Everful

Wholesale angel pins

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Angel Pins

Find the perfect pieces: alloy brooches, fashion brooches, crystal brooches and more

Popular collections in angel pins

All products in angel pins

filterShow filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Angel Cat Enamel Brooch Night Scene City Moon Stars Design Cute Pink Kitty Badge Alloy Metal Jewelry Pin For Women Kids Gift
Angel Cat Enamel Brooch Night Scene City Moon Stars Design Cute Pink Kitty Badge Alloy Metal Jewelry Pin For Women Kids Gift
like
Find Similar
Enamel angel badge with pink character and starry night sky scene on white background - Pink Angel Cat Night Scene (CC598)
Angel Cat Enamel Brooch Night Scene City Moon Stars Design Cute Pink Kitty Badge Alloy Metal Jewelry Pin For Women Kids Gift
-9%
$0.68
No MOQ
Elegant Enamel Angel Wings Brooch For Women Luxury Alloy Artificial Pearl Zirconia Pin For Suit Jacket Banquet Jewelry Accessory
Elegant Enamel Angel Wings Brooch For Women Luxury Alloy Artificial Pearl Zirconia Pin For Suit Jacket Banquet Jewelry Accessory
like
Find Similar
Elegant angel wing brooch with pearls and colorful enamel on a polished gold base - Blue
Golden enamel angel wing brooch with green gradient wings, pearls and a teardrop pendant - Green
Elegant Enamel Angel Wings Brooch For Women Luxury Alloy Artificial Pearl Zirconia Pin For Suit Jacket Banquet Jewelry Accessory
-9%
$0.60
No MOQ
Cartoon Angel Wings Eyes Enamel Pin Brooch Alloy White Blue Seraphim Badge Personalized Creative Fashion Jewelry Gifts For Clothing Backpack
Cartoon Angel Wings Eyes Enamel Pin Brooch Alloy White Blue Seraphim Badge Personalized Creative Fashion Jewelry Gifts For Clothing Backpack
like
Find Similar
Anime-style enamel pin featuring wings, heart, and star in mint green and gold finish - Xz9537
Minimalist six-winged angel enamel pin in white and light blue with golden alloy frame - Six-Winged Angel Style (XZ9538)
Cartoon Angel Wings Eyes Enamel Pin Brooch Alloy White Blue Seraphim Badge Personalized Creative Fashion Jewelry Gifts For Clothing Backpack
-8%
$0.42
No MOQ
Free Shipping
Retro Creative Angel Brooch Holding Puppy Alloy Enamel Dripping Oil Rhinestone Pin Badge Clothing Accessory For Women Jewelry
Retro Creative Angel Brooch Holding Puppy Alloy Enamel Dripping Oil Rhinestone Pin Badge Clothing Accessory For Women Jewelry
like
Find Similar
Macro detail of vintage gold angel brooch with white enamel dress and small rhinestones - Gold
Retro Creative Angel Brooch Holding Puppy Alloy Enamel Dripping Oil Rhinestone Pin Badge Clothing Accessory For Women Jewelry
-9%
$1.31
Mix MOQ : 3
Free Shipping
Vintage Alloy Angel Wing Feather Brooch For Women Elegant Rhinestone Inlaid Faux Artificial Pearl Pin Suit Wedding Banquet Jewelry
Vintage Alloy Angel Wing Feather Brooch For Women Elegant Rhinestone Inlaid Faux Artificial Pearl Pin Suit Wedding Banquet Jewelry
like
Find Similar
Elegant silver angel wing brooch with sparkling crystals and a lustrous pearl in hand - White Pearl Style (XZ0346-1)
Elegant silver feather brooch with white rhinestones and a dark grey pearl detail - Black Pearl Style (XZ0346-2)
Vintage Alloy Angel Wing Feather Brooch For Women Elegant Rhinestone Inlaid Faux Artificial Pearl Pin Suit Wedding Banquet Jewelry
-8%
$0.94
No MOQ
Vintage Motel Key Tag Enamel Pins Creative Devil Angel Wing Brooch For Clothing Backpack Unisex Alloy Jewelry Gift
Vintage Motel Key Tag Enamel Pins Creative Devil Angel Wing Brooch For Clothing Backpack Unisex Alloy Jewelry Gift
like
Find Similar
Red and black Motel 666 enamel pin with devil horns and gothic style badge accessory - Red Devil Style (QHXZ5017)
Blue motel 444 enamel pin featuring white angel wings and a golden halo design - Blue Angel Style (QHXZ5018)
Vintage Motel Key Tag Enamel Pins Creative Devil Angel Wing Brooch For Clothing Backpack Unisex Alloy Jewelry Gift
-9%
$0.39
No MOQ
Free Shipping
Luxury Alloy Angel Wing Brooch Pin With Red Enamel Gold Stars White Rhinestone And Red Artificial Pearl Pendant Women Suit Jewelry
Luxury Alloy Angel Wing Brooch Pin With Red Enamel Gold Stars White Rhinestone And Red Artificial Pearl Pendant Women Suit Jewelry
like
Find Similar
Luxury red and gold angel wing brooch with five stars and a red pearl pendant - Red
NewLuxury Alloy Angel Wing Brooch Pin With Red Enamel Gold Stars White Rhinestone And Red Artificial Pearl Pendant Women Suit Jewelry
-7%
$0.58
No MOQ
Free Shipping
Angel Wings Heart Rhinestone Brooch For Women Gold Silver Zinc Alloy Crystal Teardrop Pendant Suit Pin Fashion Jewelry
