossed Bow Decor Travel Portable Toiletry Makeup Organizer
like
Find Similar
Pink satin quilted 3-piece makeup bag set with handle and embroidered butterfly pattern - Large / Pink
Three-piece set of silver metallic quilted makeup bags with cute bow texture design - Large / Silver
Quilted PU bow cosmetic bag set with heart pouch on bed for travel storage - Large / Beige
+6
Large Capacity Quilted Satin Cosmetic Bag With Butterfly Embossed Bow Decor Travel Portable Toiletry Makeup Organizer
$1.87-3.60
No MOQ
Corduroy Square Makeup Bag Solid Color Small Cosmetic Storage Pouch Portable Zippered Purse Women Girls Simple Travel
Corduroy Square Makeup Bag Solid Color Small Cosmetic Storage Pouch Portable Zippered Purse Women Girls Simple Travel
like
Find Similar
Detail view of cream corduroy cosmetic bag with pink knot zipper and brand label - Milk White
Detailed texture of khaki corduroy makeup bag with a green zipper pull on vintage books - Apricot
Detail view of grey corduroy makeup pouch with pink strap and metal zipper on white desk - Gray
Detail of pink corduroy makeup bag with green zipper puller on a white desk - Nude Pink
+7
Corduroy Square Makeup Bag Solid Color Small Cosmetic Storage Pouch Portable Zippered Purse Women Girls Simple Travel
$1.67
No MOQ
 · 
39 views
Makeup Bag Linen Polyester Blend Zipper Cosmetic Pouch Portable Wristlet Strap Creative Letter Print Travel Storage For Women
Makeup Bag Linen Polyester Blend Zipper Cosmetic Pouch Portable Wristlet Strap Creative Letter Print Travel Storage For Women
like
Find Similar
Canvas makeup bag with 'I'M NOT PERFECT' slogan and black side handle strap - Eyeliner Quote Illustration (Style 1)
Portable cream canvas cosmetic bag with LOVE lipstick print and black wristlet strap - Makeup LOVE Alphabet (Style 2)
Makeup Bag Linen Polyester Blend Zipper Cosmetic Pouch Portable Wristlet Strap Creative Letter Print Travel Storage For Women
$1.44
No MOQ
Pink Bubble Texture Makeup Bag Large Capacity Canvas Cosmetic Travel Organizer Portable Zipper Storage Pouch For Women
Pink Bubble Texture Makeup Bag Large Capacity Canvas Cosmetic Travel Organizer Portable Zipper Storage Pouch For Women
like
Find Similar
Pink bubble fabric travel makeup bag with H & R logo on a stylish chair - Pink
Pink Bubble Texture Makeup Bag Large Capacity Canvas Cosmetic Travel Organizer Portable Zipper Storage Pouch For Women
$3.11
No MOQ
Mesh Cosmetic Bag Travel Toiletry Organizer Nylon Grid Portable Makeup Pouch Contrast Color Zipper Lightweight
Mesh Cosmetic Bag Travel Toiletry Organizer Nylon Grid Portable Makeup Pouch Contrast Color Zipper Lightweight
like
Find Similar
Semicircle mesh makeup bag in lilac and yellow with bear patch and zipper closure - Semicircle Style / Light Purple
Rose pink mesh makeup bag with zipper and BEAR label on a white surface - Semicircle Style / Rose Red
Semi-circle mesh cosmetic bag in coral pink with light blue zipper trim and bear patch - Semicircle Style / Orange
Mesh makeup bag in grey and orange color block featuring the BEAR logo on a white background - Semicircle Style / Gray
+8
Mesh Cosmetic Bag Travel Toiletry Organizer Nylon Grid Portable Makeup Pouch Contrast Color Zipper Lightweight
$1.59-2.11
No MOQ
Floral Lace Mesh Makeup Bag Portable Cosmetic Storage Pouch For Travel Women Elegant Zipper Handbag Handheld Organizer
Floral Lace Mesh Makeup Bag Portable Cosmetic Storage Pouch For Travel Women Elegant Zipper Handbag Handheld Organizer
like
Find Similar
Floral mesh cosmetic bag in beige with yellow flower patterns and size dimensions - Pillow Bag / Beige
Pink floral lace makeup pouch with silver petal zipper and brand label, 14x10cm size - Small Flat Bag / Pink
Beige floral mesh makeup bag with lace details and dimensions for daily skincare storage - Hexagonal Bag / Beige
Pink floral lace makeup bag in hexagonal shape with zipper closure weighing 62g - Hexagonal Bag / Pink
+5
Floral Lace Mesh Makeup Bag Portable Cosmetic Storage Pouch For Travel Women Elegant Zipper Handbag Handheld Organizer
$1.50-2.31
Mix MOQ : 2
Artistic Floral Makeup Bag Linen Zippered Cosmetic Pouch With Wrist Strap Landscape Oil Painting Travel Toiletry Organizer For Women
Artistic Floral Makeup Bag Linen Zippered Cosmetic Pouch With Wrist Strap Landscape Oil Painting Travel Toiletry Organizer For Women
