Everful

Wholesale angel pins

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Angel Pins

Find the perfect pieces: alloy brooches, fashion brooches, crystal brooches and more

All products in angel pins

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Funny Skeleton Enamel Pin Gothic Horror Badge Halloween Gift Zinc Alloy Brooch For Backpack Hat Accessories Jewelry
Funny Skeleton Enamel Pin Gothic Horror Badge Halloween Gift Zinc Alloy Brooch For Backpack Hat Accessories Jewelry
like
Find Similar
Skeleton drinking coffee enamel pin with 'As far as I know, I'm delightful' quote - Drinking Skeleton (QHXZ3783)
Black enamel skull brooch with rainbow text Guess I'll Just Dissociate for Halloween - Skeleton Dissociate Text (QHXZ3784)
Enamel heart pin featuring a skeleton reading in bed with a cat and coffee - Heart Home Skeleton (QHXZ3785)
Stay Weird enamel pin featuring a skeleton with pink cowboy hat and possum on white background - Skeleton With Opossum (QHXZ3787)
+1
Funny Skeleton Enamel Pin Gothic Horror Badge Halloween Gift Zinc Alloy Brooch For Backpack Hat Accessories Jewelry
-8%
$0.42
No MOQ
 · 
106 sold recently
Free Shipping
Gothic Enamel Brooch Pins Gothic Halloween Skull UFO Potion Bottle Alloy Lapel Pin For Backpack Clothing Decor Gift
Gothic Enamel Brooch Pins Gothic Halloween Skull UFO Potion Bottle Alloy Lapel Pin For Backpack Clothing Decor Gift
like
Find Similar
Pink UFO enamel pin with alien and 'GET IN LOSER' text on a mint green beam - Pink UFO Alien (QHXZ032)
Get In Loser enamel pin featuring skeletons in a pink car on a white background - Skull Convertible Car (QHXZ034)
Pink heart-shaped metal brooch featuring black spiderweb pattern and Stay Weird text - Spider Web Heart (QHXZ036)
Pink horror cassette tape enamel pin featuring dripping blood and a sharp knife design - Tape Cassette Horror Slime (QHXZ250)
+4
Gothic Enamel Brooch Pins Gothic Halloween Skull UFO Potion Bottle Alloy Lapel Pin For Backpack Clothing Decor Gift
-10%
$0.47-0.58
No MOQ
Horror Movie Monster Enamel Pin Alloy Painted Brooch Halloween Cartoon Badge For Backpack Clothes Decor Vampire Mummy Wolfman Design Unisex Jewelry
Horror Movie Monster Enamel Pin Alloy Painted Brooch Halloween Cartoon Badge For Backpack Clothes Decor Vampire Mummy Wolfman Design Unisex Jewelry
like
Find Similar
Cartoon enamel pin featuring a colorful mummy-style female character portrait in orange - Egyptian Mummy Female Character (QHXZ4300)
Orange monster enamel pin in cartoon horror style with purple accents for bags - Purple Comic Style Monster Face (QHXZ4292)
Angry gorilla enamel pin badge with vibrant red and yellow lightning facial patterns - Roaring Gorilla Head (QHXZ4293)
Gothic vampire girl enamel pin with purple skin and black hair on white background - Vampire Female Face (QHXZ4294)
+5
Horror Movie Monster Enamel Pin Alloy Painted Brooch Halloween Cartoon Badge For Backpack Clothes Decor Vampire Mummy Wolfman Design Unisex Jewelry
-8%
$0.45
No MOQ
Funny Skeleton Reading Enamel Pin Bookworm Alloy Brooch THE READER Forever Working On My TBR Badge For Backpack Clothing Gift
Funny Skeleton Reading Enamel Pin Bookworm Alloy Brooch THE READER Forever Working On My TBR Badge For Backpack Clothing Gift
like
Find Similar
Tarot card enamel pin featuring a skeleton on books with The Reader text in blue - Tarot Reader Style (QHXZ2184)
Round enamel pin with skull reading a book and Forever Working On My TBR text - Working On My TBR Style (QHXZ2186)
Enamel pin featuring a skeleton reading a pink book with Let Me Read In Peace text - Read In Peace Style (QHXZ2187)
Funny Skeleton Reading Enamel Pin Bookworm Alloy Brooch THE READER Forever Working On My TBR Badge For Backpack Clothing Gift
-9%
$0.55
No MOQ
 · 
71 sold recently
Vintage Celestial Butterfly Enamel Pin Brooch Alloy Sun Moon Stars Astrology Pattern Badge Gift For Women Clothing Accessory
Vintage Celestial Butterfly Enamel Pin Brooch Alloy Sun Moon Stars Astrology Pattern Badge Gift For Women Clothing Accessory
like
Find Similar
Creative butterfly enamel pin with celestial sun moon and planet patterns in gold finish - Starry Sky Butterfly Style (XZ3818)
Vintage Celestial Butterfly Enamel Pin Brooch Alloy Sun Moon Stars Astrology Pattern Badge Gift For Women Clothing Accessory
-9%
$0.47
No MOQ
 · 
20 sold recently
Free Shipping
Halloween Pumpkin Enamel Brooch Humorous Skull Hand Booty Design Pin Funny Cartoon Badge For Party Accessory Festival Jewelry
Halloween Pumpkin Enamel Brooch Humorous Skull Hand Booty Design Pin Funny Cartoon Badge For Party Accessory Festival Jewelry
like
Find Similar
Funny Halloween pumpkin enamel pin featuring skeleton hands and Spooktacular booty text - Booty Pumpkin Style (QHXZ4943)
Halloween enamel pin featuring an orange pumpkin with white skeleton hand motif - Double Pumpkin Style (QHXZ5079)
Halloween Pumpkin Enamel Brooch Humorous Skull Hand Booty Design Pin Funny Cartoon Badge For Party Accessory Festival Jewelry
-9%
$0.50
No MOQ
 · 
30 sold recently
Free Shipping
Creative Alloy Enamel Heart Brooch Pin Punk Skull Wave Art Creation Adam Lapel Pin Cartoon Badge Jewelry Accessory
Creative Alloy Enamel Heart Brooch Pin Punk Skull Wave Art Creation Adam Lapel Pin Cartoon Badge Jewelry Accessory
like
Find Similar
Macro shot of heart-shaped brooch with blue ocean waves in classic Japanese art style - Ukiyo-e Wave Style (XZ8573)
Creative heart shaped enamel pin featuring black background and white skeleton hands - Skeleton Pinky Swear Style (XZ8576)
Creative heart-shaped enamel pin featuring white skulls on a grey background - Double Skeleton Style (xz8577)
Creative Alloy Enamel Heart Brooch Pin Punk Skull Wave Art Creation Adam Lapel Pin Cartoon Badge Jewelry Accessory
