Everful

Wholesale woven patches

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Woven Patches

Find the perfect pieces: handbags, shoulder bags, crossbody bags and more

All products in woven patches

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Leopard Print Faux Leather Buttons Retro Round Heart Patches For DIY Jewelry Hair Accessories Clothing Sewing Decoration
Leopard Print Faux Leather Buttons Retro Round Heart Patches For DIY Jewelry Hair Accessories Clothing Sewing Decoration
like
Find Similar
Detailed view of leopard print fabric round buttons with smooth silver metal backing base - Round Style
Macro view of leopard print heart-shaped DIY fabric buttons with flat metal backings - Heart Style
Leopard Print Faux Leather Buttons Retro Round Heart Patches For DIY Jewelry Hair Accessories Clothing Sewing Decoration
$0.08
Mix MOQ : 10
Cartoon Embroidered Patches For Kids Clothing DIY Iron On Decorative Appliques For Bags Hats Shoes Animal Fruit Flower Letter
Cartoon Embroidered Patches For Kids Clothing DIY Iron On Decorative Appliques For Bags Hats Shoes Animal Fruit Flower Letter
like
Find Similar
Detailed set of 60 unique embroidered patches with heat seal backing for clothing repair - Cartoon Series
Cartoon Embroidered Patches For Kids Clothing DIY Iron On Decorative Appliques For Bags Hats Shoes Animal Fruit Flower Letter
$7.78
No MOQ
Free Shipping
Embroidered Patches Rainbow Star Heart Cartoon Fabric Stickers Self Adhesive Iron On Applique For Clothing Bags DIY Decor
Embroidered Patches Rainbow Star Heart Cartoon Fabric Stickers Self Adhesive Iron On Applique For Clothing Bags DIY Decor
like
Find Similar
Embroidered rainbow cloud patch for children's clothing with 4.1cm x 2.8cm dimensions - 9#-Rainbow Embroidered Patch
Technical drawing showing the 2.2cm dimensions of the yellow star embroidery patch - 13#-Yellow Star Embroidered Patch
Green star shaped embroidery patch with white border 1.4cm small self adhesive iron on - 17#-Green Small Star Embroidered Patch
Detailed view of gold star embroidered patch with dimensions of 2.2 cm by 2.2 cm - 16#-Gold Star Embroidered Patch
+17
Embroidered Patches Rainbow Star Heart Cartoon Fabric Stickers Self Adhesive Iron On Applique For Clothing Bags DIY Decor
$0.10-2.36
No MOQ
 · 
13 views
Free Shipping
Chenille Tiger Head Embroidery Patch Iron On Applique DIY Animal Badge For Clothing Sweater Hoodie Jacket Decor
Chenille Tiger Head Embroidery Patch Iron On Applique DIY Animal Badge For Clothing Sweater Hoodie Jacket Decor
like
Find Similar
Chenille tiger head embroidery patch for clothing with 3D texture and size markings - Tiger 1# (AZ25041E9-4)
Set of 4 cartoon tiger chenille embroidery patches for DIY clothing decoration - Tiger (AZ25041E9-4)
Chenille Tiger Head Embroidery Patch Iron On Applique DIY Animal Badge For Clothing Sweater Hoodie Jacket Decor
$1.15-3.46
No MOQ
Cartoon Animal Embroidery Patches Bear Deer Owl Bird Heart Shape Iron On Patches For Clothing Bags DIY Sew Applique
Cartoon Animal Embroidery Patches Bear Deer Owl Bird Heart Shape Iron On Patches For Clothing Bags DIY Sew Applique
like
Find Similar
Adventure animal bear embroidered patch in brown and green finish with size 5x3.5cm - Adventure Bear (1)
Blue heart embroidery patch featuring two pink birds and floral details, size 5.2x4.3cm - Heart Birds (2)
Blue bird and pink flower embroidered patch with green background on variant view - Bird in Flowers (3)
5.0x4.0 CM embroidered owl patch on yellow heart background with blue border - Pink Owl (4)
+5
Cartoon Animal Embroidery Patches Bear Deer Owl Bird Heart Shape Iron On Patches For Clothing Bags DIY Sew Applique
$0.12
No MOQ
Kawaii Cartoon Animal Embroidered Felt Patch Charms For DIY Bag Clothing Decoration With Metal Ball Chain
Kawaii Cartoon Animal Embroidered Felt Patch Charms For DIY Bag Clothing Decoration With Metal Ball Chain
like
Find Similar
Daisy embroidery patch double-sided adhesive sheets CROWN #513L size 10x20cm - Adhesive Sheet
Assorted cute cartoon embroidered felt patches with metal chains for luggage and DIY - Set of 13 Pieces
Detailed view of cute dog-shaped embroidery patch showing 11.2cm x 9.5cm dimensions - Dog Head Shape
Detail view of pink and white bunny embroidery luggage tag with dimensions and ball chain - Rabbit
+11
Kawaii Cartoon Animal Embroidered Felt Patch Charms For DIY Bag Clothing Decoration With Metal Ball Chain
$0.43-12.07
No MOQ
 · 
10 views
Free Shipping
3D Rhinestone Five Petal Padded Flower DIY Hair Accessory Clothing Bag Shoe Decoration Patch Artificial Pearl Fabric Floral Applique
3D Rhinestone Five Petal Padded Flower DIY Hair Accessory Clothing Bag Shoe Decoration Patch Artificial Pearl Fabric Floral Applique
like
Find Similar
Detail of pink padded fabric flower with center pearl and small rhinestones - Pink (#1)
Navy blue 5-petal padded fabric flower with rhinestones and central pearl for DIY craft - Dark Blue (#2)
White fabric five-petal flower accessory with silver rhinestones and central faux pearl - White (#3)
Pink fabric 3D flower charm with diamond accents and white pearl for DIY crafts - Rose Pink (#4)
+7
3D Rhinestone Five Petal Padded Flower DIY Hair Accessory Clothing Bag Shoe Decoration Patch Artificial Pearl Fabric Floral Applique
$0.05
Mix MOQ : 200
Thanksgiving Harvest Embroidered Patches Turkey Pumpkin Iron On Appliques DIY Clothing Hat Decoration Holiday Accessories
Thanksgiving Harvest Embroidered Patches Turkey Pumpkin Iron On Appliques DIY Clothing Hat Decoration Holiday Accessories
like
Find Similar
Detailed dimensions of Thanksgiving pilgrim hat embroidery patch with size measurements - Pilgrim Hat
Embroidered pumpkin patch with orange silk thread and dimensions for Thanksgiving - Pumpkin
Detail view of cornucopia embroidery patch showing 6.4x5.3cm size and weight - Cornucopia
Embroidered beer mug patch for Thanksgiving with orange and yellow knit texture - Beer Mug
+6
Thanksgiving Harvest Embroidered Patches Turkey Pumpkin Iron On Appliques DIY Clothing Hat Decoration Holiday Accessories
$0.16-2.06
No MOQ
 · 
10 views
Free Shipping
Double Layer Sequin Butterfly DIY Patch For Hair Accessories Clothing Decoration With Rhinestone Embellishment For Kids