like
Find Similar
Floral makeup bag with pink peony and mountain art print with wrist strap - Peony Pavilion (款式1)
Floral makeup bag with blue mountain print and black wrist strap for storage - Blue Mountain Gold Tower (款式2)
Impressionist mountain and peony floral canvas makeup bag with zipper and handle strap - Cloud Sea Snow Mountain (款式3)
Floral canvas makeup bag with vintage white peony print and Chinese cloud patterns - Ink Blue Peony (款式4)
Artistic Floral Makeup Bag Linen Zippered Cosmetic Pouch With Wrist Strap Landscape Oil Painting Travel Toiletry Organizer For Women
-4%
$1.37
No MOQ
Jacquard Floral Makeup Bag Large Capacity Butterfly Embossed Toiletry Bag Handheld Portable Travel Organizer For Women
Jacquard Floral Makeup Bag Large Capacity Butterfly Embossed Toiletry Bag Handheld Portable Travel Organizer For Women
like
Find Similar
Macro view of embossed floral makeup bag with dual zippers and sturdy top handle - Pink Green Floral
Close-up of butterfly jacquard makeup bag with gold metal double zipper and handle - Colorful Butterfly
Pink jacquard makeup bag with relief texture, top handle, and dual zipper closure detail - Pink Background Bow
Close-up of floral embossed jacquard makeup bag with sturdy handle and dual zippers - Egg Yolk Flower
Jacquard Floral Makeup Bag Large Capacity Butterfly Embossed Toiletry Bag Handheld Portable Travel Organizer For Women
$4.84
No MOQ
Floral Plant Pattern Makeup Bag Fine Linen Cosmetic Pouch With Zipper And Wrist Strap For Women Travel Wash Storage
Floral Plant Pattern Makeup Bag Fine Linen Cosmetic Pouch With Zipper And Wrist Strap For Women Travel Wash Storage
like
Find Similar
Floral canvas makeup bag with blue leaf print and black zipper handle strap - Blue Artistic Leaves (Style 1)
Trapezoidal makeup bag with blue and purple leaf patterns and a black wrist strap - Blue and Purple Veined Leaves (Style 2)
Canvas floral cosmetic bag featuring blue leaf pattern and portable black wrist strap - Purple Mist Foliage (Style 3)
Floral makeup bag featuring blue leaf pattern and sturdy black zipper closure - Cyan Blue Gradient Botanical (Style 4)
Floral Plant Pattern Makeup Bag Fine Linen Cosmetic Pouch With Zipper And Wrist Strap For Women Travel Wash Storage
$1.44
No MOQ
Quilted Cotton Cosmetic Bag Floral Bear Print Large Capacity Travel Toiletry Organizer Portable Zipper Storage Pouch Bag
Quilted Cotton Cosmetic Bag Floral Bear Print Large Capacity Travel Toiletry Organizer Portable Zipper Storage Pouch Bag
like
Find Similar
Three-piece set of beige quilted cosmetic bags with cute bear pattern in various sizes - Bear Design Large (23x14.5x14)
Quilted cotton cosmetic bag with blue floral pattern and elegant white ribbon zipper - Dark Blue Ribbon Flower Small (19x7x6)
Quilted floral makeup bag with blue flower print and vintage ribbon zipper detail - Dark Blue Ribbon Flower Medium (25x18x7)
Detail of quilted floral makeup bag with blue begonia print and white bow handle - Dark Blue Ribbon Flower Large (23x14.5x14)
+8
Quilted Cotton Cosmetic Bag Floral Bear Print Large Capacity Travel Toiletry Organizer Portable Zipper Storage Pouch Bag
-5%
$1.56-3.43
No MOQ
 · 
49 views
Floral Plant Print Cosmetic Bag Imitation Linen Makeup Pouch With Zipper And Wristlet For Travel Toiletries Storage Women
Floral Plant Print Cosmetic Bag Imitation Linen Makeup Pouch With Zipper And Wristlet For Travel Toiletries Storage Women
like
Find Similar
Floral print cosmetic bag in dark green featuring realistic leaf patterns and hand strap - Fine Hemp / Dark Green Seaweed Style / 17*25cm With Webbing
Floral makeup bag with dark green tropical leaves pattern and a black zipper closure - Fine Hemp / Tropical Plant Leaf Style / 17*25cm With Webbing
Green cosmetic bag with bamboo leaf print and durable zipper for travel storage - Fine Hemp / Fresh Emerald Bamboo Leaf Style / 17*25cm With Webbing
Floral makeup bag with lush green leaf pattern and secure zipper closure and hand strap - Fine Hemp / Lush Green Leaf Style / 17*25cm With Webbing
Floral Plant Print Cosmetic Bag Imitation Linen Makeup Pouch With Zipper And Wristlet For Travel Toiletries Storage Women
-4%
$1.37
No MOQ
Valentine's Day Heart Print Cosmetic Bag Polyester Zippered Makeup Pouch Foldable Travel Toiletry Organizer Women
