Everful

Wholesale angel pins

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Angel Pins

Find the perfect pieces: alloy brooches, fashion brooches, crystal brooches and more

Popular collections in angel pins

All products in angel pins

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Retro Alloy Angel Heart Enamel Brooch Pin For Valentine's Day Wedding Party Unisex Wings Cupid Red Heart Lapel Pin Accessory
Retro Alloy Angel Heart Enamel Brooch Pin For Valentine's Day Wedding Party Unisex Wings Cupid Red Heart Lapel Pin Accessory
like
Find Similar
Vintage gold angel heart brooch with red enamel wings including dimension details - Antique Gold
Close-up showing dimensions of vintage cupid angel heart brooch in silver alloy - Antique Silver
Retro Alloy Angel Heart Enamel Brooch Pin For Valentine's Day Wedding Party Unisex Wings Cupid Red Heart Lapel Pin Accessory
-9%
$1.31
No MOQ
Free Shipping
Creative Cartoon Angel Wings Alloy Enamel Brooch Pin Minimalist White Gold Plated Badge For Clothes Backpack Hat Unisex Jewelry Gift
Creative Cartoon Angel Wings Alloy Enamel Brooch Pin Minimalist White Gold Plated Badge For Clothes Backpack Hat Unisex Jewelry Gift
like
Find Similar
Detail view of white enamel angel wing pins with golden edges and spiral patterns - Angel Wings Style (WY2190)
Creative Cartoon Angel Wings Alloy Enamel Brooch Pin Minimalist White Gold Plated Badge For Clothes Backpack Hat Unisex Jewelry Gift
-10%
$0.52
Mix MOQ : 2
Free Shipping
Vintage Alloy Caduceus Brooch Pin Medical Symbol Double Snake Staff With Angel Wings Enamel Suit Lapel Pin Jewelry Gift
Vintage Alloy Caduceus Brooch Pin Medical Symbol Double Snake Staff With Angel Wings Enamel Suit Lapel Pin Jewelry Gift
like
Find Similar
Vintage gold Caduceus brooch with white enamel wings medical emblem for suits - Angel Wings Staff Style (C449-A)
Vintage Alloy Caduceus Brooch Pin Medical Symbol Double Snake Staff With Angel Wings Enamel Suit Lapel Pin Jewelry Gift
-13%
$0.70
Mix MOQ : 3
Free Shipping
Vintage Gold Angel Wings Brooch For Women Men Elegant Rhinestone Inlaid Alloy Wing Lapel Pin Fashion Jewelry Accessory Gift
Vintage Gold Angel Wings Brooch For Women Men Elegant Rhinestone Inlaid Alloy Wing Lapel Pin Fashion Jewelry Accessory Gift
like
Find Similar
Vintage gold angel wing brooch with sparkling white rhinestones for elegant suits - Angel Wings Style (FG012-A)
Vintage Gold Angel Wings Brooch For Women Men Elegant Rhinestone Inlaid Alloy Wing Lapel Pin Fashion Jewelry Accessory Gift
-13%
$1.37
Mix MOQ : 3
Elegant Angel Letter Tassel Brooch For Women Gold Plated Copper Micro Inlaid Zirconia Heart Pin Accessory For Banquet Party
Elegant Angel Letter Tassel Brooch For Women Gold Plated Copper Micro Inlaid Zirconia Heart Pin Accessory For Banquet Party
like
Find Similar
Elegant gold Angel brooch with pavé zircon stones and dangling chain tassel detail - Gold
Elegant Angel Letter Tassel Brooch For Women Gold Plated Copper Micro Inlaid Zirconia Heart Pin Accessory For Banquet Party
-13%
$4.39
Mix MOQ : 3
Free Shipping
Vintage Angel Girl Brooch Alloy Enamel Drip Glaze Mosaic Wings Pin Fashion Light Luxury Jewelry For Women Men Coat Accessory
Vintage Angel Girl Brooch Alloy Enamel Drip Glaze Mosaic Wings Pin Fashion Light Luxury Jewelry For Women Men Coat Accessory
like
Find Similar
Detailed view of enamel angel brooch with dimensions 6.9cm height and 5.4cm width - Multicolored (KC Gold)
Colorful enamel angel girl brooch with gold trim on white background for fashion accessories - Pink (KC Gold)
Vintage Angel Girl Brooch Alloy Enamel Drip Glaze Mosaic Wings Pin Fashion Light Luxury Jewelry For Women Men Coat Accessory
-9%
$1.96
No MOQ
Free Shipping
Creative Cartoon Dice Angel Devil Round Enamel Brooch Pin With Slogan Alloy Badge Jewelry For Backpack Clothing Accessories
Creative Cartoon Dice Angel Devil Round Enamel Brooch Pin With Slogan Alloy Badge Jewelry For Backpack Clothing Accessories
like
Find Similar
Enamel pin with winged dice and red devil featuring Devils Roll The Dice quote - Creative Dice Devil Style (QHXZ3116)
Creative Cartoon Dice Angel Devil Round Enamel Brooch Pin With Slogan Alloy Badge Jewelry For Backpack Clothing Accessories
-8%
$0.45
No MOQ
Creative Angel On Car Metal Enamel Brooch Pin Vintage KAZ 2Y5 Badge For Clothing Bag Accessories Women Men Jewelry Gift
Creative Angel On Car Metal Enamel Brooch Pin Vintage KAZ 2Y5 Badge For Clothing Bag Accessories Women Men Jewelry Gift
like
Find Similar
Vintage gold car enamel pin with angel figure and KAZ 2Y5 license plate badge - Angel Sitting on Car Roof Style (QHXZ4447)
NewCreative Angel On Car Metal Enamel Brooch Pin Vintage KAZ 2Y5 Badge For Clothing Bag Accessories Women Men Jewelry Gift
-9%
$0.65
No MOQ
Elegant Angel Wings Heart Crown Brooch Pin Alloy Artificial Cat Eye Stone Rhinestone Breastpin Jewelry For Women Gift
Elegant Angel Wings Heart Crown Brooch Pin Alloy Artificial Cat Eye Stone Rhinestone Breastpin Jewelry For Women Gift
like
Find Similar
Elegant gold angel wing brooch with cream opal heart and crown on velvet background - Angel Wings Heart Crown (X0543) / Gold
Elegant Angel Wings Heart Crown Brooch Pin Alloy Artificial Cat Eye Stone Rhinestone Breastpin Jewelry For Women Gift
-8%
$0.34
No MOQ
Funny Alloy Enamel Fried Egg Red Bubble Brooch Double Chain Lapel Pin For Women Teens Creative Food Design Jewelry
Funny Alloy Enamel Fried Egg Red Bubble Brooch Double Chain Lapel Pin For Women Teens Creative Food Design Jewelry
like
Find Similar
Cartoon fried egg chain brooch with red Eat Me dialog box and golden finish - Fried Egg and Red Dialog Bubble Style (CC1341)
Funny Alloy Enamel Fried Egg Red Bubble Brooch Double Chain Lapel Pin For Women Teens Creative Food Design Jewelry