-8%
$0.63
No MOQ
Free Shipping
Vintage Celestial Butterfly Moon Phase Enamel Brooch Pin Set Alloy Starry Moth Lapel Pin For Women Daily Dress Jewelry
Vintage Celestial Butterfly Moon Phase Enamel Brooch Pin Set Alloy Starry Moth Lapel Pin For Women Daily Dress Jewelry
like
Find Similar
Exquisite butterfly enamel brooch with lunar phases and star patterns in purple and gold - Purple Orange Moon Butterfly (XZ5896)
Detail of purple butterfly enamel pin with gold plating and moon pattern wings - Yellow Black Pink Moon Butterfly (XZ5897)
Celestial moth enamel pin featuring moon phases and stars in gold and blue finish - Blue Green Celestial Moth (XZ5898)
Exquisite butterfly metal brooch with celestial moon phase and star enamel design - Sky Blue Celestial Eye Butterfly (XZ5899)
+1
Vintage Celestial Butterfly Moon Phase Enamel Brooch Pin Set Alloy Starry Moth Lapel Pin For Women Daily Dress Jewelry
-9%
$0.68
No MOQ
 · 
11 sold recently
Free Shipping
Vintage Scarecrow Enamel Brooch Pin Alloy Multicolor Rhinestone Crow Bird Lapel Pin Fashion Coat Jacket Decorative Jewelry
Vintage Scarecrow Enamel Brooch Pin Alloy Multicolor Rhinestone Crow Bird Lapel Pin Fashion Coat Jacket Decorative Jewelry
like
Find Similar
Cartoon scarecrow enamel brooch with a black bird and vibrant autumn colors on white background - Scarecrow Style (C906-A)
Vintage Scarecrow Enamel Brooch Pin Alloy Multicolor Rhinestone Crow Bird Lapel Pin Fashion Coat Jacket Decorative Jewelry
-9%
$1.18
Mix MOQ : 3
 · 
16 sold recently
Vintage Halloween Pumpkin Brooch For Women Men Zinc Alloy Enamel Rhinestone Pin Badge Festive Party Jewelry Gift
Vintage Halloween Pumpkin Brooch For Women Men Zinc Alloy Enamel Rhinestone Pin Badge Festive Party Jewelry Gift
like
Find Similar
Sparkling Halloween pumpkin brooch with orange enamel and crystals in gold setting - Orange Pumpkin Style (001)
Vintage Halloween Pumpkin Brooch For Women Men Zinc Alloy Enamel Rhinestone Pin Badge Festive Party Jewelry Gift
-9%
$0.65
No MOQ
 · 
13 sold recently
Creative Enamel Heart Key Eye Brooch Pins Alloy Surrealist Lapel Pin For Couples Clothing Backpack Decoration Accessories
Creative Enamel Heart Key Eye Brooch Pins Alloy Surrealist Lapel Pin For Couples Clothing Backpack Decoration Accessories
like
Find Similar
Creative heart and eye key enamel brooch pin in red and blue finish for couples - Heart Style (CC416)
Creative heart eye key brooch with red enamel heart and light blue key shaft details - Key Style (CC417)
Creative Enamel Heart Key Eye Brooch Pins Alloy Surrealist Lapel Pin For Couples Clothing Backpack Decoration Accessories
-9%
$0.60
No MOQ
Alloy Enamel Rhinestone Brooch Pin Stacked Books And Glasses Design Vintage Creative Clothing Accessory For Women Men Gift
Alloy Enamel Rhinestone Brooch Pin Stacked Books And Glasses Design Vintage Creative Clothing Accessory For Women Men Gift
like
Find Similar
Creative enamel book and glasses brooch with rhinestones for men and women 3.9cm - Colorful
Enamel book stack and eyeglasses brooch with rhinestones for men and women - Blue
Alloy Enamel Rhinestone Brooch Pin Stacked Books And Glasses Design Vintage Creative Clothing Accessory For Women Men Gift
-9%
$2.10
No MOQ
Free Shipping
Gothic Severed Hand Alloy Enamel Brooch Pin Horror Stitch Design Hand Badge For Backpack Clothes Costume Halloween Decoration
Gothic Severed Hand Alloy Enamel Brooch Pin Horror Stitch Design Hand Badge For Backpack Clothes Costume Halloween Decoration
like
Find Similar
Detailed Thing hand enamel pin with black stitching from The Addams Family movie series - Severed Hand Gesture Style (xz9107)
Gothic Severed Hand Alloy Enamel Brooch Pin Horror Stitch Design Hand Badge For Backpack Clothes Costume Halloween Decoration
-10%
$0.52
No MOQ
 · 
15 sold recently
Creative Cartoon Alloy Enamel Brooch Pin Set Cute Animal Succulent Plant Food Funny Pun Badge For Clothes Bag Hat Accessory
Creative Cartoon Alloy Enamel Brooch Pin Set Cute Animal Succulent Plant Food Funny Pun Badge For Clothes Bag Hat Accessory
like
Find Similar
Colorful cartoon clown rabbit metal badge pin with yellow polka dots on white background - Yellow Clown Rabbit (QHXZ084)
Cartoon enamel pin featuring a cute green frog hiding in a vibrant orange flower pot - Frog Potted Plant (QHXZ692)
Cute cartoon turtle enamel pin with sunglasses and "TURTLEY COOL, DUDE" banner - Turtle with Sunglasses (QHXZ865)
Cartoon orange toad enamel pin badge with Toad You So banner on white background - Funny Toad (QHXZ866)
+6
Creative Cartoon Alloy Enamel Brooch Pin Set Cute Animal Succulent Plant Food Funny Pun Badge For Clothes Bag Hat Accessory
-9%
$0.45-0.58
No MOQ
 · 
20 sold recently
Free Shipping
Halloween Enamel Ghost Brooch Pin Set Alloy Gothic Cartoon Pumpkin Chainsaw Tarot Badge For Party Women Men Gift Jewelry
Halloween Enamel Ghost Brooch Pin Set Alloy Gothic Cartoon Pumpkin Chainsaw Tarot Badge For Party Women Men Gift Jewelry
like
Find Similar
Halloween ghost lovers tarot enamel pin featuring a heart shaped ghost badge - Qhxz2426
Pink heart enamel pin with cute ghosts and pumpkin elements for Halloween style - Pumpkin Ghost Teardrop Style (QHXZ2427)
Halloween enamel pin featuring a white ghost and RIP tombstone inside a pink bottle - Bottle Gravestone Ghost Style(QHXZ2428)
Halloween ghost enamel pin featuring long legs in fishnet stockings and high heels - Ghost with Fishnet Legs Style (QHXZ24129)
+1
Halloween Enamel Ghost Brooch Pin Set Alloy Gothic Cartoon Pumpkin Chainsaw Tarot Badge For Party Women Men Gift Jewelry
-9%
$0.50
No MOQ
Free Shipping