Double Layer Sequin Butterfly DIY Patch For Hair Accessories Clothing Decoration With Rhinestone Embellishment For Kids
like
Find Similar
Detailed close-up of a purple sequined double-layer butterfly accessory with a teardrop gem - Purple (Purple/Yellow/Pink Combination)
Sky blue sequin double-layer butterfly accessory with a sparkling iridescent gem center - Sky Blue
Sparkly lavender sequin double-layer butterfly accessory with teardrop rhinestone - Lavender
Blue sequin butterfly lace patch with iridescent rhinestone for DIY hair accessories - White With Sky Blue Sequins
+2
Double Layer Sequin Butterfly DIY Patch For Hair Accessories Clothing Decoration With Rhinestone Embellishment For Kids
$0.14
Mix MOQ : 200
Cute Cartoon Animal Embroidery Patches Self Adhesive Plush Iron On Patches For Clothing DIY Phone Case Decoration
Cute Cartoon Animal Embroidery Patches Self Adhesive Plush Iron On Patches For Clothing DIY Phone Case Decoration
like
Find Similar
Detail view of rabbit embroidery patch showing 6cm x 6.9cm size and 2.6g weight - White Rabbit-3#
Detailed size chart showing the 2cm x 2.2cm dimensions of the cute paw plush patch - Small Paw-6#
Detailed size measurement of the cute embroidered rabbit patch showing 7.5cm width - Rabbit Head-5#
Detailed embroidery patch of cute white cartoon sheep with 5.5cm x 5.9cm size marking - Little Sheep-4#
+6
Cute Cartoon Animal Embroidery Patches Self Adhesive Plush Iron On Patches For Clothing DIY Phone Case Decoration
$0.14-2.70
No MOQ
 · 
13 views
Free Shipping
Red Flocked Fabric Polka Dot Heart Round Buttons For DIY Jewelry Making Accessories Hair Clips Clothing Decoration
Red Flocked Fabric Polka Dot Heart Round Buttons For DIY Jewelry Making Accessories Hair Clips Clothing Decoration
like
Find Similar
Macro shot of red velvet magnetic buttons with tiny crystals for DIY jewelry accessories - Small Round (17mm)
Close-up of red velvet polka dot round buttons for DIY craft and hair accessories - Medium Round (23mm)
Close-up of red velvet polka dot round buttons for DIY jewelry with silver metal backing - Large Round (25mm)
Macro shot of red velvet heart-shaped DIY accessories with white dots and silver inlay - Small Heart (18x15mm)
+1
NewRed Flocked Fabric Polka Dot Heart Round Buttons For DIY Jewelry Making Accessories Hair Clips Clothing Decoration
$0.04-0.07
Mix MOQ : 10
Handmade Acrylic Flower Sequins DIY Apparel Accessories With Rhinestone Center Sparkling Floral Decoration For Brooch Shoe Flower
Handmade Acrylic Flower Sequins DIY Apparel Accessories With Rhinestone Center Sparkling Floral Decoration For Brooch Shoe Flower
like
Find Similar
Macro detail of aurora coral sequins flower charms with crystal center for DIY crafts - Purple
Close-up of red sequin flower accessory with crystal center and felt back for DIY - Red
Detail view of aurora coral flower patches with crystal center and felt backing - Rose Red
Macro shot of green sequin flower charms with rhinestone center for DIY apparel decor - Grass Green
+6
Handmade Acrylic Flower Sequins DIY Apparel Accessories With Rhinestone Center Sparkling Floral Decoration For Brooch Shoe Flower
-6%
$0.27
Mix MOQ : 10
Cartoon Baby Theme Embroidered Patches Polyester Sewing Appliques For Clothing Decoration Blue Yellow Animals Cute Style
Cartoon Baby Theme Embroidered Patches Polyester Sewing Appliques For Clothing Decoration Blue Yellow Animals Cute Style
like
Find Similar
Daisy embroidery patch double-sided adhesive sheets CROWN #513L size 10x20cm - 1Pc Strong Adhesive Sheet 10x20cm
Baby rattle embroidery patch with dimensions 5.5x3.3cm for cute infant clothing repair - Baby Rattle Style (C23XX-066-09)
Detail showing rainbow and cloud embroidery patch with precise size measurements 6x4cm - Rainbow Cloud Style (C23XX-066-17)
Set of 25 blue baby embroidery patches with bottle and stroller for nursery crafts - Set of 24 Girl (C23XX-210-YT)
+23
Cartoon Baby Theme Embroidered Patches Polyester Sewing Appliques For Clothing Decoration Blue Yellow Animals Cute Style
$0.15-6.33
No MOQ
 · 
15 views
Free Shipping
Basketball Embroidery Patches Iron On Sew On Sports Themed Applique Badges For Clothing Bags DIY Decor Jersey Hoop MVP Heart Patterns
Basketball Embroidery Patches Iron On Sew On Sports Themed Applique Badges For Clothing Bags DIY Decor Jersey Hoop MVP Heart Patterns
like
Find Similar
Cartoon basketball LOVE embroidery patch with black letters and orange border, 6.3cm height - LOVE Letter Style
Red basketball jersey embroidered patch with yellow trim and size dimensions shown - Jersey Style
Cartoon basketball embroidery patch with slogan, measuring 6.4x6.8cm for garment DIY - Slogan and Silhouette
Embroidered basketball hoop patch, 6.6cm x 6.3cm iron-on badge for clothes DIY - Basketball Hoop Style
+17
Basketball Embroidery Patches Iron On Sew On Sports Themed Applique Badges For Clothing Bags DIY Decor Jersey Hoop MVP Heart Patterns
$0.17-5.50
No MOQ
Free Shipping
Christmas Embroidery Patches Iron On Santa Claus Snowman Reindeer DIY Clothing Decoration For Xmas Gift
Christmas Embroidery Patches Iron On Santa Claus Snowman Reindeer DIY Clothing Decoration For Xmas Gift
like
Find Similar
Detailed view of elf hat Christmas patch with size measurements 5.6cm by 6.3cm - Christmas Patch 1# (Elf Hat)
Detailed size view of Christmas ball embroidery patch with red bow and snowflake motif - Christmas Patch 10# (Snowflake Ornament)
Detailed embroidery of a Christmas bow with green pine needles and size measurements - Christmas Patch 19# (Bow with Pine)
Detail view of candy cane embroidery patch with green bow and dimensions shown - Christmas Patch 3# (Candy Cane)
+29
Christmas Embroidery Patches Iron On Santa Claus Snowman Reindeer DIY Clothing Decoration For Xmas Gift
$0.20-8.87
No MOQ
 · 
14 views
Free Shipping
Viking Rune Embroidered Patch Vegvisir Compass Thor Hammer Applique Mystical Nordic Style Sew On Iron On Cloth Patch For Apparel
Viking Rune Embroidered Patch Vegvisir Compass Thor Hammer Applique Mystical Nordic Style Sew On Iron On Cloth Patch For Apparel
like
Find Similar
8.1cm Viking Vegvisir compass patch with embroidered Norse runes on black fabric - Viking Compass Pattern (PE3939CT)
Black square Viking embroidery patch with TRX and V≈L text, size 6x6cm for DIY apparel - Matrix Rune Pattern (PE4168CT)