-9%
$0.50
No MOQ
 · 
14 views
Free Shipping
Fashion Elegant Alloy Fairy Elf Brooch For Women Sparkling Rhinestone Angel Pin For Wedding Party Commute Jewelry Gift
Fashion Elegant Alloy Fairy Elf Brooch For Women Sparkling Rhinestone Angel Pin For Wedding Party Commute Jewelry Gift
like
Find Similar
Sparkling gold fairy brooch pin with white zircons for women, 5.5cm elegant angel wing jewelry - Gold (2839)
Elegant silver fairy brooch with white crystals and colorful zircon wings - Silver (2839)
Fashion Elegant Alloy Fairy Elf Brooch For Women Sparkling Rhinestone Angel Pin For Wedding Party Commute Jewelry Gift
-9%
$1.83
No MOQ
Free Shipping
Funny Enamel Pins Cartoon Humorous Quotes Animal Brooches Zinc Alloy Badges For Clothing Backpack Decoration Unisex Gift
Funny Enamel Pins Cartoon Humorous Quotes Animal Brooches Zinc Alloy Badges For Clothing Backpack Decoration Unisex Gift
like
Find Similar
Cartoon white French Bulldog enamel pin with red heart pattern and black metal outline - French Bulldog Style (QHXZ3525)
Chemical element periodic table WTF enamel pin badge with The Element of Surprise slogan - Periodic Table WTF (QHXZ3528)
Pink enamel laptop brooch with Document It Or It Didn't Happen quote on grey screen - Pink Laptop (QHXZ3530)
Funny cartoon toast enamel pin with funny quote gluten free minimalist brooch for women - Cartoon Toast (QHXZ3533)
+8
Funny Enamel Pins Cartoon Humorous Quotes Animal Brooches Zinc Alloy Badges For Clothing Backpack Decoration Unisex Gift
-9%
$0.37-0.47
No MOQ
 · 
24 sold recently
Free Shipping
Funny Witty Quote Enamel Pin Alloy Brooch Personalized Punk Skull Witchcraft Slogan Badge Jewelry For Clothing Backpack Decor
Funny Witty Quote Enamel Pin Alloy Brooch Personalized Punk Skull Witchcraft Slogan Badge Jewelry For Clothing Backpack Decor
like
Find Similar
Yellow enamel musical ticket brooch with I love Musicals text and 24601 numbering - Musical Ticket Style (QHXZ5043)
Creative rectangular pink enamel brooch featuring bold black oh FFS lettering design - Pink oh FFS Square (QHXZ5044)
Inspirational enamel brooch with 'dont trade your AUTHENTICITY FOR APPROVAL' quote - Authenticity Irregular Style (QHXZ5045)
Minimalist enamel pin featuring ironic quote It's A Beautiful Day To Leave Me Alone - Leave Me Alone Rectangular Stack (QHXZ5047)
+12
Funny Witty Quote Enamel Pin Alloy Brooch Personalized Punk Skull Witchcraft Slogan Badge Jewelry For Clothing Backpack Decor
-9%
$0.39
No MOQ
 · 
50 sold recently
Elegant Gold Alloy Heart Letter Brooch With Cupid Angel Rhinestone Inlaid Personalized Suit Lapel Pin Jewelry Accessories
Elegant Gold Alloy Heart Letter Brooch With Cupid Angel Rhinestone Inlaid Personalized Suit Lapel Pin Jewelry Accessories
like
Find Similar
Elegant gold Heart brooch with Cupid design and sparkling crystals for suits - Gold
Elegant Gold Alloy Heart Letter Brooch With Cupid Angel Rhinestone Inlaid Personalized Suit Lapel Pin Jewelry Accessories
-9%
$0.60
No MOQ
Halloween Ghost Black Cat Enamel Pin Alloy Brooch Set Funny Text Ghost Badge For Clothing Backpack Decor Creative Cartoon Pins Gift
Halloween Ghost Black Cat Enamel Pin Alloy Brooch Set Funny Text Ghost Badge For Clothing Backpack Decor Creative Cartoon Pins Gift
like
Find Similar
Detail of a Halloween enamel pin featuring a white ghost and a black cat with yellow eyes - Ghost Black Cat (QHXZ463)
Cartoon Halloween enamel pin featuring a white ghost and a black cat with yellow eyes - Sheet Ghost Black Cat (QHXZ464)
Halloween enamel pin featuring a white ghost hugging a black cat with a yellow eye - Ghost Hugging Cat (QHXZ465)
Creative Halloween enamel pin featuring a cute white ghost and a small black cat motif - Cute Ghost Black Cat (QHXZ466)
+10
NewHalloween Ghost Black Cat Enamel Pin Alloy Brooch Set Funny Text Ghost Badge For Clothing Backpack Decor Creative Cartoon Pins Gift
-9%
$0.45-0.47
No MOQ
 · 
295 sold recently
Free Shipping
Vintage Angel Cupid Brooch Antique Style Alloy Retro Clothing Pin Fashion Jewelry For Men Women
Vintage Angel Cupid Brooch Antique Style Alloy Retro Clothing Pin Fashion Jewelry For Men Women
like
Find Similar
Silver vintage reading angel brooch pin with 2.5cm size and 6.6g weight details - Antique Silver
Vintage Angel Cupid Brooch Antique Style Alloy Retro Clothing Pin Fashion Jewelry For Men Women
-9%
$1.18
No MOQ
Free Shipping
Y2K Trendy Colorful Heart Enamel Brooch Pin For Women Men Alloy Drip Oil Concentric Heart Badge For Clothing Backpack Jewelry
Y2K Trendy Colorful Heart Enamel Brooch Pin For Women Men Alloy Drip Oil Concentric Heart Badge For Clothing Backpack Jewelry
like
Find Similar
Rainbow heart enamel brooch with pink and red concentric layers and golden metal trim - Pink Red Gradient Style (XZ5369)
Y2K style heart brooch with green gradient enamel layers and golden metallic border - Gradient Green Style (XZ5370)
Vintage heart shaped enamel brooch with colorful nested layers and golden frame - Orange Yellow Gradient Style (XZ5547)
Y2K blue gradient heart enamel pin with rose gold metal edges for bags and clothing - Gradient Blue Style (XZ5550)
+1
Y2K Trendy Colorful Heart Enamel Brooch Pin For Women Men Alloy Drip Oil Concentric Heart Badge For Clothing Backpack Jewelry
-8%
$0.42
No MOQ
 · 
350 sold recently
Dark Gothic Vintage Frame Brooches Alloy Enamel Skeleton Cat Silhouettes Pin Badges Halloween Party Costume Jewelry Gift
Dark Gothic Vintage Frame Brooches Alloy Enamel Skeleton Cat Silhouettes Pin Badges Halloween Party Costume Jewelry Gift
like
Find Similar
Gothic punk enamel pin featuring a female skull silhouette with Victorian ornate frame - Lady Skeleton Silhouette Style (QHXZ5009)
