Everful

Wholesale art posters

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Art Posters

Find the perfect pieces: wall stickers, window stickers, kitchen stickers and more

All products in art posters

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Coffee Time Wall Stickers Watercolor Coffee Cup Bean PVC Decorative Decal For Cafe Kitchen Home Living Room Wall Decor
Coffee Time Wall Stickers Watercolor Coffee Cup Bean PVC Decorative Decal For Cafe Kitchen Home Living Room Wall Decor
like
Find Similar
Creative coffee time wall sticker featuring steaming cup and beans for kitchen decor - Coffee (PH-QT9091)
Coffee Time Wall Stickers Watercolor Coffee Cup Bean PVC Decorative Decal For Cafe Kitchen Home Living Room Wall Decor
$0.78
No MOQ
Creative Quote Always Kiss Me Goodnight Wall Sticker PVC Removable DIY Heart Mural Art Decal For Bedroom Home Decor
Creative Quote Always Kiss Me Goodnight Wall Sticker PVC Removable DIY Heart Mural Art Decal For Bedroom Home Decor
like
Find Similar
Flat layout showing size specifications for Always Kiss Me Goodnight wall sticker - 19*45CM
Creative Quote Always Kiss Me Goodnight Wall Sticker PVC Removable DIY Heart Mural Art Decal For Bedroom Home Decor
$0.63
No MOQ
Valentine's Day Love Heart Wall Sticker Creative Die Cut PVC Removable Wall Decal For Living Room Bedroom Romantic Home Decor
Valentine's Day Love Heart Wall Sticker Creative Die Cut PVC Removable Wall Decal For Living Room Bedroom Romantic Home Decor
like
Find Similar
2 options
NewValentine's Day Love Heart Wall Sticker Creative Die Cut PVC Removable Wall Decal For Living Room Bedroom Romantic Home Decor
$1.44
No MOQ
Halloween Spooky Vibes Wall Sticker Black PVC Bat Star Removable Decal For Living Room Bedroom Holiday Party Decor
Halloween Spooky Vibes Wall Sticker Black PVC Bat Star Removable Decal For Living Room Bedroom Holiday Party Decor
like
Find Similar
Spooky Vibes Halloween wall sticker with bats and stars in black PVC material - Spooky Vibes Typography (PD385) / PD385/30*60
NewHalloween Spooky Vibes Wall Sticker Black PVC Bat Star Removable Decal For Living Room Bedroom Holiday Party Decor
$1.21
Mix MOQ : 4
Soccer World Cup Theme Static Window Stickers PVC Watercolor Graffiti Football Player Silhouette Goal Wall Decor For Home Office Fans
Soccer World Cup Theme Static Window Stickers PVC Watercolor Graffiti Football Player Silhouette Goal Wall Decor For Home Office Fans
like
Find Similar
Detailed size specifications for soccer theme graffiti window stickers and dimensions - Square Combo Set / Soccer World Cup Theme
Soccer World Cup Theme Static Window Stickers PVC Watercolor Graffiti Football Player Silhouette Goal Wall Decor For Home Office Fans
-5%
$1.86
No MOQ
Gamer Loading Progress Bar Battery Wall Sticker PVC Modern Minimalist Decorative Decal For Living Room Bedroom Game Room
Gamer Loading Progress Bar Battery Wall Sticker PVC Modern Minimalist Decorative Decal For Living Room Bedroom Game Room
like
Find Similar
Macro detail of LOADING progress bar wall decal in 50cm size for home decoration - 10*50cm
Gamer Loading Progress Bar Battery Wall Sticker PVC Modern Minimalist Decorative Decal For Living Room Bedroom Game Room
$0.58
No MOQ
Creative Music Vinyl Record Wall Stickers PVC Self Adhesive Multicolored Retro Room Decor Artistic Musical Wall Decals
Creative Music Vinyl Record Wall Stickers PVC Self Adhesive Multicolored Retro Room Decor Artistic Musical Wall Decals
like
Find Similar
Retro vinyl record wall stickers in five colors for music-themed home decor 24.5cm - 24.5*24.5cm