8cm Viking Mjölnir embroidered patch with Nordic rune circle and white stitched edge - Thors Hammer Pattern (PE4297CT)
Viking Rune Embroidered Patch Vegvisir Compass Thor Hammer Applique Mystical Nordic Style Sew On Iron On Cloth Patch For Apparel
-6%
$0.27-0.44
No MOQ
Punk Landscape Astronaut Embroidery Patches Iron On Appliques For Clothing DIY Decoration Outdoor Adventure Camping Badges Fabric Stickers
Punk Landscape Astronaut Embroidery Patches Iron On Appliques For Clothing DIY Decoration Outdoor Adventure Camping Badges Fabric Stickers
like
Find Similar
Detail of embroidered astronaut helmet patch showing mountain landscape and cosmic planets - Astronaut Helmet Style (PE6207CT)
Hot air balloon embroidery patch featuring mountain and bear for DIY clothing - Hot Air Balloon Landscape Style(PE6204CT)
Macro detail of mushroom light bulb embroidered patch showing stitching and 5.2x8.4cm size - Lightbulb Mushroom Style (PE6205CT)
Embroidered outdoor compass patch with snow mountain and tent scenery, 7.8x8.1cm size - Compass Camping Style (PE6354CT)
+1
Punk Landscape Astronaut Embroidery Patches Iron On Appliques For Clothing DIY Decoration Outdoor Adventure Camping Badges Fabric Stickers
-5%
$0.59-0.82
No MOQ
Gothic Cat Tarot Embroidery Patch Iron On Embroidered Skull Rose Animal Slogan Decorative Badge For Clothing Bag Jacket
Gothic Cat Tarot Embroidery Patch Iron On Embroidered Skull Rose Animal Slogan Decorative Badge For Clothing Bag Jacket
like
Find Similar
Detail of tarot death card embroidery patch with orange rose, size 5.5x9.2cm - Death Tarot Card (PE9423CT)
XIV Temperance tarot card embroidered patch with gold and purple gothic embroidery - Temperance Tarot Card (PE9424CT)
Funny white cats embroidered patch with Are You Pooping text on dark green background - ARE YOU POOPING Cat (PE9492CT)
Embroidered black cat and skull patch with Don't Tell Me What To Do text 6x9.2cm - Black Cat Skull (PE9496CT)
+1
Gothic Cat Tarot Embroidery Patch Iron On Embroidered Skull Rose Animal Slogan Decorative Badge For Clothing Bag Jacket
-4%
$0.69-0.96
Mix MOQ : 10
Free Shipping
Scottish Terrier Dog PU Leather Patch With White Stitching Cartoon Puppy Shape DIY Accessories For Phone Case Bag Decor
Scottish Terrier Dog PU Leather Patch With White Stitching Cartoon Puppy Shape DIY Accessories For Phone Case Bag Decor
like
Find Similar
Macro view of brown leather dog-shaped accessory with white contrast stitching detail - Brown
Deep pink leather Scottish Terrier puppy charm with decorative white stitching detail - Rose Red
Close-up of pink PU leather Scottish Terrier dog charm with white stitching for DIY crafts - Pink
Detail of black faux leather puppy patch with contrast white stitching for DIY crafts - Black
Scottish Terrier Dog PU Leather Patch With White Stitching Cartoon Puppy Shape DIY Accessories For Phone Case Bag Decor
$0.43
No MOQ
Free Shipping
Fabric Flower Patch For DIY Hair Accessory Clothing Brooch Handmade Korean Style Five Petal Flower Applique Sewing Decor
Fabric Flower Patch For DIY Hair Accessory Clothing Brooch Handmade Korean Style Five Petal Flower Applique Sewing Decor
like
Find Similar
Handmade light blue 3D fabric flower accessory with pink center for DIY hairpins - Blue
Handmade purple 3D fabric five-petal flower accessory for DIY hair clips and clothing - Purple
Handmade light green fabric five-petal flower accessory with a pink center for DIY crafts - Green
Handmade light yellow fabric flower accessory with pink center for DIY sewing crafts - Yellow
+2
Fabric Flower Patch For DIY Hair Accessory Clothing Brooch Handmade Korean Style Five Petal Flower Applique Sewing Decor
$0.06
Mix MOQ : 200
Vintage Padded Satin Heart Charms For DIY Jewelry Making Earrings Phone Case Decor Handcrafted Shiny Fabric Buttons
Vintage Padded Satin Heart Charms For DIY Jewelry Making Earrings Phone Case Decor Handcrafted Shiny Fabric Buttons
like
Find Similar
Close-up of pink satin heart buttons with metal base for DIY jewelry making - Pink
Macro detail of dark green satin heart magnetic buttons on a white striped ceramic plate - Green
Macro view of grey satin heart-shaped fabric buttons with flat metal backing for DIY crafts - Silver
Detail of heart-shaped black satin fabric buttons with smooth silver metal backing - Black
Vintage Padded Satin Heart Charms For DIY Jewelry Making Earrings Phone Case Decor Handcrafted Shiny Fabric Buttons
-9%
$0.10
Mix MOQ : 10
Free Shipping
Vintage Snake Pattern Leather Heart Shaped Decorative Patch For DIY Hair Accessories Hat Bag Clothing Decoration Embellishment
Vintage Snake Pattern Leather Heart Shaped Decorative Patch For DIY Hair Accessories Hat Bag Clothing Decoration Embellishment
like
Find Similar
Detail of red snake-patterned leather heart charms with metal magnetic base for DIY crafts - Snake/Crocodile Pattern Leather Heart Style / Burgundy
Macro detail of heart-shaped DIY accessories featuring grey snakeskin texture and mirror finish - Snake/Crocodile Pattern Leather Heart Style / Silver Gray
Vintage Snake Pattern Leather Heart Shaped Decorative Patch For DIY Hair Accessories Hat Bag Clothing Decoration Embellishment
$0.11
Mix MOQ : 2
Mini Cartoon Fish Embroidery Patch Colorful Animal Iron On Sew On Patches For Clothing DIY Bag Hat Accessories Small Applique
Mini Cartoon Fish Embroidery Patch Colorful Animal Iron On Sew On Patches For Clothing DIY Bag Hat Accessories Small Applique
like
Find Similar
Mini yellow fish embroidered patch for DIY clothing accessories, size 4.0 x 2.0 cm - Yellow Fish (B)
Mini green fish embroidery patch size 4.0x2.0 cm for DIY clothing bags accessories - Green Fish (A)
Mini orange fish embroidered patch variant C, measuring 4.0cm x 2.0cm for DIY clothing - Orange Fish (C)
Mini fish shaped embroidery patch in pink and white color, size 4.0cm by 2.0cm - Rose Red Fish (F)
+4
Mini Cartoon Fish Embroidery Patch Colorful Animal Iron On Sew On Patches For Clothing DIY Bag Hat Accessories Small Applique
$0.08
No MOQ
Free Shipping
Vintage Plaid Fabric Covered Heart Buttons For Sewing Cute DIY Apparel Decor Accessory Retro Plaid Pattern Heart Shaped Button
Vintage Plaid Fabric Covered Heart Buttons For Sewing Cute DIY Apparel Decor Accessory Retro Plaid Pattern Heart Shaped Button