Halloween Creative Black Cat Wizard Hat Alloy Enamel Brooch Pins Lacquered Witch Moon Star Badge Backpack Clothing Jewelry Gift
Halloween Creative Black Cat Wizard Hat Alloy Enamel Brooch Pins Lacquered Witch Moon Star Badge Backpack Clothing Jewelry Gift
like
Find Similar
Halloween black cat enamel pin with wizard hat and floral details in gold finish - Floral Black Cat Wizard Hat Style (xz3252)
Halloween Creative Black Cat Wizard Hat Alloy Enamel Brooch Pins Lacquered Witch Moon Star Badge Backpack Clothing Jewelry Gift
-9%
$0.47
No MOQ
Free Shipping
Cartoon Cryptid Enamel Pins Set Bigfoot Alien Nessie Jackalope Jersey Devil Alloy Brooch With Motivational Quote Jewelry
Cartoon Cryptid Enamel Pins Set Bigfoot Alien Nessie Jackalope Jersey Devil Alloy Brooch With Motivational Quote Jewelry
like
Find Similar
Cute golden and white enamel jackalope pin badge with "Believes in You" text - Jackalope Style (XZ9591)
Cartoon Bigfoot enamel pin with BELIEVES IN YOU banner and black pine tree - Bigfoot Style (XZ9592)
Green Nessie dinosaur enamel pin with 'Nessie Believes In You' text on white background - Nessie Style (XZ9593)
Cartoon Cryptid Enamel Pins Set Bigfoot Alien Nessie Jackalope Jersey Devil Alloy Brooch With Motivational Quote Jewelry
-9%
$0.76
No MOQ
 · 
1 reviews
Free Shipping
Gothic Dark Alloy Enamel Brooch Pin Collection Halloween Horror Dagger Heart Magic Book Witch Boot Tombstone Bag Decoration
Gothic Dark Alloy Enamel Brooch Pin Collection Halloween Horror Dagger Heart Magic Book Witch Boot Tombstone Bag Decoration
like
Find Similar
Gothic black wizard boot enamel brooch with triple moon and spider web details - Witch Boot Style (XZ6803)
Gothic black bat and silver pentagram enamel brooch pin for Halloween accessories - Pentagram Bat Style (XZ6805)
Gothic Dark Alloy Enamel Brooch Pin Collection Halloween Horror Dagger Heart Magic Book Witch Boot Tombstone Bag Decoration
-10%
$0.52
No MOQ
Free Shipping
Retro Orthodox Cross Enamel Brooch Pin Religious Flower Badge Gold Plated Alloy Lapel Pin For Women Men Jewelry Gifts
Retro Orthodox Cross Enamel Brooch Pin Religious Flower Badge Gold Plated Alloy Lapel Pin For Women Men Jewelry Gifts
like
Find Similar
Golden Orthodox cross brooch with dark blue enamel and white floral corner details - Dark Blue (QHXZ5548)
Orthodox red enamel cross brooch with gold plating and white flower patterns - Red (QHXZ5549)
Orthodox black enamel cross brooch with golden metal edge and white petal design - Black (QHXZ5550)
Golden Orthodox cross brooch with white enamel clover leaf ends and flower accents - White (QHXZ5551)
+3
Retro Orthodox Cross Enamel Brooch Pin Religious Flower Badge Gold Plated Alloy Lapel Pin For Women Men Jewelry Gifts
-9%
$0.39
No MOQ
 · 
13 sold recently
Free Shipping
Artistic Cat Enamel Pins Set Van Gogh Picasso Inspired Skull Potion Cat Badges Cute Alloy Brooches For Clothing Backpack Cat Mom Jewelry Gift
Artistic Cat Enamel Pins Set Van Gogh Picasso Inspired Skull Potion Cat Badges Cute Alloy Brooches For Clothing Backpack Cat Mom Jewelry Gift
like
Find Similar
Cat Mom Enamel Pin featuring a white cloud design with cute cartoon kittens and paw prints - Stay at Home Cat Mom (QHXZ3441)
Enamel cat skeleton pin featuring 'THIS IS ALMOST ENOUGH CATS' text for cat lovers - Cat Skull (QHXZ3440)
Cartoon enamel pin featuring four white cats in colorful coffee cups with a floral tray - Cats and Coffee (QHXZ3439)
Catpuccino enamel pin featuring cute cartoon cats in a coffee cup design badge - Catpuccino (QHXZ3438)
+7
Artistic Cat Enamel Pins Set Van Gogh Picasso Inspired Skull Potion Cat Badges Cute Alloy Brooches For Clothing Backpack Cat Mom Jewelry Gift
-9%
$0.37-0.47
No MOQ
 · 
74 sold recently
Free Shipping
Pink Skeleton Alloy Brooch Gothic Heart Milk Box Ghostface Enamel Pin Badge For Clothing Backpack Decoration Jewelry Gift
Pink Skeleton Alloy Brooch Gothic Heart Milk Box Ghostface Enamel Pin Badge For Clothing Backpack Decoration Jewelry Gift
like
Find Similar
Enamel brooch featuring pink strawberry milk carton design with Fresh Boy Tears text - Strawberry Milk Carton Style (XZ6068)
Enamel pin featuring a skeletal hand holding a pink rose for fashion accessories - Skeleton Holding Rose Style (xz6069)
Pink Skeleton Alloy Brooch Gothic Heart Milk Box Ghostface Enamel Pin Badge For Clothing Backpack Decoration Jewelry Gift
-9%
$0.47
No MOQ
Free Shipping
Halloween Punk Dark Style Bowknot Brooch Zinc Alloy Baking Varnish Enamel Pins Skull Ghost Bat Spider Decoration Badge
Halloween Punk Dark Style Bowknot Brooch Zinc Alloy Baking Varnish Enamel Pins Skull Ghost Bat Spider Decoration Badge
like
Find Similar
Gothic punk bow brooch with purple and green checkerboard and spider web enamel - Purple Green Striped Spider Web Style (QHXZ4634)
Gothic black bow enamel pin with cute ghost patterns and white lace trim detail - Black Ghost Pattern Style (QHXZ4635)
Gothic punk enamel skull brooch with black bowknot and dark pattern details - Skull Top Hat Black Bowknot Style (QHXZ4637)
Halloween Punk Dark Style Bowknot Brooch Zinc Alloy Baking Varnish Enamel Pins Skull Ghost Bat Spider Decoration Badge
-9%
$0.39
No MOQ
Free Shipping
Halloween Ghost Pumpkin Alloy Enamel Brooch Pin Funny Boo Cartoon Badge Commemorative Medal For Costume Accessory Jewelry
Halloween Ghost Pumpkin Alloy Enamel Brooch Pin Funny Boo Cartoon Badge Commemorative Medal For Costume Accessory Jewelry
like
Find Similar
Cute Halloween enamel pin featuring a smiling orange pumpkin and white ghost design - Pumpkin Ghost Style (XZ6795)
Detail of cute white ghost enamel pin with orange Boo lettering for Halloween - Boo Ghost Style (XZ6794)
Close-up of cute ghost enamel pin holding a pumpkin basket and orange flower bouquet - Flower Pumpkin Ghost Style (XZ6793)