Creative Music Vinyl Record Wall Stickers PVC Self Adhesive Multicolored Retro Room Decor Artistic Musical Wall Decals
$1.44
No MOQ
Baseball Sports Theme Wall Stickers Waterproof PVC Decal For Bedroom Living Room Game Day Hit Hard Run Fast Home Decor
Baseball Sports Theme Wall Stickers Waterproof PVC Decal For Bedroom Living Room Game Day Hit Hard Run Fast Home Decor
like
Find Similar
Detail of baseball wall sticker featuring hitter illustration and Hit Hard Run Fast text - Style A (KSY265A)
Detailed size chart for baseball-themed wall sticker showing 40cm dimensions and Game Day art - Style B (KSY265B)
Detailed dimensions of the Game Day baseball wall sticker with bat and ball graphics - Style C (KSY265C)
Detail showing 40cm Pitches Be Crazy baseball wall decal sticker with bats and balls - Style D (KSY265D)
+2
Baseball Sports Theme Wall Stickers Waterproof PVC Decal For Bedroom Living Room Game Day Hit Hard Run Fast Home Decor
$1.10
No MOQ
Watercolor Elephant Family Wall Stickers PVC Self Adhesive Removable Decals For Nursery Kids Bedroom Home Decor
Watercolor Elephant Family Wall Stickers PVC Self Adhesive Removable Decals For Nursery Kids Bedroom Home Decor
like
Find Similar
Elephant wall sticker showing paste effect and layout size for home decoration - Elephant Family (SC408)
Watercolor Elephant Family Wall Stickers PVC Self Adhesive Removable Decals For Nursery Kids Bedroom Home Decor
$1.38
Mix MOQ : 4
Halloween Horror Bat And Spider Wall Stickers PVC Self-Adhesive Decals For Party Living Room Home Decoration
Halloween Horror Bat And Spider Wall Stickers PVC Self-Adhesive Decals For Party Living Room Home Decoration
like
Find Similar
Halloween wall sticker size guide showing black bat and spider decals dimensions - Spider Bat Purple
Halloween Horror Bat And Spider Wall Stickers PVC Self-Adhesive Decals For Party Living Room Home Decoration
-5%
$0.90
No MOQ
Valentine's Day Romantic Kissing Couple Wall Sticker PVC Self-Adhesive Removable Cartoon Heart Pattern Decal For Bedroom Home Decor
Valentine's Day Romantic Kissing Couple Wall Sticker PVC Self-Adhesive Removable Cartoon Heart Pattern Decal For Bedroom Home Decor
like
Find Similar
Cartoon boy and girl kissing wall decal with red hearts for romantic bedroom decor - Valentine Kissing Characters
Valentine's Day Romantic Kissing Couple Wall Sticker PVC Self-Adhesive Removable Cartoon Heart Pattern Decal For Bedroom Home Decor
$0.92
Mix MOQ : 4
Boho Morandi Rainbow Wall Stickers With Inspirational Affirmations Removable PVC Wall Decals For Kids Nursery Room Home Decor
Boho Morandi Rainbow Wall Stickers With Inspirational Affirmations Removable PVC Wall Decals For Kids Nursery Room Home Decor
like
Find Similar
Detailed size chart for rainbow wall sticker with motivational quotes in soft Morandi colors - 30x60cm (fun-b75)
Boho Morandi Rainbow Wall Stickers With Inspirational Affirmations Removable PVC Wall Decals For Kids Nursery Room Home Decor
$1.21
No MOQ
Halloween Party Wall Sticker Black Bat Silhouette PVC Self Adhesive Removable Decal For Living Room Kids Room Decoration
Halloween Party Wall Sticker Black Bat Silhouette PVC Self Adhesive Removable Decal For Living Room Kids Room Decoration
like
Find Similar
1 option
Halloween Party Wall Sticker Black Bat Silhouette PVC Self Adhesive Removable Decal For Living Room Kids Room Decoration
$1.87
No MOQ
Valentine's Day Bowknot Paw Prints Wall Stickers Red Heart Lips DIY PVC Decorative Decal For Bedroom Living Room Home Decor
Valentine's Day Bowknot Paw Prints Wall Stickers Red Heart Lips DIY PVC Decorative Decal For Bedroom Living Room Home Decor
like
Find Similar