like
Find Similar
Detail of heart-shaped fabric buttons with pink plaid pattern and metal sewing base - Pink Heart Plaid (Single) / Pink
Detailed view of yellow plaid heart fabric buttons with silver dual-hole metal base backings - Yellow Heart Plaid (Single) / Yellow
Detailed view of heart-shaped plaid fabric buttons on a ceramic tray for DIY sewing crafts - Blue Heart Plaid (Single) / Blue
Close-up of heart-shaped plaid fabric buttons with silver metal sewing base on ceramic - Purple Heart Plaid (Single) / Purple
NewVintage Plaid Fabric Covered Heart Buttons For Sewing Cute DIY Apparel Decor Accessory Retro Plaid Pattern Heart Shaped Button
$0.08
Mix MOQ : 10
Free Shipping
Funny Cat With Knife Embroidered Patch Tactical Badge Hook And Loop Backing Cartoon Animal Skeleton Ghost Applique Gear
Funny Cat With Knife Embroidered Patch Tactical Badge Hook And Loop Backing Cartoon Animal Skeleton Ghost Applique Gear
like
Find Similar
Funny black cat embroidery patch holding a knife with velcro backing for outdoor gear 7cm - Black Cat with Knife (V01286-1)
Detailed view of cat with knife embroidery patch showing 7cm by 6cm dimensions - Tricolor Cat with Knife (V01286-2)
Tactical black cat embroidery patch with knife and yellow eyes on white background - Sleepwalking Black Cat (V01391-1)
Close-up of cute cat holding knife embroidered patch with sharp black and white textures - Sleepwalking Black & White Cat (V01391-2)
+6
Funny Cat With Knife Embroidered Patch Tactical Badge Hook And Loop Backing Cartoon Animal Skeleton Ghost Applique Gear
$1.15-1.44
No MOQ
Free Shipping
Sequined Embroidered Patch Makeup Cosmetic Shape Lipstick Nail Polish Iron On Applique DIY Clothing Decoration
Sequined Embroidered Patch Makeup Cosmetic Shape Lipstick Nail Polish Iron On Applique DIY Clothing Decoration
like
Find Similar
Embroidered lipstick sequin patch for DIY clothing decor in pink and gold, 4x14.6cm - Sequined Lipstick Shape
Lipstick and perfume sequins embroidered patch DIY iron on applique for clothes 12.7x19.6cm - Sequined Makeup Palette Shape
Sequin embroidered makeup brush patch in black and gold for DIY clothing decoration - Sequined Makeup Brush Shape
Pink and black sequined nail polish bottle embroidery patch for DIY clothing, 5.2x10.8cm - Sequined Nail Polish Shape
+1
Sequined Embroidered Patch Makeup Cosmetic Shape Lipstick Nail Polish Iron On Applique DIY Clothing Decoration
-6%
$0.22-1.23
Mix MOQ : 10
 · 
25 views
Van Gogh Portrait And Starry Night Police Box Embroidered Patches For Clothing DIY Sewing Repair Iron On Stamp Applique
Van Gogh Portrait And Starry Night Police Box Embroidered Patches For Clothing DIY Sewing Repair Iron On Stamp Applique
like
Find Similar
Van Gogh self-portrait cartoon embroidery patch for DIY clothing decor, size 5.2x8cm - Van Gogh Portrait Style (PE6890CT) / 5.2x8cm
Starry Night stamp patch with Doctor Who TARDIS design for DIY clothing 6.5x8.5cm - Starry Night Police Box Stamp Style (PE6928CT) / 6.5x8.5cm
Van Gogh Portrait And Starry Night Police Box Embroidered Patches For Clothing DIY Sewing Repair Iron On Stamp Applique
-5%
$0.55-0.70
Mix MOQ : 10
Heart Shaped Embroidered Patches Iron On DIY Applique For Clothing Bags Cartoon Cat Flower Love Polyester Craft
Heart Shaped Embroidered Patches Iron On DIY Applique For Clothing Bags Cartoon Cat Flower Love Polyester Craft
like
Find Similar
Pink heart embroidery patch with blue heart detail and size specs 4.9cm by 5.5cm - Orange Blue Small Heart (B1L-C-1-6)
Blue heart embroidery patch with pink Love lettering and star details for DIY crafts - Blue Love Heart (B1L-C-1-4)
Pink heart embroidery patch with blue wings and smiley face for DIY clothing decor - Pink Winged Smile (B1L-C-1-5)
Self-adhesive heart shaped mountain embroidery patch for clothing DIY 5.5x4.9cm - Mountain Landscape Heart (B1L-C-1-8)
+4
Heart Shaped Embroidered Patches Iron On DIY Applique For Clothing Bags Cartoon Cat Flower Love Polyester Craft
$0.22-0.27
No MOQ
 · 
25 views
Free Shipping
Pizza Embroidery Patch Cartoon Food DIY Iron On Patch For Clothing Bags Apparel Sewing Decoration Embroidery Applique
Pizza Embroidery Patch Cartoon Food DIY Iron On Patch For Clothing Bags Apparel Sewing Decoration Embroidery Applique
like
Find Similar
Set of 8 pizza embroidery patches including heart shape and slices, total weight 21.9g - Pizza Food Play Patch Set
Macro shot of embroidered pizza slice patch showing detailed stitching and 7.1cm dimensions - Pizza Patch 1# (Incomplete Round)
Detailed embroidery dimensions of the 7cm pizza patch showing width and weight specs - Pizza Food Patch 2# (Shrimp Style)
Pizza slice embroidered patch for DIY clothing creative repair 6.5x7cm size - Pizza Patch 3# (Full Toppings Round)
+5
Pizza Embroidery Patch Cartoon Food DIY Iron On Patch For Clothing Bags Apparel Sewing Decoration Embroidery Applique
$0.24-2.94
No MOQ
Free Shipping
Handmade DIY Crochet Puff Flowers Soft Cotton Yarn Floral Ornament For Clothing Hat Bags DIY Craft Decor Accessories
Handmade DIY Crochet Puff Flowers Soft Cotton Yarn Floral Ornament For Clothing Hat Bags DIY Craft Decor Accessories
like
Find Similar
Handmade crochet puff flower in cream with pink center for DIY crafts and accessories - Beige + Pink Heart
Handmade 3cm yellow and white milk cotton crochet puff flower for DIY crafts and decor - Orange + White Heart
Handmade white crochet flower with brown center, measuring 3.3cm for DIY accessories - Beige + Brown Heart
Handmade crochet puff flower in cream and brown yarn shown with measurement ruler - Beige + Coffee Heart
+1
NewHandmade DIY Crochet Puff Flowers Soft Cotton Yarn Floral Ornament For Clothing Hat Bags DIY Craft Decor Accessories
$0.14-0.16
No MOQ
Alphabet Letters Embroidery Patches Autumn Thanksgiving Halloween Theme Decorative Applique For Clothing DIY Repair
Alphabet Letters Embroidery Patches Autumn Thanksgiving Halloween Theme Decorative Applique For Clothing DIY Repair
like
Find Similar
Adhesive sheets for strawberry alphabet patches, application guide 20cm x 10cm - One Sheet Strong Adhesive 20*10CM
Turkey alphabet A letter embroidery patch for clothes with 6.5cm x 6cm dimensions - Letter A