Cartoon white ghost enamel pin with orange horns holding a knife for Halloween accessory - Demon Knife Ghost Style (XZ6792)
+1
Halloween Ghost Pumpkin Alloy Enamel Brooch Pin Funny Boo Cartoon Badge Commemorative Medal For Costume Accessory Jewelry
-9%
$0.60
No MOQ
Free Shipping
Gothic Movie Character Enamel Pin Zinc Alloy Wednesday Shining Inspired Brooch Cartoon Figure Badge For Clothing Decor
Gothic Movie Character Enamel Pin Zinc Alloy Wednesday Shining Inspired Brooch Cartoon Figure Badge For Clothing Decor
like
Find Similar
Cartoon witch enamel brooch with umbrella and Salty Witch text on white background - Little Witch (Salty Witch) Style (QHXZ1128)
Gothic punk enamel pin featuring a dark girl with a bloody scythe badge accessory - Dark Girl with Scythe Style (QHXZ1131)
Gothic Movie Character Enamel Pin Zinc Alloy Wednesday Shining Inspired Brooch Cartoon Figure Badge For Clothing Decor
-9%
$0.55
No MOQ
 · 
19 sold recently
Fantasy Black Dragon Enamel Brooch Personalized Fourth Wing Metal Badge Cartoon Mythical Creature Pin For Clothing Backpack Decor Unisex Gift
Fantasy Black Dragon Enamel Brooch Personalized Fourth Wing Metal Badge Cartoon Mythical Creature Pin For Clothing Backpack Decor Unisex Gift
like
Find Similar
Vintage black and gold dragon brooch with round enamel details and mythical cloud pattern - Twin Dragons Pattern (QHXZ5544)
Fantasy Black Dragon Enamel Brooch Personalized Fourth Wing Metal Badge Cartoon Mythical Creature Pin For Clothing Backpack Decor Unisex Gift
-8%
$0.42
No MOQ
 · 
83 sold recently
Cute Halloween Cartoon Ghost Enamel Brooch Pin Set Alloy Painted Ghost With Knife Wizard Hat Flower Quote Fashion Badge For Clothing Bag
Cute Halloween Cartoon Ghost Enamel Brooch Pin Set Alloy Painted Ghost With Knife Wizard Hat Flower Quote Fashion Badge For Clothing Bag
like
Find Similar
Cute white ghost enamel pin holding a gray kitchen knife accessory for Halloween - Cute Ghost with Knife (XZ8969)
Ghost enamel pin with wizard hat and magic wand for Halloween accessory decorations - Wizard Hat Ghost with Wand (XZ8970)
Cute white ghost enamel pin with a pink flower detail and black metal outlines - Ghost Holding Pink Flower (XZ8971)
Cute white ghost enamel pin holding a phone with Mean Girls quote and pink ribbon - Ghost with Phone and Quote (XZ8973)
Cute Halloween Cartoon Ghost Enamel Brooch Pin Set Alloy Painted Ghost With Knife Wizard Hat Flower Quote Fashion Badge For Clothing Bag
-8%
$0.63
No MOQ
Free Shipping
Vintage Halloween Witch Wizard Hat Brooch Alloy Rhinestone Enamel Black Gold Star Pendant Pin For Men Women Party Jewelry Gift
Vintage Halloween Witch Wizard Hat Brooch Alloy Rhinestone Enamel Black Gold Star Pendant Pin For Men Women Party Jewelry Gift
like
Find Similar
Wizard hat brooch in black enamel with gold stars and rhinestones for Halloween - XZ20-006 Halloween Hat
NewVintage Halloween Witch Wizard Hat Brooch Alloy Rhinestone Enamel Black Gold Star Pendant Pin For Men Women Party Jewelry Gift
-8%
$1.26
Mix MOQ : 2
 · 
17 sold recently
Creepy Cute Enamel Pins Set Gothic Pastel Halloween Brooch Alloy Drip Oil Skull Strawberry Mushroom Pizza Badge For Men Women Bag Accessory
Creepy Cute Enamel Pins Set Gothic Pastel Halloween Brooch Alloy Drip Oil Skull Strawberry Mushroom Pizza Badge For Men Women Bag Accessory
like
Find Similar
Pink melting mushroom enamel pin with blue eye patterns on a purple cap, punk style - Xz6850
Pink cartoon pizza slice enamel pin with surreal eyeball design for Halloween - Multi-Eye Pizza Style (XZ6851)
Pastel pink snail skull enamel pin with butterfly wings in whimsical goth style - Xz6852
Pink brain and white skull punk enamel pin in zinc alloy with dripping oil finish - Brain-Exposed Skull Style (XZ6853)
+1
Creepy Cute Enamel Pins Set Gothic Pastel Halloween Brooch Alloy Drip Oil Skull Strawberry Mushroom Pizza Badge For Men Women Bag Accessory
-9%
$0.65
No MOQ
Free Shipping
Creative Cartoon Animal Skeleton Enamel Brooch Pin Alloy Gothic Cat Dog Rabbit Bird Shapes Halloween Party Gift Jewelry
Creative Cartoon Animal Skeleton Enamel Brooch Pin Alloy Gothic Cat Dog Rabbit Bird Shapes Halloween Party Gift Jewelry
like
Find Similar
Gothic black and white enamel pin featuring a detailed curled cat skeleton design - Curled Cat Skeleton (CC1042)
Gothic black and white enamel cat skeleton brooch pin with arched back design - Arched Back Cat Skeleton (CC1043)
Gothic black and white enamel cat skeleton brooch made of alloy and oil drip finish - Sitting Cat Skeleton (CC1044)
Stylized black cat skeleton enamel brooch pin with blue fish detail on white background - Cat Skeleton With Fish (CC1045)
+3
Creative Cartoon Animal Skeleton Enamel Brooch Pin Alloy Gothic Cat Dog Rabbit Bird Shapes Halloween Party Gift Jewelry
-10%
$0.52
No MOQ
Free Shipping
Funny Christmas Snowman Ghost Enamel Brooch Happy Holidays Badge Zinc Alloy Festive Pin For Clothing Hat Decoration Jewelry Gift
Funny Christmas Snowman Ghost Enamel Brooch Happy Holidays Badge Zinc Alloy Festive Pin For Clothing Hat Decoration Jewelry Gift
like
Find Similar
Grumpy snowman enamel pin with striped scarf and Happy Holidays text on white background - Grumpy Snowman Style (QHXZ5241)
Ghost enamel pin with Christmas hat and colorful holiday lights on white background - Christmas Ghost Style (QHXZ5242)
NewFunny Christmas Snowman Ghost Enamel Brooch Happy Holidays Badge Zinc Alloy Festive Pin For Clothing Hat Decoration Jewelry Gift
-8%
$0.42
No MOQ
Halloween Animal Social Party Skeleton Rabbit Frog Wolf Enamel Brooch Pin Set Creative Floral Anatomy Badges Jewelry
Halloween Animal Social Party Skeleton Rabbit Frog Wolf Enamel Brooch Pin Set Creative Floral Anatomy Badges Jewelry