Detail view of cartoon bow and paw stickers with sheet size dimensions in centimeters - 20*29cm/fun-f997
Valentine's Day Bowknot Paw Prints Wall Stickers Red Heart Lips DIY PVC Decorative Decal For Bedroom Living Room Home Decor
$0.72
No MOQ
Inspirational Butterfly Wall Sticker With Nothing Is Impossible Believe In Yourself Quote PVC Removable DIY Decal For Living Room
Inspirational Butterfly Wall Sticker With Nothing Is Impossible Believe In Yourself Quote PVC Removable DIY Decal For Living Room
like
Find Similar
Nothing is impossible wall sticker with butterflies for room decoration 70x40cm - Inspirational Quote with Butterfly / 15*57CM
Inspirational Butterfly Wall Sticker With Nothing Is Impossible Believe In Yourself Quote PVC Removable DIY Decal For Living Room
$0.95
Mix MOQ : 2
Motivational English Quotes Wall Sticker Removable PVC Decal For Office Study Living Room DIY Home Decor Wall Art
Motivational English Quotes Wall Sticker Removable PVC Decal For Office Study Living Room DIY Home Decor Wall Art
like
Find Similar
Detailed sizing chart for motivational book-themed wall decal measuring 60x35cm - 35*60cm
Motivational English Quotes Wall Sticker Removable PVC Decal For Office Study Living Room DIY Home Decor Wall Art
$1.30
No MOQ
Valentine's Day Removable PVC Wall Stickers Cartoon Cat Cupid Angel Heart Pattern Romantic Home Decor Mural For Bedroom
Valentine's Day Removable PVC Wall Stickers Cartoon Cat Cupid Angel Heart Pattern Romantic Home Decor Mural For Bedroom
like
Find Similar
Romantic Love XOXO wall stickers with pink watercolor hearts and floral elements - Love And XOXO Style (10Y44-D78)
Pink lips and checkered text heat transfer sticker for clothing decoration 40x40cm - Lips Kiss Me Style (10Y44-D79)
Cartoon cat angel wall sticker for 1st Valentine's Day in 40x40cm PVC layout - First Valentine Angel Style (10Y44-D80)
Cartoon angel cat wall decal with My Cat Is My Valentine text for bedroom decor - Cat Valentine Style (10Y44-D81)
Valentine's Day Removable PVC Wall Stickers Cartoon Cat Cupid Angel Heart Pattern Romantic Home Decor Mural For Bedroom
$1.18
Mix MOQ : 3
Valentine's Day Love Heart Wall Sticker PVC Minimalist Removable Art Decal For Living Room Bedroom Home Decor
Valentine's Day Love Heart Wall Sticker PVC Minimalist Removable Art Decal For Living Room Bedroom Home Decor
like
Find Similar
1 option
Valentine's Day Love Heart Wall Sticker PVC Minimalist Removable Art Decal For Living Room Bedroom Home Decor
$1.56
No MOQ
Beauty Profile Silhouette Wall Sticker Elegant Floral Vine Female Face Removable PVC Art Decal For Living Room Bedroom
Beauty Profile Silhouette Wall Sticker Elegant Floral Vine Female Face Removable PVC Art Decal For Living Room Bedroom
like
Find Similar
Elegant woman silhouette wall sticker with floral patterns for home wall decor - 30x60cm / Black
Beauty Profile Silhouette Wall Sticker Elegant Floral Vine Female Face Removable PVC Art Decal For Living Room Bedroom
$1.10
Mix MOQ : 4
Middle Eastern Ramadan Eid Kitchen Wall Sticker Teapot Fruit Pattern PVC Decorative Decal For Living Room Home Decor
Middle Eastern Ramadan Eid Kitchen Wall Sticker Teapot Fruit Pattern PVC Decorative Decal For Living Room Home Decor
like
Find Similar
Ramadan wall sticker size chart showing teapot and lantern motifs in 40x60cm layout - Teapot Fruit Style (FX-E299) / 40x60cm
NewMiddle Eastern Ramadan Eid Kitchen Wall Sticker Teapot Fruit Pattern PVC Decorative Decal For Living Room Home Decor
$1.44
No MOQ
Watercolor Unicorn Moon Star Wall Stickers For Kids Room Bedroom Decor PVC Removable Cartoon Animal Cloud Wall Decal