Size specifications for embroidered letter B patch with colorful striped texture - Letter B
Embroidered letter C patch with sunflower design and dimensions 6.5cm by 5.3cm - Letter C
+32
Alphabet Letters Embroidery Patches Autumn Thanksgiving Halloween Theme Decorative Applique For Clothing DIY Repair
$0.21-8.03
No MOQ
Free Shipping
Camouflage Embroidered Patches Polyester Cotton Iron On Sew On Decorative Cloth Stickers For Clothing Bags Hats DIY
Camouflage Embroidered Patches Polyester Cotton Iron On Sew On Decorative Cloth Stickers For Clothing Bags Hats DIY
like
Find Similar
Assorted camouflage embroidered patches with sport wear text for DIY apparel decor - Full Set (11 PCS)
Camouflage Embroidered Patches Polyester Cotton Iron On Sew On Decorative Cloth Stickers For Clothing Bags Hats DIY
$2.02
Mix MOQ : 10
 · 
21 views
Free Shipping
Embroidery Patches Self-Adhesive Cartoon Chibi Characters DIY Clothing Decorative Stickers For Jackets Backpacks Applique
Embroidery Patches Self-Adhesive Cartoon Chibi Characters DIY Clothing Decorative Stickers For Jackets Backpacks Applique
like
Find Similar
Embroidered cartoon couple patches featuring a boy and girl for DIY clothing decoration - Cartoon Couple 1# (2Pcs)
Cartoon boy embroidery patch with blue overalls and glasses, 7cm x 4.6cm self-adhesive sticker - Cartoon Boy 1# (With Glasses)
Detailed view of cartoon boy embroidery patch with dimensions 7cm by 4.2cm and 2.1g weight - Self-Adhesive Boy 8# (Black T-shirt)
Detail of cartoon girl embroidery patch with 7.2cm height and 2.6g weight dimensions - Girl Patch 7# (Black Top)
+9
Embroidery Patches Self-Adhesive Cartoon Chibi Characters DIY Clothing Decorative Stickers For Jackets Backpacks Applique
$0.29-2.97
No MOQ
Free Shipping
Cartoon Apple Embroidery Patches Polyester Thread Iron On Fruit Patterns For Clothing Backpack DIY Decorative
Cartoon Apple Embroidery Patches Polyester Thread Iron On Fruit Patterns For Clothing Backpack DIY Decorative
like
Find Similar
Embroidered red apple patch in a transparent bag with a blue bow for clothes decoration - Style 1
Creative melting red apple embroidered iron-on patch with green leaf for clothing - 2#
Embroidered apple patch in a sack, creative fruit badge sticker, size 6.7x5.7cm - 3#
Cartoon red apple embroidery patch with a cute worm in top hat, 6.1x6.7cm size - 4#
+13
Cartoon Apple Embroidery Patches Polyester Thread Iron On Fruit Patterns For Clothing Backpack DIY Decorative
$0.23-4.65
No MOQ
Free Shipping
Creative Pizza Embroidery Patches Cartoon Food Embroidered Applique Iron On Badges For Clothing Hats Bags DIY Decoration
Creative Pizza Embroidery Patches Cartoon Food Embroidered Applique Iron On Badges For Clothing Hats Bags DIY Decoration
like
Find Similar
Detail view of colorful pizza embroidery patch with dimensions 6.9cm by 6.1cm - Bitten Pizza Shape Style (披萨布贴3#)
Detail view of pizza slice embroidery patch showing dimensions 7.3cm by 3.2cm - Narrow Long Pizza Slice Style (披萨布贴5#)
Creative Pizza Embroidery Patches Cartoon Food Embroidered Applique Iron On Badges For Clothing Hats Bags DIY Decoration
$0.32-0.43
No MOQ
Free Shipping
Cute Cartoon Duck Plush Embroidery Patches Iron On Self Adhesive Fabric Decorative Appliques For Clothes Bags
Cute Cartoon Duck Plush Embroidery Patches Iron On Self Adhesive Fabric Decorative Appliques For Clothes Bags
like
Find Similar
Detail of cute white plush duck embroidery patch showing 6.5cm and 5.5cm measurements - Tilting Head Duck-6#
Detail of cartoon duck embroidery patch with sailor hat showing 6.5cm size dimension - Forward Moving Duck-7#
Cute embroidered plush duck patch with blue hat and yellow bag for phone case decor - Cute Little Chick-5#
Cute cartoon duck plush embroidery patch with yellow hat and blue bow, size 6.5x4.5cm - Lovely Duck-2#
+5
Cute Cartoon Duck Plush Embroidery Patches Iron On Self Adhesive Fabric Decorative Appliques For Clothes Bags
$0.28-2.65
No MOQ
Free Shipping
Cartoon Ghost Embroidery Patches Funny Animal Cat Goose Iron On Patches For Clothing DIY T-Shirt Jacket Applique Decor
Cartoon Ghost Embroidery Patches Funny Animal Cat Goose Iron On Patches For Clothing DIY T-Shirt Jacket Applique Decor
like
Find Similar
Cartoon white ghost embroidery patch with red horns and knife for DIY clothing - Devil Ghost With Knife (PE8269CT)
Embroidered goose meme patch with Be Gay Do Crime slogan and orange details - Goose With Knife Be Gay Do Crime (PE8277CT)
Gothic embroidered patch featuring purple cat with pentagram and moon, size 7x6.5cm - Gothic Pentagram Purple Cat (PE8291CT)
Macro detail of raccoon embroidery patch with I level up text, sized 5.1x6.1cm - Raccoon With Sword And Shield (PE8337CT)
Cartoon Ghost Embroidery Patches Funny Animal Cat Goose Iron On Patches For Clothing DIY T-Shirt Jacket Applique Decor
-6%
$0.27-0.77
Mix MOQ : 10
Free Shipping
Construction Vehicle Embroidered Patches Polyester Cartoon Excavator Bulldozer Iron On Sew On For Kids Clothing Decoration
Construction Vehicle Embroidered Patches Polyester Cartoon Excavator Bulldozer Iron On Sew On For Kids Clothing Decoration
like
Find Similar
Daisy embroidery patch double-sided adhesive sheets CROWN #513L size 10x20cm - Double-Sided Adhesive Sheet 20*10cm
Set of 9 construction vehicle embroidery patches featuring colorful tractors and excavators - 10-Piece Construction Vehicle Set (W9WJ-102-YT)
Set of 10 yellow construction vehicle iron-on patches with detailed embroidery - 10-Piece Construction Vehicle Set (W9WJ-102-YT)
Size specifications for red steamroller embroidered patch measuring 8x4.5cm for clothing - Red Road Roller (W9WJ-08-01)
+9
Construction Vehicle Embroidered Patches Polyester Cartoon Excavator Bulldozer Iron On Sew On For Kids Clothing Decoration
$0.22-2.94
No MOQ
Snowflake Embroidery Patches Polyester Fabric Heat Melt Adhesive Iron On For DIY Clothing Hats Bags Winter Christmas Decor
Snowflake Embroidery Patches Polyester Fabric Heat Melt Adhesive Iron On For DIY Clothing Hats Bags Winter Christmas Decor
like
Find Similar
Macro detail of snowflake embroidery patch showing fine blue texture and 7cm size - Snowflake Patch 1#
Detailed size view of snowflake embroidery patches in blue and pink with iron-on backing - Snowflake Patch 2#