like
Find Similar
Wolf and skull enamel brooch with pink floral accents and green leaves on white background - Wolf Skeleton Design (CC2111)
Artistic enamel brooch featuring a half-rabbit and half-skeleton design with floral accents - Rabbit Skeleton Design (CC2112)
Halloween frog enamel pin featuring a creative split design of a green frog and a skeleton - Frog Skeleton Design (CC2113)
Halloween Animal Social Party Skeleton Rabbit Frog Wolf Enamel Brooch Pin Set Creative Floral Anatomy Badges Jewelry
-8%
$0.79
No MOQ
Creative Cartoon Dog Enamel Pin Cute Puppy Alloy Brooch Badge For Backpack Clothing Decoration Unisex Pet Lover Jewelry Gift
Creative Cartoon Dog Enamel Pin Cute Puppy Alloy Brooch Badge For Backpack Clothing Decoration Unisex Pet Lover Jewelry Gift
like
Find Similar
Close-up of a cartoon Border Collie enamel pin with a cute winking expression - Winking Border Collie (QHXZ4437)
Cute cartoon enamel dog brooch featuring a white puppy biting a bone for backpacks - Samoyed with Bone (QHXZ4438)
Cute black and white cartoon dog enamel pin featuring a playful husky pup with a tongue out - Husky with Tongue Out (QHXZ4439)
Cute cartoon Golden Retriever enamel pin featuring a waving dog in vibrant yellow and pink - Waving Golden Retriever (QHXZ4440)
+1
Creative Cartoon Dog Enamel Pin Cute Puppy Alloy Brooch Badge For Backpack Clothing Decoration Unisex Pet Lover Jewelry Gift
-9%
$0.39
No MOQ
 · 
57 sold recently
Christmas Penguin Enamel Brooch Pin Alloy Reindeer Antlers Santa Hat Animal Badge For Sweater Lapel Holiday Gift Jewelry
Christmas Penguin Enamel Brooch Pin Alloy Reindeer Antlers Santa Hat Animal Badge For Sweater Lapel Holiday Gift Jewelry
like
Find Similar
Christmas penguin enamel brooch with red scarf and reindeer antlers in gold plating - Antlers Penguin
Cute enamel penguin brooch with red Christmas hat and scarf in a gold metal finish - Santa Hat Penguin
Christmas Penguin Enamel Brooch Pin Alloy Reindeer Antlers Santa Hat Animal Badge For Sweater Lapel Holiday Gift Jewelry
-9%
$0.39
No MOQ
Free Shipping
Punk 8-Ball Enamel Pins Zinc Alloy Skull Cherry Bikini Lady Skeleton Hand Metal Badge Brooch For Clothing Accessories
Punk 8-Ball Enamel Pins Zinc Alloy Skull Cherry Bikini Lady Skeleton Hand Metal Badge Brooch For Clothing Accessories
like
Find Similar
Bowling girl in red bikini on black number 8 ball enamel pin badge accessory - Retro Bikini Lady Style (QHXZ2122)
Custom cherry skull and black number 8 pool ball enamel pin with gold metal trim - Skull Cherry Style (QHXZ2123)
Creative black 8-ball cherry skull metal pin with enamel finish for clothing accessories - Double 8-Ball Cherry Style (QHXZ2124)
Punk style black 8-ball and skeleton hand enamel pin badge for clothing and bags - Skeleton Hand Holding 8-Ball (QHXZ2125)
Punk 8-Ball Enamel Pins Zinc Alloy Skull Cherry Bikini Lady Skeleton Hand Metal Badge Brooch For Clothing Accessories
-9%
$0.50
No MOQ
Free Shipping
Gothic Tarot Card The Witch Enamel Pin Mysterious Witch And Black Cat Zinc Alloy Brooch Halloween Jewelry Badge For Clothes
Gothic Tarot Card The Witch Enamel Pin Mysterious Witch And Black Cat Zinc Alloy Brooch Halloween Jewelry Badge For Clothes
like
Find Similar
Enamel tarot witch brooch with black cat and moon phases on polished metal pin - Witch Black Cat Tarot Style (QHXZ4561)
Gothic Tarot Card The Witch Enamel Pin Mysterious Witch And Black Cat Zinc Alloy Brooch Halloween Jewelry Badge For Clothes
-9%
$0.39
No MOQ
 · 
11 sold recently
Creative Cute Fruit Skull Enamel Pin Halloween Pumpkin Skeleton Brooch Funny Enamel Badge For Backpack Jacket Decoration Accessories
Creative Cute Fruit Skull Enamel Pin Halloween Pumpkin Skeleton Brooch Funny Enamel Badge For Backpack Jacket Decoration Accessories
like
Find Similar
Gothic enamel pin featuring a white skull with pink flowers on a purple square background - Purple Square Skull Floral (QHXZ4229)
Skeleton in shirt with pink cup enamel pin featuring Go Ahead Call HR slogan text - Workplace Humor Skull (QHXZ4308)
Gothic strawberry skull enamel pin with red fruit body and green leaves metal badge - Strawberry Skull (QHXZ4408)
Unique cherry skull enamel pin with red fruit and green leaves on silver metal - Cherry Skull (QHXZ4409)
+9
Creative Cute Fruit Skull Enamel Pin Halloween Pumpkin Skeleton Brooch Funny Enamel Badge For Backpack Jacket Decoration Accessories
-9%
$0.37-0.45
No MOQ
Cartoon Halloween Ghost Enamel Brooch Pins Set Pumpkin Skeleton Badge Spooky Cute Jewelry For Backpack Clothing Hat Accessories
Cartoon Halloween Ghost Enamel Brooch Pins Set Pumpkin Skeleton Badge Spooky Cute Jewelry For Backpack Clothing Hat Accessories
like
Find Similar
Cute white ghost enamel pin holding a gray kitchen knife accessory for Halloween - Ghost with Knife Style (XZ8969)
Ghost enamel pin with wizard hat and magic wand for Halloween accessory decorations - Ghost with Witch Hat Style (XZ8970)
Cute white ghost enamel pin holding a phone with Mean Girls quote and pink ribbon - Ghost with Phone Quote Style (XZ8973)
Cartoon Halloween Ghost Enamel Brooch Pins Set Pumpkin Skeleton Badge Spooky Cute Jewelry For Backpack Clothing Hat Accessories
-8%
$0.63
No MOQ
Free Shipping
Halloween Cartoon Ghost Pumpkin Enamel Pin Set Black Cat Wizard Hat Badge Zinc Alloy Brooch For Backpack Clothing Accessories
Halloween Cartoon Ghost Pumpkin Enamel Pin Set Black Cat Wizard Hat Badge Zinc Alloy Brooch For Backpack Clothing Accessories
like
Find Similar
Halloween enamel pin with cute ghost and black cat riding an orange pumpkin cart - Ghost Driving Pumpkin Car Style (QHXZ4898)