Angel Wings Heart Rhinestone Brooch For Women Gold Silver Zinc Alloy Crystal Teardrop Pendant Suit Pin Fashion Jewelry
like
Find Similar
Elegant angel wings brooch with heart crystal and water drop pendant on gold base - Gold Angel
Elegant silver angel wings heart brooch with sparkling rhinestones and drop pendant - Silver Angel
Angel Wings Heart Rhinestone Brooch For Women Gold Silver Zinc Alloy Crystal Teardrop Pendant Suit Pin Fashion Jewelry
-13%
$0.45
Mix MOQ : 2
Angel Wing Rhinestone Brooch Alloy Inlaid Sparkling Suit Lapel Pin For Women Men Fashion Jewelry Clothing Accessory Gold Silver
Angel Wing Rhinestone Brooch Alloy Inlaid Sparkling Suit Lapel Pin For Women Men Fashion Jewelry Clothing Accessory Gold Silver
like
Find Similar
Elegant gold angel wing brooch with sparkling rhinestones for suits and coats - Angel Style Gold (MM-BR-2348-GD) / Gold
Silver angel wing brooch with sparkling rhinestones, 4.1cm high and 5.5cm wide for jackets - Angel Style Silver (MM-BR-2348-SL) / Silver
Angel Wing Rhinestone Brooch Alloy Inlaid Sparkling Suit Lapel Pin For Women Men Fashion Jewelry Clothing Accessory Gold Silver
-9%
$1.44
No MOQ
Free Shipping
Vintage Motel Keychain Style Enamel Pins 444 Angel 666 Devil Zinc Alloy Brooch Badge For Clothing Bags Unisex Jewelry
Vintage Motel Keychain Style Enamel Pins 444 Angel 666 Devil Zinc Alloy Brooch Badge For Clothing Bags Unisex Jewelry
like
Find Similar
Red and black Motel 666 enamel pin with devil horns and gothic style badge accessory - Red Devil Style (QHXZ5017)
Blue motel 444 enamel pin featuring white angel wings and a golden halo design - Light Blue Angel Style (QHXZ5018)
Vintage Motel Keychain Style Enamel Pins 444 Angel 666 Devil Zinc Alloy Brooch Badge For Clothing Bags Unisex Jewelry
-9%
$0.39
No MOQ
Free Shipping
Vintage Gold Alloy Enamel Angel Brooch Pin For Women Elegant Wing Praying Angel Lapel Pin Suit Sweater Corsage Jewelry Accessories
Vintage Gold Alloy Enamel Angel Brooch Pin For Women Elegant Wing Praying Angel Lapel Pin Suit Sweater Corsage Jewelry Accessories
like
Find Similar
Golden angel enamel brooch dimensions and weight shown on a clean white background - White
Detailed dimensions of the gold and dark blue enamel angel brooch in inches and cm - Blue
Vintage Gold Alloy Enamel Angel Brooch Pin For Women Elegant Wing Praying Angel Lapel Pin Suit Sweater Corsage Jewelry Accessories
-9%
$1.31
Mix MOQ : 3
Free Shipping
Stainless Steel Angel Brooch For Women Irregular Pleated Wrinkled Design Mirror Polished Metallic Fashion Clothing Jewelry Pin
Stainless Steel Angel Brooch For Women Irregular Pleated Wrinkled Design Mirror Polished Metallic Fashion Clothing Jewelry Pin
like
Find Similar
Detailed macro view of silver irregular pleated metal brooch with mirror polished finish - Silver
Golden irregular pleated metal brooch with a high-gloss mirror finish for elegant styling - Gold
Stainless Steel Angel Brooch For Women Irregular Pleated Wrinkled Design Mirror Polished Metallic Fashion Clothing Jewelry Pin
-13%
$1.37-1.57
No MOQ
Free Shipping
Cute Cartoon Angel Devil Cat Enamel Brooch Pin Set Alloy Animal Badge For Backpack Clothing Decoration Women Girls Gift
Cute Cartoon Angel Devil Cat Enamel Brooch Pin Set Alloy Animal Badge For Backpack Clothing Decoration Women Girls Gift
like
Find Similar
Cute cartoon white angel cat enamel pin with pink heart necklace for backpack and clothing - No.15 Angel Cat
Cute black demon cat enamel pin with red bat wings and orange bell for backpacks - No.16 Devil Cat
Cute Cartoon Angel Devil Cat Enamel Brooch Pin Set Alloy Animal Badge For Backpack Clothing Decoration Women Girls Gift
-9%
$0.39
Mix MOQ : 2
Vintage Alloy Artificial Pearl Moon Angel Brooch Pin Matte Gold Silver Fairy Mythology Fashion Accessory For Women Jewelry
Vintage Alloy Artificial Pearl Moon Angel Brooch Pin Matte Gold Silver Fairy Mythology Fashion Accessory For Women Jewelry
like
Find Similar
Macro detail of vintage matte gold sun and moon brooch with pearl accents - Gold
Detail of vintage matte fairy and moon brooch with silver finish and white pearls - Silver
Vintage Alloy Artificial Pearl Moon Angel Brooch Pin Matte Gold Silver Fairy Mythology Fashion Accessory For Women Jewelry
-9%
$1.44
Mix MOQ : 3
Free Shipping
Surrealist Cthulhu Angel Enamel Brooch Pin Seraphim Wings Multi Eye White Gold Alloy Badge Halloween Gift Clothing Accessory
Surrealist Cthulhu Angel Enamel Brooch Pin Seraphim Wings Multi Eye White Gold Alloy Badge Halloween Gift Clothing Accessory