Detailed view of colorful snowflake embroidery patch showing dimensions 7.1cm by 6.2cm - Snowflake Patch 3#
Detailed view of colorful snowflake embroidery patch with exact size measurements - Snowflake Patch 4#
+47
Snowflake Embroidery Patches Polyester Fabric Heat Melt Adhesive Iron On For DIY Clothing Hats Bags Winter Christmas Decor
$0.27-13.93
No MOQ
 · 
20 views
Free Shipping
Outdoor Adventure Camping Landscape Embroidery Patches Iron On Starry Sky Mountain Star UFO Whale DIY Clothing Applique
Outdoor Adventure Camping Landscape Embroidery Patches Iron On Starry Sky Mountain Star UFO Whale DIY Clothing Applique
like
Find Similar
Detailed embroidery patch showing a camping tent, coffee cup, and pine trees - Camping Coffee Cup Style (PE5902CT)
Starry adventure landscape heart-shaped embroidery patch with mountain forest design - Mountain Heart Style (PE5905CT) / 5.2x7.5cm
Detailed embroidery patch showing a creative whale island with palm trees and a tent - Creative Whale Island Style (PE5907CT)
Embroidered landscape patch with mountain and forest design, size 5.5x7.1cm for DIY clothes - Polaroid Landscape Style (PE5818CT) / 5.5x7.1cm
Outdoor Adventure Camping Landscape Embroidery Patches Iron On Starry Sky Mountain Star UFO Whale DIY Clothing Applique
-4%
$0.61-0.96
No MOQ
Free Shipping
Sweet Plush Star Patch Fabric Metal Embellishment For DIY Hair Clips Phone Case Decoration Soft Star Shape Craft Accessories
Sweet Plush Star Patch Fabric Metal Embellishment For DIY Hair Clips Phone Case Decoration Soft Star Shape Craft Accessories
like
Find Similar
Close-up of plush star patches with metallic mirror finish for DIY hair accessories - White
Macro detail of plush brown star-shaped DIY accessories with silver metal center decoration - Light Coffee
Detail view of plush brown felt star with metallic silver star inlay for DIY crafts - Dark Coffee
Macro shot of rose red plush star patches with metallic center for DIY crafts - Rose Red
+2
NewSweet Plush Star Patch Fabric Metal Embellishment For DIY Hair Clips Phone Case Decoration Soft Star Shape Craft Accessories
$0.08
Mix MOQ : 10
White Rose Flower Embroidery Patches Lace Appliques For Clothing Repair DIY Decoration Sewing On Jacket Dress
White Rose Flower Embroidery Patches Lace Appliques For Clothing Repair DIY Decoration Sewing On Jacket Dress
like
Find Similar
White rose flower lace embroidery patch measuring 9.3cm by 13.6cm on wood background - Two Flowers on Stem (9.3x13.6cm)
White embroidered rose patch with dimensions 12cm by 14.5cm for clothing repair - Large Peony Flower (12x14.5cm)
White floral lace embroidery patch for clothing repairs, size 4.7cm by 4.8cm - Six-petal Small Flower (4.7x4.8cm)
White maple leaf embroidered patch with detailed stitching and 9x9cm dimensions - Maple Leaf Shape (9x9cm)
+10
White Rose Flower Embroidery Patches Lace Appliques For Clothing Repair DIY Decoration Sewing On Jacket Dress
$0.05-0.48
Mix MOQ : 5
Free Shipping
Musical Note Embroidery Patch Polyester Decorative Iron On Applique For Clothing Bag Hat DIY Craft Musical Symbol Patch
Musical Note Embroidery Patch Polyester Decorative Iron On Applique For Clothing Bag Hat DIY Craft Musical Symbol Patch
like
Find Similar
Yellow double eighth note music patch with black embroidery border for clothes and bags - Yellow Double Eighth Note Style (I) / 6.5x4.5cm
Yellow musical note embroidery patch with black border, size 4.0x7.0cm for DIY sewing - Yellow Eighth Note Style (J) / 4.0x7.0cm
Bright green musical note embroidery patch with black edges for clothing DIY, 6.5x4.5cm - Green Double Eighth Note Style (A) / 6.5x4.5cm
Yellow eighth note musical symbol embroidery patch with black edges, 4.5x7.0 cm size - Yellow Sixteenth Note Style (C) / 4.5x7.0cm
+5
Musical Note Embroidery Patch Polyester Decorative Iron On Applique For Clothing Bag Hat DIY Craft Musical Symbol Patch
$0.08-0.12
No MOQ
Chenille Sports Ball Embroidered Patches Sports Theme Iron On Patch With Glitter Border For Clothing Bag Decoration
Chenille Sports Ball Embroidered Patches Sports Theme Iron On Patch With Glitter Border For Clothing Bag Decoration
like
Find Similar
Macro detail of a 6cm yellow softball chenille patch with red stitching and gold sequins - Yellow Softball Style (1#)
6cm volleyball chenille patch with glitter gold border for sports apparel and bags - Black and White Volleyball Style (2#)
6CM Chenille tennis ball patch with lime green fluffy texture and gold glitter border - Bright Green Tennis Style (3#)
6cm Chenille golf ball patch with white fluffy texture and gold glitter sequins embroidery - White Golf Style (4#)
+1
Chenille Sports Ball Embroidered Patches Sports Theme Iron On Patch With Glitter Border For Clothing Bag Decoration
$0.35-4.24
No MOQ
Free Shipping
Space Astronaut Rocket Cartoon Embroidery Patch Set Iron On Appliques For Clothing Jeans Backpack DIY Repair Decorative Patches
Space Astronaut Rocket Cartoon Embroidery Patch Set Iron On Appliques For Clothing Jeans Backpack DIY Repair Decorative Patches
like
Find Similar
Close-up of 12 space-themed embroidery patches including rockets, astronauts and planets - Full Set Space Theme
Detail view of oval cartoon embroidery patch with blue fabric and star patterns - Bright Blue Cartoon Face Profile (星球膝盖贴-9#)
Detail of space astronaut embroidery patch with UFO on denim fabric for clothing repair - Denim Astronaut UFO Letter Q (星球膝盖贴-8#)
Detailed astronaut embroidery patch for clothing repair with UFO and stars 8.3x12.8cm - Black Oval Astronaut UFO (星球膝盖贴-7#)
+9
Space Astronaut Rocket Cartoon Embroidery Patch Set Iron On Appliques For Clothing Jeans Backpack DIY Repair Decorative Patches
$0.24-3.46
No MOQ
Embroidery Morale Patch Hook And Loop Backing Tactical Badge Drone Pilot Theme For Backpacks And Jackets Decorative Accessory
Embroidery Morale Patch Hook And Loop Backing Tactical Badge Drone Pilot Theme For Backpacks And Jackets Decorative Accessory
like
Find Similar
Tactical black patch with GIVE RESPECT GET RESPECT white embroidery for drone bags - Square Give Respect (White Edge)
8cm Drone Pilot embroidered patch with Give Respect Get Respect slogan on black - Round Give Respect (Black & White)
Drone Pilot Two Wheels Down embroidered motorcycle tactical backpack patch 8cm diameter - Round Two Wheels Down (Black & White)