Halloween enamel pin with black cat, orange pumpkin and ghost in wizard hat - Ghost Black Cat Pumpkin Combo Style (QHXZ4899)
Halloween enamel pin with a black cat and ghost on an orange pumpkin lantern base - Sunglasses Ghost Pumpkin Soup Style (QHXZ4900)
Halloween enamel pin with white ghost in wizard hat, black cat and pumpkin characters - Ghost Sucking Pumpkin Black Cat Style (QHXZ4901)
Halloween Cartoon Ghost Pumpkin Enamel Pin Set Black Cat Wizard Hat Badge Zinc Alloy Brooch For Backpack Clothing Accessories
-9%
$0.39
No MOQ
Gothic Dark Romance Book Club Enamel Pin Skull Rose Flower Ticket Shape Brooch Halloween Badge For Men Women Clothing Jewelry
Gothic Dark Romance Book Club Enamel Pin Skull Rose Flower Ticket Shape Brooch Halloween Badge For Men Women Clothing Jewelry
like
Find Similar
Pink Dark Romance Book Club enamel pin with white skull and red roses design - Round Skull Rose Style (QHXZ5620)
Pink ticket enamel pin with Dark Romance Book Club lettering and skull motif - Pink Ticket Style (QHXZ5621)
Gothic Dark Romance Book Club Enamel Pin Skull Rose Flower Ticket Shape Brooch Halloween Badge For Men Women Clothing Jewelry
-8%
$0.42
No MOQ
 · 
50 sold recently
Free Shipping
Creative Cartoon Opossum Alloy Brooch Pin Humorous Letter Print Enamel Badge Metal Jewelry Accessory For Clothes Bags Backpacks
Creative Cartoon Opossum Alloy Brooch Pin Humorous Letter Print Enamel Badge Metal Jewelry Accessory For Clothes Bags Backpacks
like
Find Similar
Cute cartoon opossum enamel pin with pink wings and Trash Fairy text on white background - Trash Fairy Style (QHXZ4424)
Cute opossum enamel pin drinking boba tea with 'CUTE BUT FERAL' text on white background - Drinking Milk Tea Style (QHXZ4425)
Cartoon opossum enamel pin with Eat Trash Die Fast text on white background - Lying on Back Style (QHXZ4426)
Funny grey opossum enamel pin with humor text it is trash can not trash can't - Curled Up Style (QHXZ4427)
+8
Creative Cartoon Opossum Alloy Brooch Pin Humorous Letter Print Enamel Badge Metal Jewelry Accessory For Clothes Bags Backpacks
-10%
$0.52
No MOQ
 · 
47 sold recently
Funny Christmas Santa Claus Enamel Pins Alloy Brooch Badges For Backpack Clothes Dabbing Santa OK Sign Pins Jewelry Gifts
Funny Christmas Santa Claus Enamel Pins Alloy Brooch Badges For Backpack Clothes Dabbing Santa OK Sign Pins Jewelry Gifts
like
Find Similar
Christmas Santa Claus enamel pin featuring pink sunglasses and Merry Christmas text - Pink Sunglasses Santa Letter Style (QHXZ4984)
Cartoon Santa Claus brooch in a dabbing pose with colorful Christmas lights and sunglasses - Dab Santa With Lights (QHXZ4985)
Christmas enamel pin featuring Santa Claus with sunglasses and green gift boxes - Waving Santa With Gifts (QHXZ4986)
Funny Christmas Santa Claus Enamel Pins Alloy Brooch Badges For Backpack Clothes Dabbing Santa OK Sign Pins Jewelry Gifts
-9%
$0.47
No MOQ
Halloween Pumpkin Witch Hat Broom Brooch For Women Men Zinc Alloy Rhinestone Enamel Party Pin Festive Holiday Jewelry Gift
Halloween Pumpkin Witch Hat Broom Brooch For Women Men Zinc Alloy Rhinestone Enamel Party Pin Festive Holiday Jewelry Gift
like
Find Similar
Halloween witch pumpkin brooch with colorful enamel flowers and rhinestones on gold base - Pumpkin Witch Broom Style (C369-A)
Halloween Pumpkin Witch Hat Broom Brooch For Women Men Zinc Alloy Rhinestone Enamel Party Pin Festive Holiday Jewelry Gift
-13%
$1.52
Mix MOQ : 3
 · 
1 reviews
Creative Matchbox Skull Enamel Pin Dark Style Burning Match Badge Punk Zinc Alloy Brooch Clothing Backpack Accessories
Creative Matchbox Skull Enamel Pin Dark Style Burning Match Badge Punk Zinc Alloy Brooch Clothing Backpack Accessories
like
Find Similar
Dark style enamel matchbox pin with skull matches and 'See You In Hell' text - Matchbox Skull Style (QHXZ5190)
Gothic punk enamel pin featuring a burning match with a red skull flame design - Burning Match Skull Style (QHXZ5191)
Creative Matchbox Skull Enamel Pin Dark Style Burning Match Badge Punk Zinc Alloy Brooch Clothing Backpack Accessories
-9%
$0.39
No MOQ
 · 
52 sold recently
Gothic Butterfly Skull Enamel Pin Dark Punk Zinc Alloy Brooch Badge For Clothing Backpack Decoration Unisex Jewelry Accessories
Gothic Butterfly Skull Enamel Pin Dark Punk Zinc Alloy Brooch Badge For Clothing Backpack Decoration Unisex Jewelry Accessories
like
Find Similar
Gothic RAD skull hand enamel pin badge with black metal edging and cream bone detail - Rock Skeleton Hand (QHXZ4674)
Creative enamel skeleton torso brooch pin with black and beige ribs design for clothing - Torso X-Ray Frame (QHXZ4676)
Enamel skull brooch with coffee and phrase All of My Flabbers Are Gasted in black and white - Skull Coffee Cup (QHXZ5050)
Creative pink butterfly enamel pin with white skull design in gothic dark aesthetic style - Pink Spotted Butterfly Skull (QHXZ5094)
+10
Gothic Butterfly Skull Enamel Pin Dark Punk Zinc Alloy Brooch Badge For Clothing Backpack Decoration Unisex Jewelry Accessories
-9%
$0.37-0.42
No MOQ
Halloween Ghost Enamel Pin Set Cartoon Round Alloy Brooch Badge For Clothing Bag Decor Funny Spooky Jewelry For Women Men Gift
Halloween Ghost Enamel Pin Set Cartoon Round Alloy Brooch Badge For Clothing Bag Decor Funny Spooky Jewelry For Women Men Gift
like
Find Similar
Round black enamel pin with white cartoon ghosts and Squad Ghouls text design - SQUAD GHOULS Ghost Badge (QHXZ2328) / Black
Yellow enamel pin with ghosts and Live Laugh Haunt text in black circular frame - LIVE LAUGH HAUNT Ghost Badge (QHXZ2329) / Yellow
Round black enamel ghost badge with white text reading Get Your Sheet Together - GET YOUR SHEET TOGETHER Ghost Badge (QHXZ2330) / Black