like
Find Similar
Detailed view of white seraphim enamel brooch with wing design and product dimensions - Hand Holding Halo Torso Style (XZ2958-1)
Gothic white seraphim enamel pin with wings and eyes, measures 4.2cm by 4cm - Multi-eyed Angel Style (XZ2958-2)
Surrealist Cthulhu Angel Enamel Brooch Pin Seraphim Wings Multi Eye White Gold Alloy Badge Halloween Gift Clothing Accessory
-9%
$0.73
Mix MOQ : 2
Free Shipping
Enamel Angel And Demon Wing Brooch Pin For Clothes Backpack Black White Winged Figure Ineffable Lapel Pin Alloy Jewelry Gift
Enamel Angel And Demon Wing Brooch Pin For Clothes Backpack Black White Winged Figure Ineffable Lapel Pin Alloy Jewelry Gift
like
Find Similar
Good Omens inspired black angel wing enamel pin with gold finish and metal plating - Black Winged Figure(QHXZ549)
White angel wings enamel brooch pin with gold metal plating for Good Omens fans - White Winged Figure(QHXZ550)
Enamel Angel And Demon Wing Brooch Pin For Clothes Backpack Black White Winged Figure Ineffable Lapel Pin Alloy Jewelry Gift
-9%
$0.50
No MOQ
Free Shipping
Zinc Alloy Enamel Seraphim Eye Of Horus Angel Wings Brooch Personalized Fantasy Mythical Bird Pin Badge For Clothing Decoration
Zinc Alloy Enamel Seraphim Eye Of Horus Angel Wings Brooch Personalized Fantasy Mythical Bird Pin Badge For Clothing Decoration
like
Find Similar
Anime-style enamel pin featuring wings, heart, and star in mint green and gold finish - Wings Heart Style (XZ9537)
Minimalist six-winged angel enamel pin in white and light blue with golden alloy frame - Six-Winged Angel Style (XZ9538)
Zinc Alloy Enamel Seraphim Eye Of Horus Angel Wings Brooch Personalized Fantasy Mythical Bird Pin Badge For Clothing Decoration
-8%
$0.42
No MOQ
Free Shipping
Luxury Gold Plated Alloy Rhinestone Angel Wing Artificial Pearl Brooch Elegant Inlaid Zirconia Wing Pendant Pin For Women Wedding Party
Luxury Gold Plated Alloy Rhinestone Angel Wing Artificial Pearl Brooch Elegant Inlaid Zirconia Wing Pendant Pin For Women Wedding Party
like
Find Similar
Elegant gold angel wing brooch with sparkling crystals and a white pearl drop on black velvet - Gold Angel Wing Pearl Style
NewLuxury Gold Plated Alloy Rhinestone Angel Wing Artificial Pearl Brooch Elegant Inlaid Zirconia Wing Pendant Pin For Women Wedding Party
-7%
$0.58
No MOQ
Fashion Alloy Enamel Angel Wing Brooch Rhinestone Inlaid Wings Pin Jewelry For Women Dress Banquet Clothing Accessories
Fashion Alloy Enamel Angel Wing Brooch Rhinestone Inlaid Wings Pin Jewelry For Women Dress Banquet Clothing Accessories
like
Find Similar
Detailed size view of an enamel angel wing brooch with pink rhinestones and dimensions - Gold Pink
Purple alloy angel wings brooch with rhinestones measuring 5.7cm by 3.8cm - Gold Purple
Elegant peacock blue and white angel wing brooch with crystals in gold finish - Gold Blue
Fashion angel wings enamel brooch with sparkling crystals and golden metal trim - Gold White
Fashion Alloy Enamel Angel Wing Brooch Rhinestone Inlaid Wings Pin Jewelry For Women Dress Banquet Clothing Accessories
-9%
$1.70
No MOQ
Free Shipping
Surrealist Artistic Enamel Brooch Pin Square Cartoon Angel And Multi-Eyed Eyes Badge For Clothing Backpack Accessories
Surrealist Artistic Enamel Brooch Pin Square Cartoon Angel And Multi-Eyed Eyes Badge For Clothing Backpack Accessories
like
Find Similar
Cartoon enamel pin featuring a single-eyed angel with halo and yellow stars on square frame - One-Eyed Angel Style (CC261)
Pink cartoon enamel pin featuring abstract angel characters with large eyes in a frame - Pink Artistic Eye Style (CC262)
Surrealist Artistic Enamel Brooch Pin Square Cartoon Angel And Multi-Eyed Eyes Badge For Clothing Backpack Accessories
-9%
$0.60
No MOQ
Free Shipping
Angel Wings Enamel Pin Brooch Feather Eye Sacred Heart Badge For Backpack Clothing Alloy Brooch Accessory Unisex Jewelry
Angel Wings Enamel Pin Brooch Feather Eye Sacred Heart Badge For Backpack Clothing Alloy Brooch Accessory Unisex Jewelry
like
Find Similar
Anime-style enamel pin featuring wings, heart, and star in mint green and gold finish - Angel Heart Style (XZ9537)
Minimalist six-winged angel enamel pin in white and light blue with golden alloy frame - Six-Winged Angel Style (XZ9538)
Angel Wings Enamel Pin Brooch Feather Eye Sacred Heart Badge For Backpack Clothing Alloy Brooch Accessory Unisex Jewelry
-8%
$0.42
No MOQ
Vintage Motel Series Zinc Alloy Enamel Brooch Personalized Devil Angel Shape Pin Badge Accessories For Bags Apparel