Gothic Victorian oval brooch with skull silhouette and spider web in black and white enamel - Gentleman Skeleton Silhouette Style (QHXZ5010)
Gothic black cat skull enamel pin with vintage ornate frame and spider web design - Skeleton Cat Silhouette Style (QHXZ5011)
Dark Gothic Vintage Frame Brooches Alloy Enamel Skeleton Cat Silhouettes Pin Badges Halloween Party Costume Jewelry Gift
-9%
$0.39
No MOQ
 · 
193 sold recently
Top 10% Best Sellers
in Brooches
Vintage Alloy Rhinestone Enamel Animal Brooch Pin Personalized Cat Horse Dog Shape Decorative Badge Jewelry For Unisex Women Men
Vintage Alloy Rhinestone Enamel Animal Brooch Pin Personalized Cat Horse Dog Shape Decorative Badge Jewelry For Unisex Women Men
like
Find Similar
Golden cat brooch with rhinestone collar, size 4.2cm by 2.7cm and weight 7.1g - Gold Standing Cat (C2731-10-GO)
Silver alloy double cat brooch with colorful rhinestones for coats and jackets - Silver Standing Cat (C2731-10-SI)
Golden cat brooch with butterfly accent and black eyes showing dimensions and weight - Gold Cat with Butterfly (C2731-15-GO)
Charming silver cat and butterfly brooch with intricate metal fur texture and black gem eyes - C2731-15-si
+14
Vintage Alloy Rhinestone Enamel Animal Brooch Pin Personalized Cat Horse Dog Shape Decorative Badge Jewelry For Unisex Women Men
-10%
$0.39-1.23
No MOQ
 · 
77 sold recently
Free Shipping
Zinc Alloy Religious Christian Quote Enamel Brooches Child Of God Holy Spirit Blessed Letter Badges For Clothes Decor
Zinc Alloy Religious Christian Quote Enamel Brooches Child Of God Holy Spirit Blessed Letter Badges For Clothes Decor
like
Find Similar
Hello My Name Is Child of God red and white enamel lapel pin badge accessory - Child of God Red White Tag Style (QHXZ3095)
Enamel pin with May the Holy Spirit Be with You text and winged cross in black and gold - Holy Spirit Star Wars Style Black Gold Style (QHXZ3096)
Pink Ichthys fish enamel pin with 'With God All Things Are Possible' religious quote - With God All Things Are Possible Fish Pink Style (QHXZ3097)
Rectangular black enamel pin with white I RIDE WITH JESUS lettering for clothing - I Ride With Jesus Rectangle Black White Style (QHXZ3098)
+1
Zinc Alloy Religious Christian Quote Enamel Brooches Child Of God Holy Spirit Blessed Letter Badges For Clothes Decor
-8%
$0.45
Mix MOQ : 2
 · 
34 sold recently
Free Shipping
Fashion Alloy Angel Brooch For Women Shiny Rhinestone Inlaid Angel Pin For Suit Cardigan Dress Decoration Jewelry Gift
Fashion Alloy Angel Brooch For Women Shiny Rhinestone Inlaid Angel Pin For Suit Cardigan Dress Decoration Jewelry Gift
like
Find Similar
Elegant gold angel brooch with sparkling crystal wings for women, size 3.5cm x 4.6cm - Gold
Macro detail of angel brooch with dimensions showing silver alloy and rhinestones - Silver
Fashion Alloy Angel Brooch For Women Shiny Rhinestone Inlaid Angel Pin For Suit Cardigan Dress Decoration Jewelry Gift
-9%
$1.70
Mix MOQ : 3
Free Shipping
Gothic Crow Raven Enamel Pins Skull Witch Hat Coffin Dagger Heart Brooches Dark Halloween Alloy Jewelry Badge Gift For Women Men
Gothic Crow Raven Enamel Pins Skull Witch Hat Coffin Dagger Heart Brooches Dark Halloween Alloy Jewelry Badge Gift For Women Men
like
Find Similar
Enamel crow pin with No Mourners No Funerals text in purple and black finish - Qhxz1352
Purple wizard hat crow enamel pin with white ghosts inside a potion bottle charm - Qhxz1466
Cartoon black raven crow on a knife enamel pin badge with golden plating and black finish - Qhxz1467
Dark gothic crow pin badge with wizard hat and golden crescent moon for Halloween - Qhxz1468
+1
Gothic Crow Raven Enamel Pins Skull Witch Hat Coffin Dagger Heart Brooches Dark Halloween Alloy Jewelry Badge Gift For Women Men
-9%
$0.45-0.50
No MOQ
 · 
20 sold recently
Cartoon Funny Enamel Pins Metal Badge Alloy Brooch For Backpack Clothing Hats Accessories Quotes Animals Gift Women Men
Cartoon Funny Enamel Pins Metal Badge Alloy Brooch For Backpack Clothing Hats Accessories Quotes Animals Gift Women Men
like
Find Similar
Cute black nurse enamel brooch with heart gesture and blue medical mask for doctors - Nurse Image (QHXZ3873)
Cartoon cow-patterned duck enamel pin featuring a pink cowboy hat and boots - Cowboy Duck (QHXZ3874)
Classic red sweater enamel pin with Love Your Neighbor slogan for vintage fashion lovers - Red Sweater (QHXZ3911)
Blue water element enamel comet pin badge with silver metal edge for game fans - Purple Comet (QHXZ3917)
+5
Cartoon Funny Enamel Pins Metal Badge Alloy Brooch For Backpack Clothing Hats Accessories Quotes Animals Gift Women Men
-9%
$0.37-0.50
No MOQ
 · 
48 sold recently
Free Shipping
Zinc Alloy Enamel Brooch Mystical Purple Moon Moth Tarot Card Planchette Pins Gothic Jewelry Badge Gift For Clothes Bags
Zinc Alloy Enamel Brooch Mystical Purple Moon Moth Tarot Card Planchette Pins Gothic Jewelry Badge Gift For Clothes Bags
like
Find Similar
Detailed view of enamel crescent moon brooch with purple mushrooms and crystal motifs - Moon Mushroom Crystal Style (XZ9215)
Purple tarot card enamel pin with golden moon and sun patterns on white background - Tarot Cards Style (XZ9216)
Purple planchette enamel pin featuring mystical moon, sun, and eye occult symbols - Planchette All Seeing Eye Style (XZ9217)
Dark purple moth enamel pin featuring moon and star patterns for Halloween gothic style - Moth Moon Star Style (XZ9218)
+1
Zinc Alloy Enamel Brooch Mystical Purple Moon Moth Tarot Card Planchette Pins Gothic Jewelry Badge Gift For Clothes Bags
-8%
$0.63
No MOQ
 · 
67 sold recently
Gothic Halloween Enamel Pins Cute Bow Skull Bat Coffin Tombstone Brooches Day Of The Dead Badge Pins For Bag Clothes Accessories