Halloween Ghost Enamel Pin Set Cartoon Round Alloy Brooch Badge For Clothing Bag Decor Funny Spooky Jewelry For Women Men Gift
-8%
$0.45
No MOQ
Free Shipping
Halloween Cartoon Black Cat Enamel Brooch Pins Witch Hat Candy Star Alloy Badge For Holiday Party Decoration Accessories
Halloween Cartoon Black Cat Enamel Brooch Pins Witch Hat Candy Star Alloy Badge For Holiday Party Decoration Accessories
like
Find Similar
Cute Halloween black cat enamel pin with orange wizard hat and dangling star pendant - Cat Wearing Witch Hat (C2749-1)
Detailed view of Halloween cat enamel pin on orange candy with exact size and weight dimensions - Cat Sitting On Candy (C2749-2)
NewHalloween Cartoon Black Cat Enamel Brooch Pins Witch Hat Candy Star Alloy Badge For Holiday Party Decoration Accessories
-9%
$0.60
No MOQ
Free Shipping
Halloween Enamel Pins Magic Cat Potion Bottle Tombstone Gothic Witchcraft Badges Alloy Cartoon Witch Brooch Jewelry Gifts
Halloween Enamel Pins Magic Cat Potion Bottle Tombstone Gothic Witchcraft Badges Alloy Cartoon Witch Brooch Jewelry Gifts
like
Find Similar
Cute dream planet rabbit and cat enamel pin badge with purple star ring design - Dreamy Planet Rabbit (XZ8842)
Enamel black cat with purple wizard hat and skull brooch pin for accessories - Witch Hat Black Cat with Skull (xz8470)
Cute black enamel magic cat on broom brooch with gold stars and metallic finish - Black Cat Riding Broomstick (XZ8471)
Enamel brooch with magic potion bottle design featuring a black cat and purple crystal - Magic Potion Bottle Cat (xz8472)
+12
Halloween Enamel Pins Magic Cat Potion Bottle Tombstone Gothic Witchcraft Badges Alloy Cartoon Witch Brooch Jewelry Gifts
-9%
$0.47-0.71
No MOQ
 · 
10 views
Free Shipping
Cartoon Cryptid Mystery Creature Alloy Painted Enamel Pin Badge Aliens Bigfoot Nessie Jersey Devil Jackalope Badge Jewelry
Cartoon Cryptid Mystery Creature Alloy Painted Enamel Pin Badge Aliens Bigfoot Nessie Jersey Devil Jackalope Badge Jewelry
like
Find Similar
Cute golden and white enamel jackalope pin badge with "Believes in You" text - Jackalope Style (xz9591)
Cartoon Bigfoot enamel pin with BELIEVES IN YOU banner and black pine tree - Bigfoot Style (xz9592)
Green Nessie dinosaur enamel pin with 'Nessie Believes In You' text on white background - Nessie Style (xz9593)
Cartoon Cryptid Mystery Creature Alloy Painted Enamel Pin Badge Aliens Bigfoot Nessie Jersey Devil Jackalope Badge Jewelry
-8%
$0.84
No MOQ
 · 
21 sold recently
Japanese Cartoon Killing Cute Skull Enamel Pin Badge Alloy Round Brooch Heart Eyes Star Pink Bow For Bags Clothes Jewelry
Japanese Cartoon Killing Cute Skull Enamel Pin Badge Alloy Round Brooch Heart Eyes Star Pink Bow For Bags Clothes Jewelry
like
Find Similar
Killing Cute skull enamel pin badge with pink bow and star detail for bags - C2952
Japanese Cartoon Killing Cute Skull Enamel Pin Badge Alloy Round Brooch Heart Eyes Star Pink Bow For Bags Clothes Jewelry
-9%
$0.47
No MOQ
Halloween Pumpkin Witch Hat Brooch Alloy Enamel Rhinestone Pin For Women Men Festive Party Jewelry Accessory
Halloween Pumpkin Witch Hat Brooch Alloy Enamel Rhinestone Pin For Women Men Festive Party Jewelry Accessory
like
Find Similar
Vintage Halloween pumpkin ghost witch brooch with colorful enamel and sparkling rhinestones - Halloween Pumpkin Witch Hat (C346-A)
Halloween Pumpkin Witch Hat Brooch Alloy Enamel Rhinestone Pin For Women Men Festive Party Jewelry Accessory
-13%
$1.12
Mix MOQ : 3
 · 
12 sold recently
Free Shipping
Gothic Skull Butterfly Enamel Brooch Pin Set Zinc Alloy Lacquered Badge For Clothes Backpack Accessories Unisex Jewelry Gift
Gothic Skull Butterfly Enamel Brooch Pin Set Zinc Alloy Lacquered Badge For Clothes Backpack Accessories Unisex Jewelry Gift
like
Find Similar
Creative pink butterfly enamel pin with white skull design in gothic dark aesthetic style - Skull and Pink Butterfly (QHXZ5094)
Gothic butterfly enamel pin featuring an orange monarch wing and a skull design - Skull and Orange Butterfly (QHXZ5095)
Creative enamel pin featuring a white skull adorned with vibrant blue butterflies - Skull and Blue Butterfly (QHXZ5096)
Gothic Skull Butterfly Enamel Brooch Pin Set Zinc Alloy Lacquered Badge For Clothes Backpack Accessories Unisex Jewelry Gift
-8%
$0.45
No MOQ
Free Shipping
Stainless Steel Cartoon Cute Animal Brooch Pin 18K Gold Plated Enamel Owl Cat Snowman Niche Design Fashion Jewelry Gift
Stainless Steel Cartoon Cute Animal Brooch Pin 18K Gold Plated Enamel Owl Cat Snowman Niche Design Fashion Jewelry Gift
like
Find Similar
Detailed view of 18k gold owl brooch with pearls, measuring 4.2cm by 3.4cm and 23.3g - Owl Style (OLBXZ004)
Detail view of snowman skiing brooch with 18k gold plating and dimensions 3.8cm by 2.9cm - Skiing Snowman Style (OLBXZ006)
Detailed view of 18k gold plated owl brooch with white enamel and green gemstone eyes - Cute Cat Style (OLBXZ007)
Stainless Steel Cartoon Cute Animal Brooch Pin 18K Gold Plated Enamel Owl Cat Snowman Niche Design Fashion Jewelry Gift
-5%
$2.69-3.96
No MOQ
Free Shipping
Gothic Punk Black Glitter Lips Brooch With White Teeth Red Blood Drip Creative Alloy Enamel Pin For Clothing Bags Jewelry
Gothic Punk Black Glitter Lips Brooch With White Teeth Red Blood Drip Creative Alloy Enamel Pin For Clothing Bags Jewelry
like
Find Similar
Creative black glitter lips brooch with white teeth and dripping red enamel detail - Black Lips Blood Drip Style (CC819)
Gothic Punk Black Glitter Lips Brooch With White Teeth Red Blood Drip Creative Alloy Enamel Pin For Clothing Bags Jewelry
-7%
$0.58
No MOQ
 · 
24 sold recently
Witch Tarot Card Enamel Brooch Zinc Alloy Black Cat Moon Phase Badge Cartoon Mystery Style Clothing Accessory For Women Men