Vintage Motel Series Zinc Alloy Enamel Brooch Personalized Devil Angel Shape Pin Badge Accessories For Bags Apparel
like
Find Similar
Red and black Motel 666 enamel pin with devil horns and gothic style badge accessory - Devil Red (QHXZ5017)
Blue motel 444 enamel pin featuring white angel wings and a golden halo design - Angel Blue (QHXZ5018)
Vintage Motel Series Zinc Alloy Enamel Brooch Personalized Devil Angel Shape Pin Badge Accessories For Bags Apparel
-9%
$0.39
No MOQ
Free Shipping
Angel Wings Heart Brooch Alloy Rhinestone Tassel Pin Elegant Corsage For Women Suit Sweater Jewelry Wedding Party Accessories
Angel Wings Heart Brooch Alloy Rhinestone Tassel Pin Elegant Corsage For Women Suit Sweater Jewelry Wedding Party Accessories
like
Find Similar
Elegant angel wing heart brooch with opal-like stone and sparkling tassel pendant - Silver
Angel Wings Heart Brooch Alloy Rhinestone Tassel Pin Elegant Corsage For Women Suit Sweater Jewelry Wedding Party Accessories
-9%
$0.47
No MOQ
Elegant Alloy Fairy Brooch For Women Gold Plated Rhinestone Artificial Pearl Angel Wings Pin Jewelry Accessories For Clothes
Elegant Alloy Fairy Brooch For Women Gold Plated Rhinestone Artificial Pearl Angel Wings Pin Jewelry Accessories For Clothes
like
Find Similar
Elegant gold-tone fairy brooch with pink rhinestones and white pearl on a white background - Pink
Elegant fairy brooch with sea blue rhinestones, gold plating, and a white pearl accent - Lake Blue
Exquisite gold and purple fairy brooch with crystals and pearl on a white pedestal - Purple
Elegant Alloy Fairy Brooch For Women Gold Plated Rhinestone Artificial Pearl Angel Wings Pin Jewelry Accessories For Clothes
-9%
$1.83
No MOQ
Free Shipping
Niche Design Cartoon Winged Angel Alloy Brooch Black White Figure Enamel Pin For Clothes Bag Backpack Accessories Fun Jewelry
Niche Design Cartoon Winged Angel Alloy Brooch Black White Figure Enamel Pin For Clothes Bag Backpack Accessories Fun Jewelry
like
Find Similar
Good Omens inspired black angel wing enamel pin with gold finish and metal plating - Black Winged Angel Style (QHXZ549)
White angel wings enamel brooch pin with gold metal plating for Good Omens fans - White Winged Angel Style (QHXZ550)
Niche Design Cartoon Winged Angel Alloy Brooch Black White Figure Enamel Pin For Clothes Bag Backpack Accessories Fun Jewelry
-9%
$0.50
No MOQ
Gothic Angel Demon Wings Enamel Brooch Pin Alloy Electroplated Gold Edge Intertwined Wing Badge For Clothing Bag Decor
Gothic Angel Demon Wings Enamel Brooch Pin Alloy Electroplated Gold Edge Intertwined Wing Badge For Clothing Bag Decor
like
Find Similar
Good Omens inspired black angel enamel pin with golden metal wings and silhouette - Black Angel Figure (QHXZ549)
Good Omens style golden metal white enamel wings angel pin badge accessory - White Angel Figure (QHXZ550)
Gothic Angel Demon Wings Enamel Brooch Pin Alloy Electroplated Gold Edge Intertwined Wing Badge For Clothing Bag Decor
-9%
$0.50
No MOQ
Free Shipping
Fashion Alloy Zirconia Angel Wing Brooch Trendy Vintage Luxurious Suit Lapel Pin Decorative Brooch Jewelry Accessories
Fashion Alloy Zirconia Angel Wing Brooch Trendy Vintage Luxurious Suit Lapel Pin Decorative Brooch Jewelry Accessories
like
Find Similar
Detailed close-up of golden angel wing brooch with sparkling rhinestones and metal texture - Gold
Macro detail of silver angel wing brooch with sparkling white zircons on wooden surface - Silver
Fashion Alloy Zirconia Angel Wing Brooch Trendy Vintage Luxurious Suit Lapel Pin Decorative Brooch Jewelry Accessories
-9%
$0.60
No MOQ
Elegant Angel Wing Brooch Pin Copper Zirconia Inlaid Luxury Suit Sweater Lapel Pin Fashion Jewelry For Women Men Gift
Elegant Angel Wing Brooch Pin Copper Zirconia Inlaid Luxury Suit Sweater Lapel Pin Fashion Jewelry For Women Men Gift
like
Find Similar
Elegant gold wing brooch with white cubic zirconia and detailed feather texture - Gold (8271-GD)
Elegant Angel Wing Brooch Pin Copper Zirconia Inlaid Luxury Suit Sweater Lapel Pin Fashion Jewelry For Women Men Gift
-13%
$6.55
Mix MOQ : 3
Free Shipping
Vintage Alloy Caduceus Brooch Enamel Snake Scepter Angel Wings Lapel Pin Medical Symbol Jewelry Suit Accessory For Men Women
Vintage Alloy Caduceus Brooch Enamel Snake Scepter Angel Wings Lapel Pin Medical Symbol Jewelry Suit Accessory For Men Women
like
Find Similar
Macro shot of gold caduceus brooch with detailed snake scales and white enamel wings - White
Golden Caduceus brooch with red and black enamel wings on white geometric steps - Red
Classic silver caduceus brooch with blue enamel wings on minimalist white display pedestal - Blue