Gothic Halloween Enamel Pins Cute Bow Skull Bat Coffin Tombstone Brooches Day Of The Dead Badge Pins For Bag Clothes Accessories
like
Find Similar
Round enamel skull brooch with pink heart sunglasses and motivational Free Hugs text - Heart Sunglasses Skull (QHXZ4399)
Gothic punk bow brooch with purple and green checkerboard and spider web enamel - Plaid Spiderweb Bow (QHXZ4634)
Gothic black bow enamel pin with cute ghost patterns and white lace trim detail - Black Ghost Pattern Bowknot(QHXZ4635)
Gothic punk enamel skull brooch with black bowknot and dark pattern details - Top Hat Skeleton Bowknot(QHXZ4637)
+13
Gothic Halloween Enamel Pins Cute Bow Skull Bat Coffin Tombstone Brooches Day Of The Dead Badge Pins For Bag Clothes Accessories
-9%
$0.37-1.28
No MOQ
 · 
12 views
Free Shipping
Vintage Alloy Angels Brooch Pin For Women Retro Cupid Relief Brooch For Suit Coat Corsage Fashion Jewelry Dress Accessories Gift
Vintage Alloy Angels Brooch Pin For Women Retro Cupid Relief Brooch For Suit Coat Corsage Fashion Jewelry Dress Accessories Gift
like
Find Similar
Retro silver alloy six-angel brooch for women with size and weight measurements - Silver 1720-SL
Macro view of vintage gold-toned angel brooch with precise size and weight dimensions - Gold 1720-GD
Vintage Alloy Angels Brooch Pin For Women Retro Cupid Relief Brooch For Suit Coat Corsage Fashion Jewelry Dress Accessories Gift
-9%
$1.18
No MOQ
Free Shipping
Creative Cute Fruit Enamel Pins Cartoon Tomato Peach Pear Leaf Alloy Brooches Fun Letter Badge Accessory For Women Men
Creative Cute Fruit Enamel Pins Cartoon Tomato Peach Pear Leaf Alloy Brooches Fun Letter Badge Accessory For Women Men
like
Find Similar
Leaf enamel brooch with 'I BELEAF IN YOU' quote on a white background - Green Leaf Style (QHXZ2343)
Cartoon pear enamel pin with 'You're pearfect' text and cute pink cheeks on white background - Yellow Pear Style (QHXZ2344)
Cute pink peach enamel pin with I AP-PEACH-IATE YOU text and green leaf detail - Pink Peach Style (QHXZ2345)
Cute red tomato enamel brooch with I Love You From My Head To-Ma-Toes pun text - Red Tomato Style (QHXZ2346)
Creative Cute Fruit Enamel Pins Cartoon Tomato Peach Pear Leaf Alloy Brooches Fun Letter Badge Accessory For Women Men
-9%
$0.47
No MOQ
 · 
168 sold recently
Free Shipping
Gothic Punk Pink Skull Enamel Pin Badge Alloy Coffin Tarot Card Butterfly Bone Brooch For Backpack Clothing Fashion Decor
Gothic Punk Pink Skull Enamel Pin Badge Alloy Coffin Tarot Card Butterfly Bone Brooch For Backpack Clothing Fashion Decor
like
Find Similar
Pink coffin enamel pin with RIP and Gender Roles text and white floral details - Pink Coffin Style (C2518-2)
Enamel butterfly brooch with ribcage and red rose design with a rubber back pin - Bone Butterfly Rose Style (C2518-4)
Punk style pink skull juice box enamel pin badge with black rubber clutch back - Skull Juice Box Style (C2518--3)
Pink floral skull tarot death enamel pin made of zinc alloy with black rubber backing - Death Tarot Style (C2518-1)
Gothic Punk Pink Skull Enamel Pin Badge Alloy Coffin Tarot Card Butterfly Bone Brooch For Backpack Clothing Fashion Decor
-21%
$0.48
No MOQ
 · 
13 views
Free Shipping
Cute Cartoon Character Enamel Pin Alloy Brooch Personalized Q-Version Character Decorative Badge Accessories For Clothes Bags
Cute Cartoon Character Enamel Pin Alloy Brooch Personalized Q-Version Character Decorative Badge Accessories For Clothes Bags
like
Find Similar
Cute golden metal angel boy enamel pin with white wings and small crown accessory - Angel Style (XZ6120)
Cartoon enamel pin featuring a boy with purple butterfly wings and a red rose detail - Purple Butterfly Wing Style (XZ6121)
Cute enamel brooch featuring a winking cartoon boy with pink petals and gold trim - Pink Flower Decor Style (XZ6122)
Enamel pin of a boy in blue sportswear with white headphones and black hair - Sport Headphone Boy Style (XZ6124)
NewCute Cartoon Character Enamel Pin Alloy Brooch Personalized Q-Version Character Decorative Badge Accessories For Clothes Bags
-9%
$0.39
No MOQ
Pink Creative Enamel Pins Alloy Brooches Creepy Cute Cartoon Skull UFO Ghost Astronaut Badges For Jackets Bags Halloween Jewelry
Pink Creative Enamel Pins Alloy Brooches Creepy Cute Cartoon Skull UFO Ghost Astronaut Badges For Jackets Bags Halloween Jewelry
like
Find Similar
Black and pink coffin badge with ghost pattern and GET IN LOSER WE'RE GOING HAUNTING text - Ghost Coffin Style (QHXZ031)
Pink UFO enamel pin with alien and 'GET IN LOSER' text on a mint green beam - UFO Alien Style (QHXZ032)
Get In Loser enamel pin featuring skeletons in a pink car on a white background - Skull Sports Car Style (QHXZ034)
Pink heart-shaped metal brooch featuring black spiderweb pattern and Stay Weird text - Stay Weird Heart Web Style (QHXZ109)
+7
Pink Creative Enamel Pins Alloy Brooches Creepy Cute Cartoon Skull UFO Ghost Astronaut Badges For Jackets Bags Halloween Jewelry
-10%
$0.47-0.58
Mix MOQ : 2
 · 
10 views
Free Shipping
Elegant Gold Angel Wings Rhinestone Brooch Pin For Women Fashion Jewelry Wings Decorative Inlaid Clothing Accessory Party Gift
Elegant Gold Angel Wings Rhinestone Brooch Pin For Women Fashion Jewelry Wings Decorative Inlaid Clothing Accessory Party Gift
like
Find Similar
Sparkling angel wing brooch with clear zircons in gold finish including size dimensions - Gold
NewElegant Gold Angel Wings Rhinestone Brooch Pin For Women Fashion Jewelry Wings Decorative Inlaid Clothing Accessory Party Gift
-9%
$8.00
No MOQ
Free Shipping
Christian Religious Alloy Cross Brooch Painted Enamel Pin With Inspirational God Prayer Quotes For Bag Apparel Accessory
Christian Religious Alloy Cross Brooch Painted Enamel Pin With Inspirational God Prayer Quotes For Bag Apparel Accessory