Witch Tarot Card Enamel Brooch Zinc Alloy Black Cat Moon Phase Badge Cartoon Mystery Style Clothing Accessory For Women Men
like
Find Similar
Enamel tarot witch brooch with black cat and moon phases on polished metal pin - Witch Cat Tarot Card Style (QHXZ4561)
Witch Tarot Card Enamel Brooch Zinc Alloy Black Cat Moon Phase Badge Cartoon Mystery Style Clothing Accessory For Women Men
-9%
$0.39
No MOQ
 · 
13 views
Celestial Moth Butterfly Enamel Pin Alloy Moon Phase Star Brooch Vintage Mysterious Gothic Jewelry Clothing Accessories Women Men Pins
Celestial Moth Butterfly Enamel Pin Alloy Moon Phase Star Brooch Vintage Mysterious Gothic Jewelry Clothing Accessories Women Men Pins
like
Find Similar
Celestial butterfly enamel pin with moon and star patterns over purple triangle - Black Butterfly Purple Triangle (XZ3416)
Cartoon moon moth enamel pin with gold trim and starry butterfly wings in black and white - Black White Moon Moth (XZ3417)
Pink and white enamel butterfly brooch with gold metallic edges for denim bags - White Moth Pink Diamond (XZ3418)
Celestial Moth Butterfly Enamel Pin Alloy Moon Phase Star Brooch Vintage Mysterious Gothic Jewelry Clothing Accessories Women Men Pins
-8%
$0.42
No MOQ
Gothic Punk Skeleton Rose Enamel Brooch Zinc Alloy Heart Rock Gesture Pins For Halloween Costume Backpack Jewelry Gift
Gothic Punk Skeleton Rose Enamel Brooch Zinc Alloy Heart Rock Gesture Pins For Halloween Costume Backpack Jewelry Gift
like
Find Similar
Punk enamel pin featuring a white skeleton hand holding a red rose in a rock gesture - Rock Gesture Skeleton Rose Style (CC1782)
Punk enamel skeleton hands heart gesture badge pin with red love text detail - Skeleton Heart Hands Style (CC1783)
Punk enamel pin showing a white skeleton hand holding a red rose flower badge - Skeleton Hand Holding Rose Style (CC1785)
Punk enamel pin featuring a half-face skull with red roses and green drip details - Half Face Skeleton Rose Style (CC1786)
Gothic Punk Skeleton Rose Enamel Brooch Zinc Alloy Heart Rock Gesture Pins For Halloween Costume Backpack Jewelry Gift
-7%
$0.58
No MOQ
Free Shipping
Vintage Alloy Enamel Moth Butterfly Bee Brooch Pins Colorful Insect Badges For Women Men Clothes Bag Decoration Jewelry Gift Accessory
Vintage Alloy Enamel Moth Butterfly Bee Brooch Pins Colorful Insect Badges For Women Men Clothes Bag Decoration Jewelry Gift Accessory
like
Find Similar
Cartoon moth enamel brooch with yellow ginkgo leaf pattern and golden outline - Moth Style (DB001-A)
Cute bee enamel pin with gold metal outlines and yellow black stripes for clothing - Bee Style (DB002-A)
Exquisite orange and black enamel butterfly brooch with golden plating finish - Db003-a
Cartoon moth enamel brooch in black and white with gold metal base and floral wing patterns - Moth Style (DB004-A)
+5
Vintage Alloy Enamel Moth Butterfly Bee Brooch Pins Colorful Insect Badges For Women Men Clothes Bag Decoration Jewelry Gift Accessory
-13%
$0.62
Mix MOQ : 3
Free Shipping
Funny Cartoon Animal Enamel Pin Badge Zinc Alloy Pun Brooch For Backpacks Clothing Accessories Jewelry Gift For Women Men Kids
Funny Cartoon Animal Enamel Pin Badge Zinc Alloy Pun Brooch For Backpacks Clothing Accessories Jewelry Gift For Women Men Kids
like
Find Similar
Cute cartoon turtle enamel pin with sunglasses and "TURTLEY COOL, DUDE" banner - Turtle With Sunglasses Style (QHXZ865)
Cartoon orange toad enamel pin badge with Toad You So banner on white background - Orange Toad Style (QHXZ866)
Cartoon Corgi hot dog enamel pin with red flames on a clean white background - Fire Corgi Style (QHXZ868)
Cute cartoon enamel otter pin holding a red heart with Be Kind To Otters text - Otter With Heart Style (QHXZ869)
+4
Funny Cartoon Animal Enamel Pin Badge Zinc Alloy Pun Brooch For Backpacks Clothing Accessories Jewelry Gift For Women Men Kids
-9%
$0.47
No MOQ
 · 
72 sold recently
Free Shipping
Halloween Enamel Ghost Brooches Cartoon Pumpkin Cat Dog Wizard Hat Lapel Pins For Clothing Bags Decoration Gift Jewelry
Halloween Enamel Ghost Brooches Cartoon Pumpkin Cat Dog Wizard Hat Lapel Pins For Clothing Bags Decoration Gift Jewelry
like
Find Similar
Detail of cute black and white enamel cat ghost brooch pin with cartoon halloween design - Ghost Cat Style (XZ5272)
Macro detail of Halloween ghost enamel pin with black and orange accent colors - Ghost with Pumpkin Style (XZ5273)
Macro detail of enamel Halloween badge featuring a pug dog wearing a white ghost sheet costume - Ghost Dog Style (XZ5275)
Halloween Enamel Ghost Brooches Cartoon Pumpkin Cat Dog Wizard Hat Lapel Pins For Clothing Bags Decoration Gift Jewelry
-9%
$0.47
No MOQ
Free Shipping
Gothic Halloween Enamel Pins Bowknot Brooch Cartoon Skull Ghost Bat Spider Alloy Badge For Clothes Bag Decoration Party Jewelry Accessory
Gothic Halloween Enamel Pins Bowknot Brooch Cartoon Skull Ghost Bat Spider Alloy Badge For Clothes Bag Decoration Party Jewelry Accessory
like
Find Similar
Gothic punk bow brooch with purple and green checkerboard and spider web enamel - Qhxz4634
Gothic black bow enamel pin with cute ghost patterns and white lace trim detail - Black Ghost Pattern Style (QHXZ4635)
Gothic punk enamel skull brooch with black bowknot and dark pattern details - Black Top Hat Skull Style (QHXZ4637)
Gothic Halloween Enamel Pins Bowknot Brooch Cartoon Skull Ghost Bat Spider Alloy Badge For Clothes Bag Decoration Party Jewelry Accessory
-8%
$0.42
No MOQ
Free Shipping
Go to

More in accessories

Explore more in angel pins

alloyartificial pearlheartgirlstylepartyshapedecorativedesigngold plated rhinestone
goldsuitinlaideyewhitemetalkidsplated rhinestonestarsphone

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access