Valentine's Day Heart Print Cosmetic Bag Polyester Zippered Makeup Pouch Foldable Travel Toiletry Organizer Women
like
Find Similar
Foldable Valentine heart makeup bag in cream canvas featuring red be mine print - Pattern 1
Pink striped Valentine's Day makeup bag with red roses and festive greeting print - Pattern 2
Foldable cosmetic bag with red buffalo plaid pattern and large white heart design - Pattern 3
Foldable cosmetic bag with heart print patterns and black zipper closure for Valentine - Pattern 4
+17
Valentine's Day Heart Print Cosmetic Bag Polyester Zippered Makeup Pouch Foldable Travel Toiletry Organizer Women
-4%
$0.96
Mix MOQ : 2
 · 
39 sold recently
Floral Pattern Makeup Bag Imitation Linen Zipper Toiletry Pouch Travel Organizer With Wrist Strap Portable For Women
Floral Pattern Makeup Bag Imitation Linen Zipper Toiletry Pouch Travel Organizer With Wrist Strap Portable For Women
like
Find Similar
Red floral makeup bag with leaf pattern, black zipper closure and portable wrist strap - Red Leaf Vein Style (Style 1)
Floral canvas makeup bag with vibrant red flower print and black wristlet strap - Hibiscus Floral Style (Style 2)
Floral canvas makeup bag with vibrant red flowers, black zipper, and wristlet strap - Bold Peony Style (Style 3)
Vibrant orange floral storage pouch with black zipper and wrist strap detail - Coral Petal Style (Style 4)
Floral Pattern Makeup Bag Imitation Linen Zipper Toiletry Pouch Travel Organizer With Wrist Strap Portable For Women
-4%
$1.37
No MOQ
Heart Pattern Quilted Makeup Bag PU Leather Waterproof Cosmetic Pouch Macaron Color Travel Toiletry Organizer Handheld Case
Heart Pattern Quilted Makeup Bag PU Leather Waterproof Cosmetic Pouch Macaron Color Travel Toiletry Organizer Handheld Case
like
Find Similar
Light green PVC makeup bag with colorful heart patterns and secure zipper closure - Green
Pink PVC heart pattern makeup bag with wavy quilting on white Arletta book - Pink
Light purple PVC makeup bag with colorful heart patterns and V-quilted texture - Purple
Light blue heart pattern quilted PVC makeup bag with a zipper and sweet gradient style - Blue
Heart Pattern Quilted Makeup Bag PU Leather Waterproof Cosmetic Pouch Macaron Color Travel Toiletry Organizer Handheld Case
$1.73
Mix MOQ : 3
 · 
15 sold recently
Makeup Cosmetic Bag Canvas Bowknot Floral Print Zippered Travel Toiletry Pouch Portable Storage Organizer For Women Girls
Makeup Cosmetic Bag Canvas Bowknot Floral Print Zippered Travel Toiletry Pouch Portable Storage Organizer For Women Girls
like
Find Similar
Floral makeup bag with pink bows on cream canvas, portable storage for cosmetics - Pink
Portable cream canvas cosmetic bag with light blue bow print and zipper closure - Blue
Makeup Cosmetic Bag Canvas Bowknot Floral Print Zippered Travel Toiletry Pouch Portable Storage Organizer For Women Girls
-5%
$1.89
No MOQ
Leopard Print Cosmetic Bag Plush Velvet Makeup Pouch With Artificial Pearl Drawstring Portable Travel Toiletry Organizer For Women
Leopard Print Cosmetic Bag Plush Velvet Makeup Pouch With Artificial Pearl Drawstring Portable Travel Toiletry Organizer For Women
like
Find Similar
2 options
Leopard Print Cosmetic Bag Plush Velvet Makeup Pouch With Artificial Pearl Drawstring Portable Travel Toiletry Organizer For Women
-4%
$4.19-4.63
Mix MOQ : 2
 · 
19 sold recently
Mini Cosmetic Bag Portable Nylon Makeup Pouch For Lipstick Travel Storage Zipper Closure Round Ring Handle Solid Color
Mini Cosmetic Bag Portable Nylon Makeup Pouch For Lipstick Travel Storage Zipper Closure Round Ring Handle Solid Color
like
Find Similar
Close-up of black nylon makeup pouch with silver metal zipper in a cozy home setting - Black
Close-up of small navy blue nylon cosmetic bag with white embroidered logo label - Navy Blue
Blue nylon cosmetic bag for lipstick on a desk with decor, shown in a lifestyle setting - Sapphire Blue
Sky blue mini makeup bag with woven quote label and contrasting green zipper detail - Blue
+3
Mini Cosmetic Bag Portable Nylon Makeup Pouch For Lipstick Travel Storage Zipper Closure Round Ring Handle Solid Color
$1.99
No MOQ
Makeup Bag Quilted Polyester Bowknot Print Zipper Closure Portable Travel Sweet Girly Style For Women
Makeup Bag Quilted Polyester Bowknot Print Zipper Closure Portable Travel Sweet Girly Style For Women