Silver alloy caduceus snake brooch with black enamel wings and vintage industrial style - Black
Vintage Alloy Caduceus Brooch Enamel Snake Scepter Angel Wings Lapel Pin Medical Symbol Jewelry Suit Accessory For Men Women
-9%
$1.18
No MOQ
Free Shipping
Gothic Enamel Pin Eye Flame Angel Wings Seraphim Brooch Zinc Alloy Lacquer Badge For Clothing Accessories Unisex Anime Jewelry
Gothic Enamel Pin Eye Flame Angel Wings Seraphim Brooch Zinc Alloy Lacquer Badge For Clothing Accessories Unisex Anime Jewelry
like
Find Similar
Soul Eater style flame eye enamel brooch with golden metal base and orange detailing - Yellow Flame Eye Style (XZ9290)
Gothic Enamel Pin Eye Flame Angel Wings Seraphim Brooch Zinc Alloy Lacquer Badge For Clothing Accessories Unisex Anime Jewelry
-10%
$0.52
No MOQ
Free Shipping
Creative Alloy Enamel BELIEVE Lettering Design Brooch Angel Anatomy Badge Personality Retro Lapel Pin For Clothing Accessories
Creative Alloy Enamel BELIEVE Lettering Design Brooch Angel Anatomy Badge Personality Retro Lapel Pin For Clothing Accessories
like
Find Similar
Yellow enamel brooch with blue Believe text and black metal frame on white background - BELIEVE Lettering Design (QHXZ715)
Enamel brooch with yellow anatomy angel design inspired by the In Utero album cover - Angel Anatomy Design (xz7388)
Creative Alloy Enamel BELIEVE Lettering Design Brooch Angel Anatomy Badge Personality Retro Lapel Pin For Clothing Accessories
-7%
$0.58
No MOQ
Free Shipping
Creative Angel Devil Enamel Pins Retro Motel Key Tag Badge Personality Red Blue Alloy Brooch Fashion Jewelry Accessory
Creative Angel Devil Enamel Pins Retro Motel Key Tag Badge Personality Red Blue Alloy Brooch Fashion Jewelry Accessory
like
Find Similar
Red and black Motel 666 enamel pin with devil horns and gothic style badge accessory - Red Devil Style (QHXZ5017)
Blue motel 444 enamel pin featuring white angel wings and a golden halo design - Blue Angel Style (QHXZ5018)
Creative Angel Devil Enamel Pins Retro Motel Key Tag Badge Personality Red Blue Alloy Brooch Fashion Jewelry Accessory
-9%
$0.39
No MOQ
Elegant Copper Zirconia Ballet Dancer Brooch For Women Sparkling Crystal Angel Girl Lapel Pin Jewelry Accessory Gift
Elegant Copper Zirconia Ballet Dancer Brooch For Women Sparkling Crystal Angel Girl Lapel Pin Jewelry Accessory Gift
like
Find Similar
Elegant silver ballet dancer brooch with sparkling cubic zirconia on luxury jewelry box - Silver
Elegant gold-plated ballet dancer brooch featuring sparkling cubic zirconia crystals - Gold
Elegant Copper Zirconia Ballet Dancer Brooch For Women Sparkling Crystal Angel Girl Lapel Pin Jewelry Accessory Gift
-9%
$5.71
Mix MOQ : 2
Free Shipping
Luxury Copper Heart Angel Wings Brooch With Zirconia Inlaid Micro-pave Heart Wing Corsage Pin For Women Fashion Jewelry
Luxury Copper Heart Angel Wings Brooch With Zirconia Inlaid Micro-pave Heart Wing Corsage Pin For Women Fashion Jewelry
like
Find Similar
Elegant wing and heart zircon brooch with red gemstone and drop pendant measurements - Red
Close-up of angel wings heart brooch with opal-like stone and pear-shaped drop pendant - White
Luxury Copper Heart Angel Wings Brooch With Zirconia Inlaid Micro-pave Heart Wing Corsage Pin For Women Fashion Jewelry
-9%
$3.98
Mix MOQ : 3
Free Shipping
Supernatural Impala Car Enamel Pin Angel Wings KAZ 2Y5 License Plate Zinc Alloy Brooch Badge For Fan Gift Accessories
Supernatural Impala Car Enamel Pin Angel Wings KAZ 2Y5 License Plate Zinc Alloy Brooch Badge For Fan Gift Accessories
like
Find Similar
Vintage gold car enamel pin with angel figure and KAZ 2Y5 license plate badge - Vintage Car Angel Style (QHXZ4447)
Supernatural Impala Car Enamel Pin Angel Wings KAZ 2Y5 License Plate Zinc Alloy Brooch Badge For Fan Gift Accessories
-9%
$0.65
No MOQ
Cartoon Devil Dice Enamel Brooch Pin Devil Roll Dice Angel Roll Eyes Quote Alloy Badge For Backpack Clothing Decoration
Cartoon Devil Dice Enamel Brooch Pin Devil Roll Dice Angel Roll Eyes Quote Alloy Badge For Backpack Clothing Decoration
like
Find Similar
Enamel pin with winged dice and red devil featuring Devils Roll The Dice quote - Devil Dice Shape Brooch (QHXZ3116)
Cartoon Devil Dice Enamel Brooch Pin Devil Roll Dice Angel Roll Eyes Quote Alloy Badge For Backpack Clothing Decoration
-8%
$0.45
No MOQ
Free Shipping
Angel Wings Heart Rhinestone Artificial Pearl Brooch Elegant Alloy Zirconia Heart Pin For Women Wedding Banquet Jewelry
Angel Wings Heart Rhinestone Artificial Pearl Brooch Elegant Alloy Zirconia Heart Pin For Women Wedding Banquet Jewelry