like
Find Similar
Religious circular enamel pin with map background and glowing cross emblem - Round Earth Cross Style (QHXZ5074)
Round enamel cross brooch featuring blue ocean waves and Don't Worry God Be With You text - Round Wave Mountain Cross Style (QHXZ5075)
Religious hexagon enamel pin set with black and white Trust God and Thank God quotes - Hexagonal 3D Quote Style (QHXZ5076)
Cross enamel pin in black and white with God is Greater than highs and lows symbols - Minimalist Mountain Cross Style (QHXZ5077)
+1
Christian Religious Alloy Cross Brooch Painted Enamel Pin With Inspirational God Prayer Quotes For Bag Apparel Accessory
-9%
$0.39
No MOQ
 · 
29 sold recently
Elegant Alloy Wing Feather Brooch For Women Luxury Retro Rhinestone Inlaid Corset Pin Clothing Accessories Jewelry
Elegant Alloy Wing Feather Brooch For Women Luxury Retro Rhinestone Inlaid Corset Pin Clothing Accessories Jewelry
like
Find Similar
Detailed view of vintage gold wing brooch with pavé crystal rhinestones and fine feathers - Gold
Detailed close-up of silver wing brooch pins with sparkling pavé-set rhinestones - Silver
Elegant Alloy Wing Feather Brooch For Women Luxury Retro Rhinestone Inlaid Corset Pin Clothing Accessories Jewelry
-9%
$0.47
No MOQ
 · 
25 sold recently
Gothic Enamel Potion Bottle Pin Poison Apple Deadly Nightshade Drink Me Brooch Halloween Jewelry Badge Fashion Accessories
Gothic Enamel Potion Bottle Pin Poison Apple Deadly Nightshade Drink Me Brooch Halloween Jewelry Badge Fashion Accessories
like
Find Similar
Enamel metal pin of a cartoon llama potion bottle for Halloween themed decoration - Purple Unique Potion Bottle Style (XZ9083)
Creepy cute pink potion bottle enamel pin with skull detail and black nickel plating - Pink Skull Potion Bottle (XZ9084)
Enamel potion bottle brooch with blue liquid and Drink Me label Alice theme - Drink Me Blue Potion Bottle (XZ9089)
Gothic enamel pin featuring a black Deadly Nightshade poison bottle for Halloween - Deadly Nightshade Potion Jar (XZ9090)
Gothic Enamel Potion Bottle Pin Poison Apple Deadly Nightshade Drink Me Brooch Halloween Jewelry Badge Fashion Accessories
-8%
$0.63
No MOQ
 · 
11 views
Magic Black Cat Enamel Pin Set Witch Sister Hairstyle Zinc Alloy Brooch Badge For Halloween Party Clothing Bag Decor Gift
Magic Black Cat Enamel Pin Set Witch Sister Hairstyle Zinc Alloy Brooch Badge For Halloween Party Clothing Bag Decor Gift
like
Find Similar
Cartoon black cat enamel pin with purple hair and yellow eyes, variant style - Purple Bun Hairstyle Black Cat Style (QHXZ4787)
Cartoon enamel pin featuring a black cat with vibrant orange curly hair and yellow eyes - Orange Curly Hairstyle Black Cat Style (QHXZ4788)
Cartoon black cat enamel pin with long yellow curly hair and big yellow eyes - Yellow Long Wavy Hairstyle Black Cat Style (QHXZ4789)
Magic Black Cat Enamel Pin Set Witch Sister Hairstyle Zinc Alloy Brooch Badge For Halloween Party Clothing Bag Decor Gift
-9%
$0.39
No MOQ
 · 
21 sold recently
Free Shipping
Elegant Copper Gold Plated Zirconia Moon Angel Brooch Pin For Women Suit Dress Accessories Fashion Jewelry
Elegant Copper Gold Plated Zirconia Moon Angel Brooch Pin For Women Suit Dress Accessories Fashion Jewelry
like
Find Similar
Detail shot of golden moon angel brooch with sparkling white and pink cubic zirconia - Gold
Elegant Copper Gold Plated Zirconia Moon Angel Brooch Pin For Women Suit Dress Accessories Fashion Jewelry
-8%
$6.07
No MOQ
Free Shipping
Cute Cartoon Alloy Enamel Pin Brooches For Women Heart Rainbow Envelope Medal Slogan Badge Decorative Clothing Bag Accessory Gift
Cute Cartoon Alloy Enamel Pin Brooches For Women Heart Rainbow Envelope Medal Slogan Badge Decorative Clothing Bag Accessory Gift
like
Find Similar
Pink enamel envelope pin with red heart and YOU'RE DOING A GREAT JOB text engraving - Pink Envelope Style (xz9170)
White pillow enamel pin with ALWAYS TIRED text and blue stripes on a white background - White Pillow Style (xz9171)
Pink and gold brain enamel pin with lyrics engraving, colorful badge for clothing - Pink Brain Shape Style (xz9179)
Shield-shaped Introverts Anonymous metal badge pin with red and green enamel finish - Red And Green Shield Style (XZ9183)
+1
Cute Cartoon Alloy Enamel Pin Brooches For Women Heart Rainbow Envelope Medal Slogan Badge Decorative Clothing Bag Accessory Gift
-9%
$0.39-0.73
No MOQ
 · 
39 sold recently
Gothic Alloy Enamel Pin Horror Skull Rose Halloween Brooch Badge For Clothing Bag Accessories Punk Jewelry Men Women
Gothic Alloy Enamel Pin Horror Skull Rose Halloween Brooch Badge For Clothing Bag Accessories Punk Jewelry Men Women
like
Find Similar
Skull and red roses enamel pin with 'Going to Hell on a Full Scholarship' text - Skull With Red Roses (QHXZ013)
Cartoon skeleton D20 dice enamel pin badge for tabletop gaming and gothic accessory style - Skull Dice (QHXZ053)
Poison apple skull enamel pin with purple melting lacquer finish and drip design - Poison Apple Skull (QHXZ460)
Skull and flame enamel pin with Fueled by Iced Coffee and Chaos text design - Flaming Skull Coffee (QHXZ1253)
+10
Gothic Alloy Enamel Pin Horror Skull Rose Halloween Brooch Badge For Clothing Bag Accessories Punk Jewelry Men Women
-9%
$0.39-1.31
No MOQ
 · 
14 views
Free Shipping
Creative Alloy Enamel Brooch Pin English Letter Motivational Slogan Badge For Clothes Backpack Decoration Accessory Women
Creative Alloy Enamel Brooch Pin English Letter Motivational Slogan Badge For Clothes Backpack Decoration Accessory Women
like
Find Similar
Blue heart enamel pin badge with 'YOU CAN DO BIG THINGS' motivational text - YOU CAN DO BIG THINGS (XZ8022) / Blue Text (XZ8022)