like
Find Similar
Detail of white quilted makeup bag with pink bow pattern and Good Night label - Octagonal Pouch / Pink
Quilted cotton cosmetic bag with pink bow patterns and a secure top zipper closure - Clutch Bag / Pink
Detail of quilted white makeup bag with light blue bows and good night label - Clutch Bag / Blue
Quilted cosmetic bag with blue bow patterns, top handle, and elegant zipper tassel detail - Makeup Bag / Blue
Makeup Bag Quilted Polyester Bowknot Print Zipper Closure Portable Travel Sweet Girly Style For Women
-5%
$2.05-3.43
No MOQ
 · 
36 views
French Bulldog Print Makeup Bag Colorful Grid Pop Art Cosmetic Pouch Portable Travel Toiletry Organizer With Wrist Strap
French Bulldog Print Makeup Bag Colorful Grid Pop Art Cosmetic Pouch Portable Travel Toiletry Organizer With Wrist Strap
like
Find Similar
Plaid makeup bag with colorful French bulldog cartoon patterns and black wrist strap - French Bulldog Grid Print (Fine Linen) / 17*25cm With Wristlet
NewFrench Bulldog Print Makeup Bag Colorful Grid Pop Art Cosmetic Pouch Portable Travel Toiletry Organizer With Wrist Strap
-4%
$1.37
No MOQ
 · 
11 sold recently
Quilted Cosmetic Makeup Bag Pink Bow Pattern Portable Toiletry Pouch Large Capacity Sweet Travel Storage Organizer
Quilted Cosmetic Makeup Bag Pink Bow Pattern Portable Toiletry Pouch Large Capacity Sweet Travel Storage Organizer
like
Find Similar
Quilted makeup bag with pink bow pattern and double zippers placed on books - Pink Horizontal Line Bow Cosmetic Bag
Quilted cotton cosmetic bag with pink bow pattern and the jolly house fabric label - Pink Horizontal Line Bow Wrist Bag
Quilted white cosmetic bag featuring pink bow and ribbon patterns with textile label - Pink Horizontal Line Bow Hand Pouch
Quilted Cosmetic Makeup Bag Pink Bow Pattern Portable Toiletry Pouch Large Capacity Sweet Travel Storage Organizer
$2.16-3.60
No MOQ
 · 
14 views
Portable Medicine Bag Linen Makeup Pouch Travel Zipper Storage Case With Wrist Strap Capsule Pattern For First Aid Supplies
Portable Medicine Bag Linen Makeup Pouch Travel Zipper Storage Case With Wrist Strap Capsule Pattern For First Aid Supplies
like
Find Similar
White canvas medicine storage bag featuring capsule print and black wristlet strap - 17*25cm / Medicine Bag Print (Style 1) / White
Portable Medicine Bag Linen Makeup Pouch Travel Zipper Storage Case With Wrist Strap Capsule Pattern For First Aid Supplies
-5%
$1.51
No MOQ
Vintage Wine Print Makeup Bag Linen Canvas Multi Functional Travel Cosmetic Storage Pouch With Zipper And Wrist Strap
Vintage Wine Print Makeup Bag Linen Canvas Multi Functional Travel Cosmetic Storage Pouch With Zipper And Wrist Strap
like
Find Similar
Cosmetic bag with vintage wine print, black hand strap and metal zipper closure - Wine Print Style 1 (xy-077-1) / 17*25cm With Wrist Strap
Vintage canvas makeup bag featuring red wine still life print and black zipper strap - Wine Print Style 2 (xy-077-2) / 17*25cm With Wrist Strap
Beige canvas makeup bag with vintage wine and grape print featuring a black wristlet - Wine Print Style 3 (xy-077-3) / 17*25cm With Wrist Strap
Beige wine themed cosmetic bag with vintage grape and bottle sketch print with zipper - Wine Print Style 4 (xy-077-4) / 17*25cm With Wrist Strap
+4
Vintage Wine Print Makeup Bag Linen Canvas Multi Functional Travel Cosmetic Storage Pouch With Zipper And Wrist Strap
-5%
$1.26-1.31
No MOQ
Gingham Makeup Bag Shell Shaped Cotton Fabric Large Capacity Zipper Closure Portable Travel Cosmetic Storage Pouch For Women
Gingham Makeup Bag Shell Shaped Cotton Fabric Large Capacity Zipper Closure Portable Travel Cosmetic Storage Pouch For Women
like
Find Similar
Close-up of pink gingham makeup bag with silver dual zippers and logo patch detail - Light Pink Plaid
Detail of blue plaid shell cosmetic bag with silver double zippers and brand label - Blue Plaid
Detail of green gingham shell makeup bag with dual silver zippers and logo label - Green Check
Detail of red and cream checkered makeup bag with silver zippers and fabric brand label - Red Check
+3
Gingham Makeup Bag Shell Shaped Cotton Fabric Large Capacity Zipper Closure Portable Travel Cosmetic Storage Pouch For Women
-10%
$2.28
No MOQ
Quilted Floral Makeup Bag Cotton Floral Rose Bow Pattern Travel Cosmetic Organizer Pouch Portable Toiletry Storage Women