Army green Drone Pilot embroidered tactical morale patch with 8cm measurement display - Round Drone Pilot (Green)
+3
Embroidery Morale Patch Hook And Loop Backing Tactical Badge Drone Pilot Theme For Backpacks And Jackets Decorative Accessory
-5%
$0.88-1.64
No MOQ
Free Shipping
Embroidered Patch Slogan Mama Says Im Special Morale Tactical Badge With Hook And Loop Backing For Backpack Apparel
Embroidered Patch Slogan Mama Says Im Special Morale Tactical Badge With Hook And Loop Backing For Backpack Apparel
like
Find Similar
9x4cm Mama Says I'm Special embroidered patch for dogs with green and brown stitching - Mama Says I'm Special (Mud)
Close-up of black rectangular patch with white embroidered MAMA SAYS I'M SPECIAL text - Mama Says I'm Special (Black)
Rectangular MAMA SAYS I'M SPECIAL embroidered patch with yellow text on black base - Mama Says I'm Special (Orange)
Tactical embroidered patch featuring red MAMA SAYS I'M SPECIAL text on black base - Mama Says I'm Special (Black Red)
+2
Embroidered Patch Slogan Mama Says Im Special Morale Tactical Badge With Hook And Loop Backing For Backpack Apparel
$0.58
No MOQ
 · 
11 views
Free Shipping
Russian Eagle Embroidered Patches Hook And Loop Tactical Morale Badges Fabric National Emblem Decor For Backpacks Hats
Russian Eagle Embroidered Patches Hook And Loop Tactical Morale Badges Fabric National Emblem Decor For Backpacks Hats
like
Find Similar
Detailed view of Russian double-headed eagle embroidery patches with hook and loop backing - Russian Emblem 2-Piece Set
Macro shot of 8x5cm Russian eagle tricolor embroidery patch with precise black border - POCCNR Russia (Black Yellow White Black Border)
Embroidered Russian Empire flag patch with white, yellow, and black stripes - POCCNR (Black Yellow White White Border)
Detailed embroidery of Russian double-headed eagle patch with Russian text 8x6cm - Imperial Russian Eagle (Vertical 8*6CM)
+9
Russian Eagle Embroidered Patches Hook And Loop Tactical Morale Badges Fabric National Emblem Decor For Backpacks Hats
-8%
$0.80-2.12
No MOQ
Free Shipping
Christmas Winter Theme Embroidery Patches Blue White Snowflake Snowman Penguin Cloth Applique Iron On DIY Clothing Decor
Christmas Winter Theme Embroidery Patches Blue White Snowflake Snowman Penguin Cloth Applique Iron On DIY Clothing Decor
like
Find Similar
Detail of blue snowflake embroidery patch measuring 2.6 inches with intricate stitching - Blue Christmas Patch 1# (Snowflake)
Blue glove embroidery patch with snowflake detail and dimensions 4cm by 7.6cm - Blue Christmas Patch 2# (Mittens)
Blue holly leaf embroidered patch with white border measuring 6.9cm x 4cm and weighing 1.3g - Blue Christmas Patch 3# (Holly Leaf)
Detailed view of hello WINTER embroidered patch with precise size measurements in cm - Blue Christmas Patch 4# (Hello Winter)
+29
Christmas Winter Theme Embroidery Patches Blue White Snowflake Snowman Penguin Cloth Applique Iron On DIY Clothing Decor
$0.17-8.27
No MOQ
 · 
14 views
Free Shipping
Cute School Bus Stationery Embroidery Patches Iron On Fabric Badges For Student Backpack Clothing DIY Repair
Cute School Bus Stationery Embroidery Patches Iron On Fabric Badges For Student Backpack Clothing DIY Repair
like
Find Similar
Detailed dimensions of yellow school bus embroidered patch showing 7.9cm width and 1.8g weight - School Bus
Detailed size chart for the compass embroidery patch showing height and weight dimensions - Compass
Cartoon alarm clock embroidered patch measuring 5.8 cm x 5.7 cm on white background - Alarm Clock
Macro view of paint palette embroidery patch with 5.5cm x 6.5cm size markings - Palette
+13
Cute School Bus Stationery Embroidery Patches Iron On Fabric Badges For Student Backpack Clothing DIY Repair
$0.20-4.24
No MOQ
 · 
16 views
Free Shipping
Celestial Sun Moon UFO Embroidered Patches Iron On Decorative Fabric Appliques Badge For Clothing Backpacks Jackets DIY
Celestial Sun Moon UFO Embroidered Patches Iron On Decorative Fabric Appliques Badge For Clothing Backpacks Jackets DIY
like
Find Similar
Detail of pop art embroidered patch showing kissing couple motif with 7x7.4cm dimensions - Kissing Art / 7x7.4cm
Gothic skeletal hand embroidered patch with colorful floral details and pink border - Skeleton Hand Flowers / 6.4x8.5cm
Artistic sun and moon embroidery patch with 8.1x8.4cm dimensions for clothing DIY - Sun Moon Face / 8.1x8.4cm
Macro shot of sun and moon embroidery patch with stars and detailed stitching, size 7.9x8.1cm - Sun and Moon / 7.9x8.1cm
+1
Celestial Sun Moon UFO Embroidered Patches Iron On Decorative Fabric Appliques Badge For Clothing Backpacks Jackets DIY
$0.63-1.15
Mix MOQ : 10
 · 
32 views
Free Shipping
Chenille Alphabet Patches White Towel Embroidery Gold Glitter Border Peel And Stick Self Adhesive DIY Clothing Decor
Chenille Alphabet Patches White Towel Embroidery Gold Glitter Border Peel And Stick Self Adhesive DIY Clothing Decor
like
Find Similar
8cm Chenille letter A patch with gold glitter edge and peel and stick adhesive backing - Letter A / White
Detail of chenille letter B patch with gold glitter edge and peel and stick adhesive backing - Letter B / White
Detail of chenille letter C patch with gold glitter edge and self-adhesive backing - Letter C / White
Detailed view of 8CM chenille letter D patch with gold glitter edge and self-adhesive backing - Letter D / White
+22
Chenille Alphabet Patches White Towel Embroidery Gold Glitter Border Peel And Stick Self Adhesive DIY Clothing Decor
$0.81
Mix MOQ : 2
Free Shipping
Self-Adhesive Star Embroidery Patches Glitter North Star Appliques For Clothing Phone Case DIY Decoration Repair Patches
Self-Adhesive Star Embroidery Patches Glitter North Star Appliques For Clothing Phone Case DIY Decoration Repair Patches
like
Find Similar
Self-adhesive green star embroidered patch with dimensions 3.2cm by 2.4cm on white background - Green
Detailed macro view of a 3.2cm blue and white star embroidered patch with size indicators - Blue
Detail view of yellow star embroidery patch showing fabric texture and 3.2cm height scale - Yellow
Detail of pink star embroidery patch with dimensions 3.2cm by 2.4cm on white background - Pink
+1