Purple oval enamel pin badge with be happy smiley face text design for clothing - be happy :) (XZ8023) / Purple Text (XZ8023)
Pink heart enamel pin with You're Strong message and gold-plated edges on white base - YOU'RE STRONG (XZ8024) / Pink Text (XZ8024)
Retro orange enamel pin badge featuring yellow 'enjoy the NOW' text in pop art style - enjoy the NOW (XZ8027) / Orange Yellow Text (XZ8027)
+4
Creative Alloy Enamel Brooch Pin English Letter Motivational Slogan Badge For Clothes Backpack Decoration Accessory Women
-10%
$0.52
Mix MOQ : 2
 · 
31 sold recently
Free Shipping
Creative Cartoon Cat Enamel Brooch David Meowie Girl With Pearl Earring Cat Parody Alloy Artificial Pearl Badge For Backpack
Creative Cartoon Cat Enamel Brooch David Meowie Girl With Pearl Earring Cat Parody Alloy Artificial Pearl Badge For Backpack
like
Find Similar
Cat with pearl earring and sunglasses enamel pin in pop art style for clothing - Girl with Pearl Earring Cat Parody (xz8907)
Enamel cat brooch with sunglasses on a flamingo floaty with I DECIDE MY VIBE text - Cat on Flamingo Float with Sunglasses (xz8910)
Pink round enamel badge with black cat and I Don't Bring Bad Luck humorous quote - Black Cat with Sarcastic Quote (xz8911)
Cartoon white cat enamel brooch with iconic red and blue lightning bolt face paint - David Meowie Lightning Makeup Cat (XZ8908)
+1
Creative Cartoon Cat Enamel Brooch David Meowie Girl With Pearl Earring Cat Parody Alloy Artificial Pearl Badge For Backpack
-9%
$0.68
No MOQ
 · 
16 views
Free Shipping
Elegant Alloy Angel Wing Brooch With Artificial Pearl And Rhinestone Matte Gold Feather Pin For Women Fashion Dress Jewelry
Elegant Alloy Angel Wing Brooch With Artificial Pearl And Rhinestone Matte Gold Feather Pin For Women Fashion Dress Jewelry
like
Find Similar
Matte gold angel wing brooch with white pearl and teardrop zircon crystal accent - Gold
Elegant Alloy Angel Wing Brooch With Artificial Pearl And Rhinestone Matte Gold Feather Pin For Women Fashion Dress Jewelry
-9%
$1.31
Mix MOQ : 3
Vintage Halloween Wizard Hat Brooch Zinc Alloy Enamel Rhinestone Star Pin Witch Hat Pendant For Men Women Party Jewelry Gift
Vintage Halloween Wizard Hat Brooch Zinc Alloy Enamel Rhinestone Star Pin Witch Hat Pendant For Men Women Party Jewelry Gift
like
Find Similar
Vintage witch hat brooch with colorful rhinestones and gold trim on white background - Black (B142-B)
Vintage wizard hat brooch with white enamel, colorful stars, and a hanging pendant - White (B142-A)
Vintage Halloween Wizard Hat Brooch Zinc Alloy Enamel Rhinestone Star Pin Witch Hat Pendant For Men Women Party Jewelry Gift
-9%
$1.86
Mix MOQ : 3
 · 
40 sold recently
Free Shipping
Horror Movie Monster Enamel Pin Alloy Painted Brooch Halloween Cartoon Badge For Backpack Clothes Decor Vampire Mummy Wolfman Design Unisex Jewelry
Horror Movie Monster Enamel Pin Alloy Painted Brooch Halloween Cartoon Badge For Backpack Clothes Decor Vampire Mummy Wolfman Design Unisex Jewelry
like
Find Similar
Cartoon enamel pin featuring a colorful mummy-style female character portrait in orange - Egyptian Mummy Female Character (QHXZ4300)
Orange monster enamel pin in cartoon horror style with purple accents for bags - Purple Comic Style Monster Face (QHXZ4292)
Angry gorilla enamel pin badge with vibrant red and yellow lightning facial patterns - Roaring Gorilla Head (QHXZ4293)
Gothic vampire girl enamel pin with purple skin and black hair on white background - Vampire Female Face (QHXZ4294)
+5
Horror Movie Monster Enamel Pin Alloy Painted Brooch Halloween Cartoon Badge For Backpack Clothes Decor Vampire Mummy Wolfman Design Unisex Jewelry
-8%
$0.45
No MOQ
Gothic Mystery Zinc Alloy Enamel Brooch Pin Set Witchy Bat Owl Winged Cat Magic Potion Badges Accessories For Clothes Bag
Gothic Mystery Zinc Alloy Enamel Brooch Pin Set Witchy Bat Owl Winged Cat Magic Potion Badges Accessories For Clothes Bag
like
Find Similar
Gothic black bat enamel pin with golden metal edge and deep blue moon background - Bat Style (QHXZ5223)
Gothic round enamel pin featuring a black cat with bat wings and purple crystals - Winged Cat Design (QHXZ5224)
Dark style gothic enamel pin featuring a black owl and purple magic potion bottle - Owl Design (QHXZ5225)
Gothic Mystery Zinc Alloy Enamel Brooch Pin Set Witchy Bat Owl Winged Cat Magic Potion Badges Accessories For Clothes Bag
-8%
$0.45
No MOQ
 · 
12 sold recently
Zinc Alloy Enamel Brooch Personalized Cartoon Day Of The Dead Skull Skeleton Badge Pin Halloween Gift For Unisex Accessories
Zinc Alloy Enamel Brooch Personalized Cartoon Day Of The Dead Skull Skeleton Badge Pin Halloween Gift For Unisex Accessories
like
Find Similar
Mexican Day of the Dead enamel pin featuring a colorful skull with floral motifs - Circular Tribal Skull (QHXZ4814)
Enamel skull brooch with vibrant feather headpiece for Dia de los Muertos festival - Feather Crown Day Of The Dead Skull (QHXZ4815)
Sugar skull enamel pin with purple and orange roses for Halloween and Day of the Dead - Rose Flower Crown Skull (QHXZ4816)
Mexican Calavera Day of the Dead enamel pin with white skull and colorful floral hat - Skeleton With Top Hat (QHXZ4817)
+1
Zinc Alloy Enamel Brooch Personalized Cartoon Day Of The Dead Skull Skeleton Badge Pin Halloween Gift For Unisex Accessories
-8%
$0.45
No MOQ
 · 
50 sold recently
New Alloy Enamel Angel Wings Heart Brooch Minimalist Fashion Red Heart Wings Lapel Pin Clothes Accessory For Women Valentine Jewelry
New Alloy Enamel Angel Wings Heart Brooch Minimalist Fashion Red Heart Wings Lapel Pin Clothes Accessory For Women Valentine Jewelry
like
Find Similar
Elegant red enamel heart brooch with white angel wings and gold trim on white background - Red Winged Heart