like
Find Similar
Elegant angel wing heart crystal brooch with a pearl drop in silver finish - Angel Wings Heart Pearl Style (K1026)
Angel Wings Heart Rhinestone Artificial Pearl Brooch Elegant Alloy Zirconia Heart Pin For Women Wedding Banquet Jewelry
-20%
$4.38
No MOQ
Free Shipping
Vintage Art Nouveau Angel Wings Fairy Brooch For Women Matte Gold Hollow Design Alloy Metal Pin Jewelry Accessory
Vintage Art Nouveau Angel Wings Fairy Brooch For Women Matte Gold Hollow Design Alloy Metal Pin Jewelry Accessory
like
Find Similar
Retro matte gold angel wing brooch with elegant female figure and dragonfly wings in a circle - Matte Gold
Artistic gold angel wing fairy brooch with dragonfly wings in minimalist metal circle - Bright Gold
Vintage Art Nouveau Angel Wings Fairy Brooch For Women Matte Gold Hollow Design Alloy Metal Pin Jewelry Accessory
-9%
$0.68
Mix MOQ : 3
Vintage Alloy Angel Brooch Enamel Flower Rhinestone Lapel Pin For Women Clothing Coats Personalized Accessory Jewelry Gift
Vintage Alloy Angel Brooch Enamel Flower Rhinestone Lapel Pin For Women Clothing Coats Personalized Accessory Jewelry Gift
like
Find Similar
Macro shot of a vintage golden angel brooch with colorful enamel flowers and rhinestones - Gold
Macro shot of silver angel brooch with colorful enamel flowers and shimmering rhinestones - Silver
Vintage Alloy Angel Brooch Enamel Flower Rhinestone Lapel Pin For Women Clothing Coats Personalized Accessory Jewelry Gift
-9%
$1.31
Mix MOQ : 3
Free Shipping
Fairy Angel Brooch Alloy Enamel Wings Rhinestone Star Pendant Retro Elegant Vintage Pin Jewelry For Women
Fairy Angel Brooch Alloy Enamel Wings Rhinestone Star Pendant Retro Elegant Vintage Pin Jewelry For Women
like
Find Similar
Detail of fairy brooch with red enamel gradient wings and gold metal star decor - Red
Fairy Angel Brooch Alloy Enamel Wings Rhinestone Star Pendant Retro Elegant Vintage Pin Jewelry For Women
-9%
$2.62
No MOQ
Free Shipping
Seraphim Angel Enamel Pin Alloy Wings Heart Eye Lapel Badge Cartoon Mythical Brooch For Clothes Bag Women Men Jewelry
Seraphim Angel Enamel Pin Alloy Wings Heart Eye Lapel Badge Cartoon Mythical Brooch For Clothes Bag Women Men Jewelry
like
Find Similar
Anime-style enamel pin featuring wings, heart, and star in mint green and gold finish - Heart Wings Magic Style (xz9537)
Minimalist six-winged angel enamel pin in white and light blue with golden alloy frame - Six-Winged Angel Holy Style (xz9538)
Seraphim Angel Enamel Pin Alloy Wings Heart Eye Lapel Badge Cartoon Mythical Brooch For Clothes Bag Women Men Jewelry
-8%
$0.42
No MOQ
Gothic Mystical Enamel Alloy Brooch Pin With All-Seeing Eye And Angel Wings Cthulhu Style Cartoon Badge For Backpack Clothing Decor
Gothic Mystical Enamel Alloy Brooch Pin With All-Seeing Eye And Angel Wings Cthulhu Style Cartoon Badge For Backpack Clothing Decor
like
Find Similar
Cartoon Cthulhu angel enamel pin with golden border and mystic eye symbol 5g - Mystical Eye Angel (XZ2954)
Gothic Mystical Enamel Alloy Brooch Pin With All-Seeing Eye And Angel Wings Cthulhu Style Cartoon Badge For Backpack Clothing Decor
-9%
$0.73
Mix MOQ : 2
Free Shipping
Vintage Angel Wings Enamel Brooch For Women Gold Plated Alloy Artificial Pearl Zirconia Rhinestone Exquisite Pin For Suit Blazer Wedding Party Jewelry
Vintage Angel Wings Enamel Brooch For Women Gold Plated Alloy Artificial Pearl Zirconia Rhinestone Exquisite Pin For Suit Blazer Wedding Party Jewelry
like
Find Similar
Elegant angel wing brooch with enamel coating, pearl center and a teardrop crystal - Enamel Angel Wings Brooch (DR017-A)
Vintage Angel Wings Enamel Brooch For Women Gold Plated Alloy Artificial Pearl Zirconia Rhinestone Exquisite Pin For Suit Blazer Wedding Party Jewelry
-9%
$1.44
Mix MOQ : 3
Free Shipping
Minimalist Alloy Enamel Angel Brooch For Men Women Creative Fashion Rhinestone Drip Oil Badge Clothing Accessories Pin Jewelry
Minimalist Alloy Enamel Angel Brooch For Men Women Creative Fashion Rhinestone Drip Oil Badge Clothing Accessories Pin Jewelry
like
Find Similar
Detailed macro view of angel brooch with golden wings, red enamel dress and rhinestones - Gold
Macro detail of gunmetal angel brooch with black enamel inlay and sparkling crystals - Black
Minimalist Alloy Enamel Angel Brooch For Men Women Creative Fashion Rhinestone Drip Oil Badge Clothing Accessories Pin Jewelry
-9%
$1.70
No MOQ
Free Shipping
Ballerina Angel Fairy Brooch Pin Gold Plated Alloy White Rhinestone Crystal Elegant Dancing Girl Jewelry For Women Wedding Party