Self-Adhesive Star Embroidery Patches Glitter North Star Appliques For Clothing Phone Case DIY Decoration Repair Patches
$0.12
No MOQ
Free Shipping
Punk Rock Embroidered Large Patch For Denim Jackets American Vintage Biker Skeleton Eagle Motorcycle Route 66 Shield Embroidered Decoration Patch
Punk Rock Embroidered Large Patch For Denim Jackets American Vintage Biker Skeleton Eagle Motorcycle Route 66 Shield Embroidered Decoration Patch
like
Find Similar
Punk Grim Reaper motorcycle embroidered patch for jacket back DIY, size 29.5x26.5cm - Death Rider Motorcycle (DB0853CT)
Large 30x25cm American bald eagle embroidery patch with flag for biker denim jackets - Spreading Wings Eagle With Flag (DB0854CT)
Large Route 66 and eagle head embroidery patch for DIY jackets, size 30x26.5cm - Eagle Head Route 66 (DB0855CT)
Large punk motorcycle embroidery patch for jackets with Independent No Club design - Cruiser Motorcycle (DB0856CT)
Punk Rock Embroidered Large Patch For Denim Jackets American Vintage Biker Skeleton Eagle Motorcycle Route 66 Shield Embroidered Decoration Patch
-4%
$3.43-5.34
No MOQ
Free Shipping
Tactical Embroidered Patch Hook And Loop Military Badge For Jackets Bags Tactical Gear Polyester Fabric Retro Style
Tactical Embroidered Patch Hook And Loop Military Badge For Jackets Bags Tactical Gear Polyester Fabric Retro Style
like
Find Similar
Top Gun Maverick style triangular navy flight embroidery patch with gold wings and stars - Triangle
Top Gun Maverick style embroidered COMCRUDESFLOT military patch with golden edge - US 9
Top Gun Maverick style embroidered shield patch with helmet design, 11x8cm size - Starr Style
Top Gun Maverick Destroyer Cruiser military embroidered patch on a white background - Aircraft Carrier
+13
Tactical Embroidered Patch Hook And Loop Military Badge For Jackets Bags Tactical Gear Polyester Fabric Retro Style
$0.86-4.32
No MOQ
 · 
20 views
Free Shipping
Jewish Hanukkah Embroidery Patches Polyester Star Of David Menorah Dreidel Festive Decorative Iron On Applique Badges
Jewish Hanukkah Embroidery Patches Polyester Star Of David Menorah Dreidel Festive Decorative Iron On Applique Badges
like
Find Similar
Embroidered Star of David Hanukkah patch in blue and yellow, 6.7x6.3cm size - Star of David Style (1#)
Hanukkah book patch with blue Star of David embroidery measuring 6.2cm by 4.8cm - Torah Style (2#)
Hanukkah gift box embroidery patch in royal blue with yellow ribbon and size markings - Gift Box Style (3#)
Star of David embroidered Hanukkah patch in gold finish, size 6.7cm by 6.6cm - Gold Coin Style (4#)
+5
Jewish Hanukkah Embroidery Patches Polyester Star Of David Menorah Dreidel Festive Decorative Iron On Applique Badges
$0.23-2.29
No MOQ
Free Shipping
Vintage Round Velvet Buttons For DIY Handcraft Accessories Fabric Covered Patches 25mm Decorative Button For Hats Clothes
Vintage Round Velvet Buttons For DIY Handcraft Accessories Fabric Covered Patches 25mm Decorative Button For Hats Clothes
like
Find Similar
Detail of dark brown velvet magnetic buttons for DIY headwear and hat accessories - Dark Coffee
Macro shot of wine red velvet round fabric buttons with flat metal back for DIY jewelry - Burgundy
Detail showing mustard yellow velvet fabric covered buttons with silver metal backings - Mustard Yellow
Macro view of navy blue velvet round buttons and silver flat back for DIY crafts - Dark Blue
Vintage Round Velvet Buttons For DIY Handcraft Accessories Fabric Covered Patches 25mm Decorative Button For Hats Clothes
$0.14
Mix MOQ : 2
Christmas Cartoon Embroidery Patches Iron On Sew On Fabric Badges For DIY Clothing Backpack Holiday Decoration Snowman Reindeer
Christmas Cartoon Embroidery Patches Iron On Sew On Fabric Badges For DIY Clothing Backpack Holiday Decoration Snowman Reindeer
like
Find Similar
Detailed size specifications for a cute polar bear embroidered Christmas patch - Style 1# (Polar Bear)
Detailed embroidery of reindeer and Christmas stocking patches with precise dimensions - Style 2# (Reindeer)
Christmas sloth embroidery patch dimensions showing 6.6cm width and 3cm height with 0.9g weight - Style 3# (Sloth)
Detailed size chart for a cute snowman embroidery patch with precise dimensions - Style 4# (Snowman)
+13
Christmas Cartoon Embroidery Patches Iron On Sew On Fabric Badges For DIY Clothing Backpack Holiday Decoration Snowman Reindeer
$0.17-5.29
No MOQ
Free Shipping
Christmas Halloween Embroidery Patches A-Z Letters Decorative Iron On Sew On For Clothing DIY Ornament
Christmas Halloween Embroidery Patches A-Z Letters Decorative Iron On Sew On For Clothing DIY Ornament
like
Find Similar
Christmas tree embroidered patch with colorful decorations and star for holiday DIY decor - Christmas Tree-A
Detailed size view of Christmas letter B embroidery patch with festive Santa hat - Christmas Hat Letter-B
Christmas embroidered letter C patch with green pattern and red bow, sized 7x5cm - Christmas Letter-C
Detailed size view of red letter D Christmas embroidery patch showing 6cm height and 5cm width - Christmas Letter-D
+34
Christmas Halloween Embroidery Patches A-Z Letters Decorative Iron On Sew On For Clothing DIY Ornament
$0.17-8.03
No MOQ
Free Shipping
Vintage College Style Plaid Heart Fabric Covered Buttons Flatback Accessories For Clothing Shoe DIY Jewelry Making
Vintage College Style Plaid Heart Fabric Covered Buttons Flatback Accessories For Clothing Shoe DIY Jewelry Making
like
Find Similar
Detail of red and black plaid heart-shaped fabric buttons with flat metal backings - Plaid Heart (Purple) / Purple
Macro shot of heart-shaped plaid fabric buttons with flat metal back for DIY crafts - Plaid Heart (Blue) / Blue
Close-up of heart-shaped plaid fabric buttons with flat metal back for DIY crafts - Plaid Heart (Yellow) / Yellow
Close-up of heart-shaped plaid fabric buttons with metal back for DIY crafts - Plaid Heart (Pink) / Pink
Vintage College Style Plaid Heart Fabric Covered Buttons Flatback Accessories For Clothing Shoe DIY Jewelry Making
$0.08
Mix MOQ : 10
Go to

More in bags

Women's Bags
Men's Bags

Explore more in woven patches

shoulderbag large capacitylettertravelwidegirlssimplemobile phonestarparty
strapcolorstyleheartartificialhandmadehollowhandsquareunderarm

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access