New Alloy Enamel Angel Wings Heart Brooch Minimalist Fashion Red Heart Wings Lapel Pin Clothes Accessory For Women Valentine Jewelry
-9%
$1.44
No MOQ
Free Shipping
Vintage Halloween Vampire Magician Brooch Pin Alloy Drip Oil Bat Rhinestone Clown Brooches For Party Costume Accessories Jewelry
Vintage Halloween Vampire Magician Brooch Pin Alloy Drip Oil Bat Rhinestone Clown Brooches For Party Costume Accessories Jewelry
like
Find Similar
Vampire magician brooch with black cape and blue gem eyes for Halloween fashion decor - Vampire Style (DR003-A)
Vintage Halloween Vampire Magician Brooch Pin Alloy Drip Oil Bat Rhinestone Clown Brooches For Party Costume Accessories Jewelry
-13%
$1.44
Mix MOQ : 3
 · 
16 sold recently
Free Shipping
Funny Alloy Enamel Pins Cartoon Animal Skull Brooches Humorous Quotes Badges For Backpack Clothes Unisex Jewelry Accessory
Funny Alloy Enamel Pins Cartoon Animal Skull Brooches Humorous Quotes Badges For Backpack Clothes Unisex Jewelry Accessory
like
Find Similar
Skeleton in shirt with pink cup enamel pin featuring Go Ahead Call HR slogan text - Workplace Skull Style (QHXZ4308)
Sad Hamster enamel pin with yellow cross meme design, cute metal waist buckle badge - Sad Hamster Style (QHXZ4345)
Funny black cat enamel pin with retro sunset background and It's Fine I'm Fine slogan - Anxious Cat Style (QHXZ4346)
Cute meditation sloth enamel pin with Let That Shit Go text for clothes decoration - Meditating Sloth Style (QHXZ4360)
+6
Funny Alloy Enamel Pins Cartoon Animal Skull Brooches Humorous Quotes Badges For Backpack Clothes Unisex Jewelry Accessory
-10%
$0.37-0.55
No MOQ
 · 
199 sold recently
Top 10% Best Sellers
in Brooches
Gothic Purple Enamel Pin Crow Coffin Heart Zinc Alloy Brooch Badge Punk Dark Style Lapel Pin Jewelry Accessory For Unisex Gift
Gothic Purple Enamel Pin Crow Coffin Heart Zinc Alloy Brooch Badge Punk Dark Style Lapel Pin Jewelry Accessory For Unisex Gift
like
Find Similar
Gothic purple coffin enamel pin with Rot in Hell text and pink heart floral details - Purple Coffin Style (QHXZ1350)
Gothic purple heart enamel pin with dagger and 'Live through the pain' text - Dagger Through Heart Style (QHXZ1351)
Gothic raven enamel pin featuring No Mourners No Funerals quote in purple and black - Black Crow Style (QHXZ1352)
Gothic Purple Enamel Pin Crow Coffin Heart Zinc Alloy Brooch Badge Punk Dark Style Lapel Pin Jewelry Accessory For Unisex Gift
-10%
$0.52
No MOQ
 · 
20 views
Cartoon Dark Gothic Series Cat Bat Mothman Enamel Pin Alloy Brooch Personalized Spooky Animal Pins Badges For Clothes Bags Decor
Cartoon Dark Gothic Series Cat Bat Mothman Enamel Pin Alloy Brooch Personalized Spooky Animal Pins Badges For Clothes Bags Decor
like
Find Similar
Cartoon ghost enamel pin with purple banner and inspirational text for Halloween - Ghost Quote Style (QHXZ063)
Enamel black cat badge with red flames and All Hail Lucipurrk text on white background - Black Cat Flame Style (QHXZ065)
Pink butterfly skull enamel pin with the quote YOU DID NOT WAKE UP TODAY TO BE MEDIOCRE - Skeleton Wings Style (QHXZ066)
Cartoon enamel cat brooch featuring I'm Fine everything is fine humorous quote design - Anxious Cat Quote Style (QHXZ067)
+8
Cartoon Dark Gothic Series Cat Bat Mothman Enamel Pin Alloy Brooch Personalized Spooky Animal Pins Badges For Clothes Bags Decor
-10%
$0.52-0.71
No MOQ
 · 
11 sold recently
Free Shipping
Elegant Angel Wing Brooch For Women Copper Inlaid Zirconia V-Shape Artificial Pearl Anti-Exposure Pin Jewelry Gift
Elegant Angel Wing Brooch For Women Copper Inlaid Zirconia V-Shape Artificial Pearl Anti-Exposure Pin Jewelry Gift
like
Find Similar
Elegant 18K gold wing brooch with white drop pearl and cubic zirconia accents - Gold
Elegant Angel Wing Brooch For Women Copper Inlaid Zirconia V-Shape Artificial Pearl Anti-Exposure Pin Jewelry Gift
-9%
$3.03
No MOQ
Free Shipping
Cute Cartoon Cow Enamel Brooch Pin Women Men Zinc Alloy Animal Rhinestone Breastpin Fashion Jewelry Clothing Decor Gift
Cute Cartoon Cow Enamel Brooch Pin Women Men Zinc Alloy Animal Rhinestone Breastpin Fashion Jewelry Clothing Decor Gift
like
Find Similar
Cartoon calf animal brooch with silver metal finish and grey sparkling rhinestones - Silver White
Cute calf brooch in golden metal with white enamel and sparkling brown rhinestones - Antique Gold White
Creative red enamel cow brooch with sparkling crystals on book pages background - Red
Cute cartoon cow animal brooch with sparkling rhinestones and enamel finish - White
+1
Cute Cartoon Cow Enamel Brooch Pin Women Men Zinc Alloy Animal Rhinestone Breastpin Fashion Jewelry Clothing Decor Gift
-9%
$1.18
No MOQ
 · 
31 sold recently
Free Shipping
Gothic Snake Enamel Pin Brooch Set Vintage Mystery Sun Moon Skull Rose Dagger Alloy Badge For Men Women Fashion Jewelry Gift
Gothic Snake Enamel Pin Brooch Set Vintage Mystery Sun Moon Skull Rose Dagger Alloy Badge For Men Women Fashion Jewelry Gift
like
Find Similar
Gothic moon and snake enamel pin featuring astrology symbols and stars in black gold - Snake with Moon Style (XZ5408)
Gothic black snake enamel brooch with skull and pink roses in golden finish - Snake Around Skull Rose Style (XZ5409)
Gothic black snake coiled around a white dagger enamel pin with celestial moon patterns - Snake with Dagger Style (XZ5411)
Enamel black snake pin with golden moon phases and stars motifs on white background - Coiled Snake with Moon Phases Style (XZ5412)
Gothic Snake Enamel Pin Brooch Set Vintage Mystery Sun Moon Skull Rose Dagger Alloy Badge For Men Women Fashion Jewelry Gift
-8%
$0.45
No MOQ
 · 
24 sold recently
Free Shipping
Pastel Goth Skeleton Enamel Pin Zinc Alloy Coffin Tombstone Moon Ribs Floral Brooch Halloween Lavender Jewelry Badge