Quilted Floral Makeup Bag Cotton Floral Rose Bow Pattern Travel Cosmetic Organizer Pouch Portable Toiletry Storage Women
like
Find Similar
Detail of quilted cosmetic bag featuring pink rose patterns and wide top carry handle - Pink Rose Large Cosmetic Bag
Macro shot of quilted makeup bag with pink roses and blue ribbons on a wooden desk - Blue Rose Large Cosmetic Bag
Quilted makeup bag with pink floral and bow patterns featuring a soft cotton finish - Pink Rose Medium Cosmetic Bag
Detailed macro view of quilted makeup bags featuring blue bows and pink floral patterns - Blue Rose Square Cosmetic Bag
+2
NewQuilted Floral Makeup Bag Cotton Floral Rose Bow Pattern Travel Cosmetic Organizer Pouch Portable Toiletry Storage Women
-5%
$1.53-3.12
No MOQ
Quilted Cosmetic Bag Large Capacity Cute Cartoon Bear Dog Pattern Zipper Storage Pouch For Travel Makeup Toiletries Women
Quilted Cosmetic Bag Large Capacity Cute Cartoon Bear Dog Pattern Zipper Storage Pouch For Travel Makeup Toiletries Women
like
Find Similar
Quilted white cosmetic bag with cute dog patterns shown next to a laptop and books - Star Dog
Close-up of quilted white cosmetic bag with cute animal prints on a desk setup - Puppy Bear
Detailed close-up of a white quilted makeup bag featuring cute bear and bow patterns - Small Grey Elephant
Detailed close-up of a pink quilted cosmetic bag with cute cat and pear pattern prints - Black Cat Pear
+9
Quilted Cosmetic Bag Large Capacity Cute Cartoon Bear Dog Pattern Zipper Storage Pouch For Travel Makeup Toiletries Women
-5%
$2.16
No MOQ
 · 
10 views
Floral Printed Makeup Bag Polyester Zipper Toiletry Pouch With Wristlet Portable Travel Cosmetic Storage Organizer Women
Floral Printed Makeup Bag Polyester Zipper Toiletry Pouch With Wristlet Portable Travel Cosmetic Storage Organizer Women
like
Find Similar
Ethnic floral canvas makeup bag with colorful patterns, silver zipper, and wrist strap - Symmetric Ethnic Floral (Style 1)
Floral canvas makeup bag with colorful Mexican pattern and black wrist strap - Colorful Embroidery Style Floral (Style 2)
Portable makeup bag with colorful Otomi pattern and bird embroidery on black background - Otomi Bird and Flower Print (Style 3)
Folk floral pattern makeup bag in black with orange flowers and wrist strap - Orange Folk Art Floral (Style 4)
NewFloral Printed Makeup Bag Polyester Zipper Toiletry Pouch With Wristlet Portable Travel Cosmetic Storage Organizer Women
-4%
$1.37
No MOQ
Elegant Jacquard Makeup Bag Blue Floral Dandelion Pattern Large Capacity Zipper Travel Cosmetic Pouch Canvas Storage
Elegant Jacquard Makeup Bag Blue Floral Dandelion Pattern Large Capacity Zipper Travel Cosmetic Pouch Canvas Storage
like
Find Similar
Close-up of floral jacquard makeup bag with May Rabbit label on a lifestyle desk - Blue Dandelion Makeup Bag
Close-up of floral jacquard makeup bag featuring blue hydrangea patterns and brand label - Blue Dandelion Medium Makeup Bag
Close-up of floral jacquard fabric and silver zipper on the travel cosmetic pouch - Blue Dandelion Small Makeup Bag
Elegant Jacquard Makeup Bag Blue Floral Dandelion Pattern Large Capacity Zipper Travel Cosmetic Pouch Canvas Storage
$1.99-3.00
No MOQ
Transparent PVC Makeup Bag With Adjustable Dividers Portable Travel Cosmetic Storage Organizer Waterproof Shoulder Strap
Transparent PVC Makeup Bag With Adjustable Dividers Portable Travel Cosmetic Storage Organizer Waterproof Shoulder Strap
like
Find Similar
Portable black clear PVC makeup case with adjustable shoulder strap and dividers - Black
Transparent PVC Makeup Bag With Adjustable Dividers Portable Travel Cosmetic Storage Organizer Waterproof Shoulder Strap
$9.80
No MOQ
Sunflower Makeup Bag Linen Zipper Cosmetic Pouch With Wrist Strap Travel Toiletry Organizer For Women Butterfly Print
Sunflower Makeup Bag Linen Zipper Cosmetic Pouch With Wrist Strap Travel Toiletry Organizer For Women Butterfly Print
like
Find Similar
Beige canvas makeup bag with sunflower gnomes and 'You are my sunshine' print - Sunflower Gnomes (Style 1)
Off-white canvas cosmetic bag featuring sunflower and butterfly print with wristlet strap - Sunflower & Inspirational Quotes (Style 2)
Beige linen sunflower makeup bag with black zipper and wristlet strap for travel - Single Realistic Sunflower (Style 3)