Ballerina Angel Fairy Brooch Pin Gold Plated Alloy White Rhinestone Crystal Elegant Dancing Girl Jewelry For Women Wedding Party
like
Find Similar
Macro shot of an elegant gold fairy brooch with sparkling white rhinestones on black - Ballet Dancer / White
Ballerina Angel Fairy Brooch Pin Gold Plated Alloy White Rhinestone Crystal Elegant Dancing Girl Jewelry For Women Wedding Party
-9%
$1.38
Mix MOQ : 2
Free Shipping
Baroque Vintage Angel Tassel Brooch Gold Alloy Red Gemstone Cupid Corsage Pin For Women Retro Palace Style Jewelry Gift
Baroque Vintage Angel Tassel Brooch Gold Alloy Red Gemstone Cupid Corsage Pin For Women Retro Palace Style Jewelry Gift
like
Find Similar
Baroque golden cupid brooch with red gemstone and heart-shaped fringe tassels - Heart Red Bead Angel Tassel Brooch
Baroque Vintage Angel Tassel Brooch Gold Alloy Red Gemstone Cupid Corsage Pin For Women Retro Palace Style Jewelry Gift
-8%
$1.32
No MOQ
Elegant Angel Letter Tassel Brooch Gold Plated Alloy Rhinestone Heart Butterfly Pin For Women Wedding Banquet Party Jewelry
Elegant Angel Letter Tassel Brooch Gold Plated Alloy Rhinestone Heart Butterfly Pin For Women Wedding Banquet Party Jewelry
like
Find Similar
Golden Angel letter brooch with sparkling heart, butterfly charms and tassel chains - Gold Angel Tassel (X0596)
NewElegant Angel Letter Tassel Brooch Gold Plated Alloy Rhinestone Heart Butterfly Pin For Women Wedding Banquet Party Jewelry
-7%
$0.58
No MOQ
Vintage Alloy Angel Brooch For Women Antique Gold Silver Color Cherub Brooch Pin Retro Fashion Clothing Accessory Jewelry
Vintage Alloy Angel Brooch For Women Antique Gold Silver Color Cherub Brooch Pin Retro Fashion Clothing Accessory Jewelry
like
Find Similar
Vintage silver-plated brooch featuring six little angels in relief on white background - Antique Silver (C633-B)
Vintage bronze angel brooch with intricate carvings for elegant coat decoration - Antique Gold (C633-A)
Vintage Alloy Angel Brooch For Women Antique Gold Silver Color Cherub Brooch Pin Retro Fashion Clothing Accessory Jewelry
-9%
$0.73
Mix MOQ : 3
Fashion Alloy Rhinestone Heart Letter Brooch With Angel Cupid Design Romantic Gold Silver Inlaid Pin For Women Apparel Jewelry
Fashion Alloy Rhinestone Heart Letter Brooch With Angel Cupid Design Romantic Gold Silver Inlaid Pin For Women Apparel Jewelry
like
Find Similar
Silver-tone Heart brooch with Cupid motif and clear rhinestones for clothing accessory - Heart Letter Style (MM-BR-3933-SL) / Silver
Golden cupid and heart brooch with white rhinestones, size 5.2cm by 2.8cm, 7g weight - Heart Letter Style (MM-BR-3933-GD) / Gold
Fashion Alloy Rhinestone Heart Letter Brooch With Angel Cupid Design Romantic Gold Silver Inlaid Pin For Women Apparel Jewelry
-9%
$1.44
No MOQ
Free Shipping
Elegant Rose Gold Wing Feather Brooch For Women With Rhinestones And Artificial Pearl Sparkling Angel Wing Lapel Pin Fashion Jewelry Accessories
Elegant Rose Gold Wing Feather Brooch For Women With Rhinestones And Artificial Pearl Sparkling Angel Wing Lapel Pin Fashion Jewelry Accessories
like
Find Similar
Rose gold angel wing brooch with sparkling rhinestones and a white pearl pendant - White
Elegant Rose Gold Wing Feather Brooch For Women With Rhinestones And Artificial Pearl Sparkling Angel Wing Lapel Pin Fashion Jewelry Accessories
-9%
$2.59
Mix MOQ : 3
Vintage Art Nouveau Angel Fairy Brooch With Colorful Enamel Wings Rhinestones Faux Artificial Pearl Gold Tone Alloy Lapel Pin For Women
Vintage Art Nouveau Angel Fairy Brooch With Colorful Enamel Wings Rhinestones Faux Artificial Pearl Gold Tone Alloy Lapel Pin For Women
like
Find Similar
Art Nouveau style angel brooch with colorful enamel wings and a hanging white pearl - Vintage Enamel Angel (B170-A)
Vintage Art Nouveau Angel Fairy Brooch With Colorful Enamel Wings Rhinestones Faux Artificial Pearl Gold Tone Alloy Lapel Pin For Women
-8%
$1.52
Mix MOQ : 3
Free Shipping
Cartoon Angel Cat Holding Red Heart Enamel Pin Brooch With Wings Alloy Badge For Women Bag Clothing Decorative Jewelry
Cartoon Angel Cat Holding Red Heart Enamel Pin Brooch With Wings Alloy Badge For Women Bag Clothing Decorative Jewelry
like
Find Similar
Cartoon winged cat holding red heart on blue cloud enamel brooch for bags - Angel Cat Holding Red Heart Style (XZ1607)
Cartoon Angel Cat Holding Red Heart Enamel Pin Brooch With Wings Alloy Badge For Women Bag Clothing Decorative Jewelry
-8%
$0.34
Mix MOQ : 2
Free Shipping
Vintage Angel Wings Crown Brooch Alloy Artificial Pearl Rhinestone Palace Style Elegant Clothing Pin For Bride Wedding Women Jewelry