Pastel Goth Skeleton Enamel Pin Zinc Alloy Coffin Tombstone Moon Ribs Floral Brooch Halloween Lavender Jewelry Badge
like
Find Similar
Gothic purple coffin enamel pin with skull, pink bow, and RIP text detail - Lavender Bow Coffin Style (QHXZ4833)
Gothic purple moon brooch with black spider and skull flower enamel pin design - Crescent Moon Spiderweb Style (QHXZ4834)
Gothic tombstone enamel pin with Dead Cute text and purple butterfly ribbon - Tombstone Style (QHXZ4835)
Enamel pin featuring a ribcage with purple flowers and butterflies on white background - Ribs Floral Style (QHXZ4836)
Pastel Goth Skeleton Enamel Pin Zinc Alloy Coffin Tombstone Moon Ribs Floral Brooch Halloween Lavender Jewelry Badge
-9%
$0.39
No MOQ
 · 
10 sold recently
Halloween Cat Enamel Pin Reaper Skull Ghost Alloy Brooch For Backpack Clothing Personalized Cartoon Jewelry Badge Gift
Halloween Cat Enamel Pin Reaper Skull Ghost Alloy Brooch For Backpack Clothing Personalized Cartoon Jewelry Badge Gift
like
Find Similar
Black reaper cat enamel pin with five white skulls in a gothic cartoon metal style - Cat On Skulls Style (QHXZ4553)
Dark punk enamel pin featuring a cute grim reaper holding a black cat mascot - Grim Reaper Hugging Black Cat Style (QHXZ4554)
Dark punk reaper cat enamel pin featuring three cute stacked kittens with a silver scythe - Cats Inside Reaper Cloak Style (QHXZ4555)
Halloween Cat Enamel Pin Reaper Skull Ghost Alloy Brooch For Backpack Clothing Personalized Cartoon Jewelry Badge Gift
-7%
$0.37
No MOQ
 · 
22 sold recently
Luxury Copper Zirconia Angel Wing Brooch For Men Women Suit Sweater Corsage Pin Fashion Zirconia Inlaid Unisex Jewelry Gift
Luxury Copper Zirconia Angel Wing Brooch For Men Women Suit Sweater Corsage Pin Fashion Zirconia Inlaid Unisex Jewelry Gift
like
Find Similar
Elegant gold wing brooch with white cubic zirconia and detailed feather texture - Gold
Luxury Copper Zirconia Angel Wing Brooch For Men Women Suit Sweater Corsage Pin Fashion Zirconia Inlaid Unisex Jewelry Gift
-9%
$6.89
No MOQ
Free Shipping
Gothic Bat Enamel Pin Set Cartoon Coffin Moon Heart Rose Brooches Zinc Alloy Halloween Dark Style Clothing Accessory Badge
Gothic Bat Enamel Pin Set Cartoon Coffin Moon Heart Rose Brooches Zinc Alloy Halloween Dark Style Clothing Accessory Badge
like
Find Similar
Gothic bat enamel pin with 'batty for you' text and silver butterfly clutch back - Spread Wing Bat Style (CZ0486-1)
Gothic bat coffin enamel pin with silver butterfly clutch and vampire quote lettering - Coffin Bat Style (CZ0486-2)
Gothic bat and heart enamel brooch pin in silver and black finish with butterfly clasp - Rose Heart Bat Style (CZ0486-3)
Black bat enamel pin with white crescent moon and stars on a white background - Moon Flower Bat Style (CZ0486-4)
Gothic Bat Enamel Pin Set Cartoon Coffin Moon Heart Rose Brooches Zinc Alloy Halloween Dark Style Clothing Accessory Badge
-10%
$0.52
No MOQ
 · 
11 views
Free Shipping
Halloween Enamel Brooches Creative Cartoon Rubber Duck Frankenstein Vampire Devil Zombie Pins Badges For Clothes Bag Decor
Halloween Enamel Brooches Creative Cartoon Rubber Duck Frankenstein Vampire Devil Zombie Pins Badges For Clothes Bag Decor
like
Find Similar
Enamel pin of a buff yellow vampire duck with a black cloak and red bow for Halloween - Vampire Dracula Style(QHXZ3260)
Red devil duck enamel pin with black horns and arrow tail made of high-quality alloy - Red Devil Style (QHXZ3261)
Halloween Enamel Brooches Creative Cartoon Rubber Duck Frankenstein Vampire Devil Zombie Pins Badges For Clothes Bag Decor
-8%
$0.42
No MOQ
 · 
297 sold recently
Zinc Alloy Christian Enamel Brooch Pin Religious Quotes Blessed Child Of God Holy Spirit Jesus Fish Metal Badge For Clothing
Zinc Alloy Christian Enamel Brooch Pin Religious Quotes Blessed Child Of God Holy Spirit Jesus Fish Metal Badge For Clothing
like
Find Similar
Hello My Name Is Child of God red and white enamel lapel pin badge accessory - Child of God Red White Tag (QHXZ3095)
Enamel pin with May the Holy Spirit Be with You text and winged cross in black and gold - Holy Spirit Black Gold (QHXZ3096)
Pink Ichthys fish enamel pin with 'With God All Things Are Possible' religious quote - Jesus Fish Inspirational Style (QHXZ3097)
Rectangular black enamel pin with white I RIDE WITH JESUS lettering for clothing - I Ride With Jesus Black White Bar (QHXZ3098)
+1
Zinc Alloy Christian Enamel Brooch Pin Religious Quotes Blessed Child Of God Holy Spirit Jesus Fish Metal Badge For Clothing
-8%
$0.45
No MOQ
 · 
14 views
Free Shipping
Halloween Enamel Brooch Pin Set Cute Cartoon Capybara Duck Ghost Pumpkin Black Cat Badge Jewelry Gift For Women Men Kids
Halloween Enamel Brooch Pin Set Cute Cartoon Capybara Duck Ghost Pumpkin Black Cat Badge Jewelry Gift For Women Men Kids
like
Find Similar
Cartoon capybara with pumpkin enamel pin badge for Halloween festive decoration - Capybara Pumpkin (QHXZ4742)
Cute Halloween Capybara enamel pin featuring a ghost costume and pumpkin bucket accessory - Ghost Cloak Capybara (QHXZ4743)
Cute Capybara enamel pin with a green-leafed pumpkin on its head on a white background - Capybara with Pumpkin on Head (QHXZ4744)
Halloween enamel pin with capybara in wizard hat and spooky pumpkins on white background - Witch Hat Capybara (QHXZ4745)
+12
Halloween Enamel Brooch Pin Set Cute Cartoon Capybara Duck Ghost Pumpkin Black Cat Badge Jewelry Gift For Women Men Kids
-8%
$0.37-0.45
No MOQ
Free Shipping
Go to

More in accessories

Explore more in angel pins

alloyartificial pearlheartgirlstylepartyshapedecorativedesigngold plated rhinestone
goldsuitinlaideyewhitemetalkidsplated rhinestonestarsphone

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access