Canvas makeup bag with sunflower and butterfly prints featuring black handle strap - Sunflower Cluster & Butterfly (Style 4)
Sunflower Makeup Bag Linen Zipper Cosmetic Pouch With Wrist Strap Travel Toiletry Organizer For Women Butterfly Print
$1.44
No MOQ
 · 
11 views
Suede Plush Makeup Bag Portable Toiletry Organizer Handheld Cosmetic Pouch Leopard Print Bow Embroidery For Travel Women
Suede Plush Makeup Bag Portable Toiletry Organizer Handheld Cosmetic Pouch Leopard Print Bow Embroidery For Travel Women
like
Find Similar
Detail of suede house makeup bag with fluffy flap, jolly embroidery, and leopard bow - Suede Leopard
Suede Plush Makeup Bag Portable Toiletry Organizer Handheld Cosmetic Pouch Leopard Print Bow Embroidery For Travel Women
$7.20
No MOQ
Floral Jacquard Makeup Bag Relief Pattern Cosmetic Storage Pouch Portable Travel Organizer For Women Canvas Fabric Case
Floral Jacquard Makeup Bag Relief Pattern Cosmetic Storage Pouch Portable Travel Organizer For Women Canvas Fabric Case
like
Find Similar
Close-up of pink embossed floral texture fabric and brand label on a makeup bag - Large / Pink Floral
Macro detail of textured floral jacquard fabric and golden flower zipper pull on makeup bag - Small / Pink Floral
Floral Jacquard Makeup Bag Relief Pattern Cosmetic Storage Pouch Portable Travel Organizer For Women Canvas Fabric Case
$2.25-2.82
No MOQ
Vintage Owl Pattern Polyester Toiletry Bag Printed Floral Makeup Organizer Zipper Travel Cosmetic Storage Pouch Bag For Women
Vintage Owl Pattern Polyester Toiletry Bag Printed Floral Makeup Organizer Zipper Travel Cosmetic Storage Pouch Bag For Women
like
Find Similar
Linen owl print cosmetic bag with floral patterns and zipper closure for travel - Owl Pattern (ymhzb3348)
Vintage Owl Pattern Polyester Toiletry Bag Printed Floral Makeup Organizer Zipper Travel Cosmetic Storage Pouch Bag For Women
$1.59
No MOQ
Lavender Floral Print Makeup Bag Fine Linen Portable Cosmetic Pouch Zipper Toiletry Storage Travel Handbag For Women
Lavender Floral Print Makeup Bag Fine Linen Portable Cosmetic Pouch Zipper Toiletry Storage Travel Handbag For Women
like
Find Similar
Black cosmetic bag with purple neon lavender print and functional zipper strap - Style 1 (Purple Neon Lavender)
Floral makeup bag featuring purple lavender print with black zipper and wristlet strap - Style 2 (Lavender Circle)
Lavender floral cosmetic bag with purple glow ring design and black wristlet strap - Style 3 (Deep Purple Lavender Cluster)
Purple floral makeup bag with neon circle design, fabric finish and black wrist strap - Style 4 (Neon Aperture Floral)
Lavender Floral Print Makeup Bag Fine Linen Portable Cosmetic Pouch Zipper Toiletry Storage Travel Handbag For Women
-4%
$1.37
No MOQ
Cute Corgi Dog Paw Bone Print Linen Canvas Cosmetic Bag Portable Travel Toiletry Makeup Pouch Organizer Zipper Closure
Cute Corgi Dog Paw Bone Print Linen Canvas Cosmetic Bag Portable Travel Toiletry Makeup Pouch Organizer Zipper Closure
like
Find Similar
Blue cosmetics pouch featuring cute Corgi dog patterns and a black wrist strap - Blue Corgi Pattern
Portable cream toiletry bag featuring adorable corgi dog prints and black zipper handle - Beige Corgi Pattern
Portable toiletry bag featuring cartoon dachshund and bone prints with black zipper handle - Beige Dachshund Paw Pattern
Portable makeup bag with colorful bone and paw print patterns on black fabric - Black Colored Paw Bone Pattern
Cute Corgi Dog Paw Bone Print Linen Canvas Cosmetic Bag Portable Travel Toiletry Makeup Pouch Organizer Zipper Closure
$1.44
No MOQ
Nylon Makeup Bag Large Capacity Travel Toiletry Organizer Handheld Square Cosmetic Pouch With Cartoon Bear Patch Cute
Nylon Makeup Bag Large Capacity Travel Toiletry Organizer Handheld Square Cosmetic Pouch With Cartoon Bear Patch Cute
like
Find Similar
Black nylon portable makeup bag with cute cartoon patch and sturdy handle for travel - Black
Blue and yellow nylon travel cosmetic bag featuring cartoon graphics and top handle - Blue
Portable coral pink nylon makeup bag with black top handle and graphic label for travel - Fluorescent Pink
Orange canvas portable toiletry bag with cartoon patches and black zipper handle - Caramel color
+1
Nylon Makeup Bag Large Capacity Travel Toiletry Organizer Handheld Square Cosmetic Pouch With Cartoon Bear Patch Cute