Vintage Angel Wings Crown Brooch Alloy Artificial Pearl Rhinestone Palace Style Elegant Clothing Pin For Bride Wedding Women Jewelry
like
Find Similar
Golden crown brooch with angel wings, white pearls and sparkling rhinestones on white background - Golden Crown Wings (AL831-A)
Vintage Angel Wings Crown Brooch Alloy Artificial Pearl Rhinestone Palace Style Elegant Clothing Pin For Bride Wedding Women Jewelry
-9%
$0.97
Mix MOQ : 3
Elegant Alloy Angel Wings Brooch For Women Artificial Pearl Rhinestone Inlaid Fashion Suit Accessory Pins Jewelry
Elegant Alloy Angel Wings Brooch For Women Artificial Pearl Rhinestone Inlaid Fashion Suit Accessory Pins Jewelry
like
Find Similar
Detail view of pearl angel wing brooch with precise dimensions 5.2cm by 4.6cm - Silver
Elegant angel wing brooch with pearls and rhinestones on gold base, sized 5.2x4.6cm - 14K Gold
Elegant Alloy Angel Wings Brooch For Women Artificial Pearl Rhinestone Inlaid Fashion Suit Accessory Pins Jewelry
-9%
$1.44
No MOQ
Free Shipping
Elegant Angel Wing Pearl Brooch For Women Gold Color Plastic Rhinestone Artificial Pearl Tassel Pin Accessory Fashion Jewelry
Elegant Angel Wing Pearl Brooch For Women Gold Color Plastic Rhinestone Artificial Pearl Tassel Pin Accessory Fashion Jewelry
like
Find Similar
Elegant gold angel wing brooch with sparkling crystals and a white pearl pendant - Gold Wing Pearl Tassel Style
Elegant Angel Wing Pearl Brooch For Women Gold Color Plastic Rhinestone Artificial Pearl Tassel Pin Accessory Fashion Jewelry
-7%
$0.58
No MOQ
Luxury Alloy Rhinestone Christmas Brooch Collection For Women Merry Christmas Tree Snowman Angel Stocking Enamel Lapel Pin Gift
Luxury Alloy Rhinestone Christmas Brooch Collection For Women Merry Christmas Tree Snowman Angel Stocking Enamel Lapel Pin Gift
like
Find Similar
Three-piece Christmas brooch set with rhinestone angel, holiday stocking, and xmas tree - Antique KC Gold
Luxury Alloy Rhinestone Christmas Brooch Collection For Women Merry Christmas Tree Snowman Angel Stocking Enamel Lapel Pin Gift
-9%
$5.50
No MOQ
Free Shipping
Vintage Alloy Angel Wing Brooch For Women Elegant 18K Gold Plated Rhinestone Feather Corset Suit Pin Jewelry Accessory
Vintage Alloy Angel Wing Brooch For Women Elegant 18K Gold Plated Rhinestone Feather Corset Suit Pin Jewelry Accessory
like
Find Similar
Vintage gold angel wing brooch with sparkling white rhinestones for elegant suits - Golden Angel Wing Style (FG012-A)
Vintage Alloy Angel Wing Brooch For Women Elegant 18K Gold Plated Rhinestone Feather Corset Suit Pin Jewelry Accessory
-13%
$1.37
Mix MOQ : 3
Elegant Angel Girl Long Dress Rhinestone Brooch Pin Silver Zinc Alloy Rose Flower Hollow Out Suit Coat Jewelry For Women
Elegant Angel Girl Long Dress Rhinestone Brooch Pin Silver Zinc Alloy Rose Flower Hollow Out Suit Coat Jewelry For Women
like
Find Similar
Elegant silver angel lady brooch with hollowed floral skirt and sparkling rhinestones - Silver
Elegant Angel Girl Long Dress Rhinestone Brooch Pin Silver Zinc Alloy Rose Flower Hollow Out Suit Coat Jewelry For Women
-13%
$1.49
Mix MOQ : 2
Retro Alloy Angel Heart Enamel Brooch Pin For Valentine's Day Wedding Party Unisex Wings Cupid Red Heart Lapel Pin Accessory
Retro Alloy Angel Heart Enamel Brooch Pin For Valentine's Day Wedding Party Unisex Wings Cupid Red Heart Lapel Pin Accessory
like
Find Similar
Vintage gold angel heart brooch with red enamel wings including dimension details - Antique Gold
Close-up showing dimensions of vintage cupid angel heart brooch in silver alloy - Antique Silver
Retro Alloy Angel Heart Enamel Brooch Pin For Valentine's Day Wedding Party Unisex Wings Cupid Red Heart Lapel Pin Accessory
-9%
$1.31
No MOQ
Free Shipping
Elegant Angel Wing Brooch With Large Round Zircon Gold Plated Copper Feather Pin For Women Wedding Party Office Jewelry
Elegant Angel Wing Brooch With Large Round Zircon Gold Plated Copper Feather Pin For Women Wedding Party Office Jewelry
like
Find Similar
Elegant gold wing brooch with pavé zircon feathers and a central sparkling crystal stone - Angel Wings Style (TD042)
Elegant Angel Wing Brooch With Large Round Zircon Gold Plated Copper Feather Pin For Women Wedding Party Office Jewelry
-13%
$2.47
No MOQ
Free Shipping
Go to

More in accessories

Explore more in angel pins

alloyartificial pearlheartgirleyepartyshapedecorativedesignphone
goldsuitinlaidstylewhitemetalkidsplated rhinestonegold plated rhinestonecopper

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access