$5.45
Mix MOQ : 3
Round Quilted Cosmetic Bag Polyester Portable Makeup Organizer Travel Toiletry Pouch Zipper Handle Soft Macaron Color
Round Quilted Cosmetic Bag Polyester Portable Makeup Organizer Travel Toiletry Pouch Zipper Handle Soft Macaron Color
like
Find Similar
Close-up of a soft quilted shell makeup bag with a top handle and zip closure - Yellow
Detailed close-up of quilted light green shell makeup bag with pink zipper and handle - Green
Close-up of a blue quilted shell makeup bag with Sorakka Studio label and top handle - Light Blue
Close-up of pink quilted shell makeup bag with Sorakka Studio label on bed - Nude Pink
+1
Round Quilted Cosmetic Bag Polyester Portable Makeup Organizer Travel Toiletry Pouch Zipper Handle Soft Macaron Color
-5%
$2.16
No MOQ
Makeup Bag Waterproof Polyester Digital Print Sloth Floral Pattern Travel Toiletry Organizer Zipper Pouch Case For Women
Makeup Bag Waterproof Polyester Digital Print Sloth Floral Pattern Travel Toiletry Organizer Zipper Pouch Case For Women
like
Find Similar
Digital sloth and floral print makeup bag with zipper closure for travel storage - Sloth & Floral
Makeup Bag Waterproof Polyester Digital Print Sloth Floral Pattern Travel Toiletry Organizer Zipper Pouch Case For Women
$1.73
No MOQ
 · 
14 views
Sweet Ballet Style Handheld Makeup Bag PU Leather Large Capacity Waterproof Toiletry Organizer With Ribbon Bow
Sweet Ballet Style Handheld Makeup Bag PU Leather Large Capacity Waterproof Toiletry Organizer With Ribbon Bow
like
Find Similar
Detailed view of pink PU storage bag with Soft Madeing embroidery and ribbon detail - Pink (Includes 2 Ribbons)
Close-up of a light green and beige large makeup bag with blue embroidery and zipper - Green (Includes 2 Ribbons)
Detail of creamy white PU leather organizer with black strap and Soft Madeing embroidery - Black (Includes 2 Ribbons)
Close-up of silver and pink handheld storage bag with Soft Madeing embroidery detail - Silver (Includes 2 Ribbons)
+1
Sweet Ballet Style Handheld Makeup Bag PU Leather Large Capacity Waterproof Toiletry Organizer With Ribbon Bow
$3.72
Mix MOQ : 2
Strawberry Print Makeup Bag Polyester Large Capacity Portable Double Sided Cosmetic Organizer Toiletry Travel Pouch Cute Women
Strawberry Print Makeup Bag Polyester Large Capacity Portable Double Sided Cosmetic Organizer Toiletry Travel Pouch Cute Women
like
Find Similar
Cute pink strawberry and bow print cosmetic bag with large capacity and zipper - 01-Pink Strawberry Bow
Cute strawberry print cosmetic bag with red fruit patterns and black zipper closure - 02-White Strawberry Heart
Pink checkered strawberry makeup bag with white flower patterns and black zipper closure - 03-Pink White Grid Strawberry
Cute strawberry print canvas cosmetic bag with zipper closure and side handle - 04-White Hand-drawn Strawberry
+6
Strawberry Print Makeup Bag Polyester Large Capacity Portable Double Sided Cosmetic Organizer Toiletry Travel Pouch Cute Women
-5%
$1.64
Mix MOQ : 2
 · 
23 views
Double Layer Makeup Bag Waterproof PU Leather PVC Transparent Geometric Pattern Portable Travel Toiletry Case Organizer
Double Layer Makeup Bag Waterproof PU Leather PVC Transparent Geometric Pattern Portable Travel Toiletry Case Organizer
like
Find Similar
Double-layer travel makeup bag with dark green geometric pattern and transparent PVC top - Green
Double-layer light blue geometric cosmetic bag with transparent top and carry handle - Blue
Black double-layer makeup bag with quilted texture and transparent top for travel storage - Black
Pink geometric pattern dual-layer makeup bag with a transparent PVC top and handle - Pink
+1
Double Layer Makeup Bag Waterproof PU Leather PVC Transparent Geometric Pattern Portable Travel Toiletry Case Organizer
-4%
$2.52
No MOQ
Floral Linen Makeup Bag Zipper Toiletry Pouch Botanical Print Travel Storage Case For Women
Floral Linen Makeup Bag Zipper Toiletry Pouch Botanical Print Travel Storage Case For Women
like
Find Similar
Floral canvas makeup bag with blue petal print and Soak text with black wristlet strap - Soak Print (xy-014-01) / With Wrist Strap
Floral canvas makeup bag in cream with Relax script and portable black wrist strap - Relax Print (xy-014-02) / With Wrist Strap
Floral canvas makeup bag with 'Unwind' text print and dark blue flower motif - Unwind Print (xy-014-03) / With Wrist Strap
Floral print makeup bag in beige with blue flower pattern and Breathe text design - Breathe Print (xy-014-04) / With Wrist Strap
+4
Floral Linen Makeup Bag Zipper Toiletry Pouch Botanical Print Travel Storage Case For Women
-5%
$1.26-1.31
No MOQ
Quilted Polyester Makeup Bag Large Capacity Multi Compartment Travel Cosmetic Organizer With Handle Zipper And Clear PVC Pouch
Quilted Polyester Makeup Bag Large Capacity Multi Compartment Travel Cosmetic Organizer With Handle Zipper And Clear PVC Pouch
like
Find Similar
Large capacity pink quilted PU makeup bag with handle and transparent PVC organizer pouch - Size 25x14x13cm / Pink
Beige quilted PU leather makeup bag set with large capacity and multi-layer storage - Size 25x14x13cm / Khaki
Black quilted makeup bag set with multi-functional compartments and transparent pouch - Size 25x14x13cm / Black
Olive green quilted PU makeup bag with large capacity partitions and dual zippers - Size 25x14x13cm / Army Green
Quilted Polyester Makeup Bag Large Capacity Multi Compartment Travel Cosmetic Organizer With Handle Zipper And Clear PVC Pouch
$5.76
No MOQ
Large Capacity Makeup Bag Portable Toiletry Travel Cosmetic Case Partitioned Storage Color Block Polyester Denim Organizer
Large Capacity Makeup Bag Portable Toiletry Travel Cosmetic Case Partitioned Storage Color Block Polyester Denim Organizer
like
Find Similar
Pink nylon cosmetic bag with yellow handles and embroidered text for travel storage - Rose Red
Blue denim texture travel cosmetic bag with pink handle and creative letter embroidery - Blue Denim
Quilted purple toiletry bag with green handle and heart charm in 24x14x9cm size - Light Purple Handbag
Pink striped portable cosmetic bag with Milo Bliss lettering and red handle, 22x12x15cm - Pink Striped Bucket Bag
+10
Large Capacity Makeup Bag Portable Toiletry Travel Cosmetic Case Partitioned Storage Color Block Polyester Denim Organizer
-4%
$3.46-5.19
No MOQ
Artistic Colorful Geometric Cosmetic Bag Fine Linen Portable Toiletry Organizer With Wristlet Strap Zipper Travel Pouch
Artistic Colorful Geometric Cosmetic Bag Fine Linen Portable Toiletry Organizer With Wristlet Strap Zipper Travel Pouch
like
Find Similar
Portable geometric makeup bag with colorful abstract print and durable zipper - 17*25cm (Linen) with Strap / Colorful Geometric Patchwork (SN-476)
Artistic Colorful Geometric Cosmetic Bag Fine Linen Portable Toiletry Organizer With Wristlet Strap Zipper Travel Pouch
-4%
$1.37
No MOQ
Floral Jacquard Cosmetic Bag Mini Portable Lipstick Pouch Travel Toiletry Storage Case Fabric Organizer For Women Students
Floral Jacquard Cosmetic Bag Mini Portable Lipstick Pouch Travel Toiletry Storage Case Fabric Organizer For Women Students
like
Find Similar
Detailed close-up of pink floral canvas makeup bag with metallic zipper and brand label - Pink Flower
Floral canvas lipstick pouch with silver zipper and logo tag in a stylish lifestyle setting - Navy Blue Small Floral
Quilted floral lipstick pouch with cloud texture on a minimalist lifestyle background - Yellow Blue Fan Shape
Floral Jacquard Cosmetic Bag Mini Portable Lipstick Pouch Travel Toiletry Storage Case Fabric Organizer For Women Students
$1.99
No MOQ
Quilted Green Makeup Bag Cotton Portable Bow Print Cosmetic Pouch Zipper Toiletry Organizer Cute Travel Aesthetic Case Women
Quilted Green Makeup Bag Cotton Portable Bow Print Cosmetic Pouch Zipper Toiletry Organizer Cute Travel Aesthetic Case Women
like
Find Similar
Detail of green quilted makeup bag with pink bow pattern and woven zipper puller - Green Fruit Bow [Makeup Bag]
Detail of green quilted makeup bag with pink bow prints and stylish woven zipper pull - Green Fruit Bow [Handbag]
Close-up of green quilted makeup bag with pink bow patterns and a woven logo patch - Green Fruit Bow [Octagonal Bag]
Quilted Green Makeup Bag Cotton Portable Bow Print Cosmetic Pouch Zipper Toiletry Organizer Cute Travel Aesthetic Case Women
-5%
$2.05-3.42
No MOQ
Go to

More in home & kitchen

Explore more in travel bottles

steelstrapalloysleevewallmetaldisplayshapedesignshoulder
plasticpetkidssquarewindowcare316 stainless steeladjustablegoldcover

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access