Watercolor Unicorn Moon Star Wall Stickers For Kids Room Bedroom Decor PVC Removable Cartoon Animal Cloud Wall Decal
like
Find Similar
1 option
Watercolor Unicorn Moon Star Wall Stickers For Kids Room Bedroom Decor PVC Removable Cartoon Animal Cloud Wall Decal
$1.27
Mix MOQ : 4
Gamer Game Controller Wall Sticker PVC Waterproof Removable Wall Decal For Living Room Bedroom Gaming Room Decor Black
Gamer Game Controller Wall Sticker PVC Waterproof Removable Wall Decal For Living Room Bedroom Gaming Room Decor Black
like
Find Similar
Dimensions of gamer wall sticker with game controller icons measuring 58cm by 20cm - 20*58cm
NewGamer Game Controller Wall Sticker PVC Waterproof Removable Wall Decal For Living Room Bedroom Gaming Room Decor Black
-5%
$0.52
No MOQ
Halloween Pumpkin Wizard Hat Wall Sticker PVC Removable Decal For Living Room Bedroom Kitchen Toilet Holiday Home Decor
Halloween Pumpkin Wizard Hat Wall Sticker PVC Removable Decal For Living Room Bedroom Kitchen Toilet Holiday Home Decor
like
Find Similar
Halloween wall sticker with pumpkin wizard hat and spider, self-adhesive PVC 40x30cm decal - Halloween Pumpkin Wizard Hat (M20036)
Halloween Pumpkin Wizard Hat Wall Sticker PVC Removable Decal For Living Room Bedroom Kitchen Toilet Holiday Home Decor
$1.01
Mix MOQ : 2
Coffee Theme Wall Decal PVC Heartbeat Love Coffee Cup Pattern Modern Minimalist Decorative Sticker For Kitchen Cafe Wall Art
Coffee Theme Wall Decal PVC Heartbeat Love Coffee Cup Pattern Modern Minimalist Decorative Sticker For Kitchen Cafe Wall Art
like
Find Similar
Detail view of Coffee Love wall sticker dimensions 60x20cm with heart and cup design - 20x60cm
Coffee Theme Wall Decal PVC Heartbeat Love Coffee Cup Pattern Modern Minimalist Decorative Sticker For Kitchen Cafe Wall Art
$0.84
No MOQ
Creative Ballet Girl Silhouette Wall Stickers PVC Waterproof Black Dancer Decals for Kids Room Bedroom Home Decor
Creative Ballet Girl Silhouette Wall Stickers PVC Waterproof Black Dancer Decals for Kids Room Bedroom Home Decor
like
Find Similar
1 option
NewCreative Ballet Girl Silhouette Wall Stickers PVC Waterproof Black Dancer Decals for Kids Room Bedroom Home Decor
-4%
$1.15
No MOQ
Believe In Yourself Quote Wall Sticker Inspirational Script Black PVC Removable Self Adhesive Art Decal For Home Office Bedroom Wall Decor
Believe In Yourself Quote Wall Sticker Inspirational Script Black PVC Removable Self Adhesive Art Decal For Home Office Bedroom Wall Decor
like
Find Similar
Minimalist Believe in yourself wall sticker in black artistic font for home office decor - Black Style (PH_QTB212)
NewBelieve In Yourself Quote Wall Sticker Inspirational Script Black PVC Removable Self Adhesive Art Decal For Home Office Bedroom Wall Decor
$0.78
No MOQ
Creative Retro Vinyl Record Space Theme Wall Stickers Cosmic Planet PVC Graffiti Decal For Bedroom Living Room Decor
Creative Retro Vinyl Record Space Theme Wall Stickers Cosmic Planet PVC Graffiti Decal For Bedroom Living Room Decor
like
Find Similar
Detailed size comparison of galaxy record wall stickers showing sheet and layout dimensions - Cosmic Starry Vinyl Record Style (PH_QTA490)
NewCreative Retro Vinyl Record Space Theme Wall Stickers Cosmic Planet PVC Graffiti Decal For Bedroom Living Room Decor
-11%
$1.65
No MOQ
Watercolor Space Astronaut Rocket Wall Stickers Waterproof PVC Decorative Decals For Kids Boys Room Nursery Home Decor
Watercolor Space Astronaut Rocket Wall Stickers Waterproof PVC Decorative Decals For Kids Boys Room Nursery Home Decor
like
Find Similar
Space astronaut wall decal with rocket and moon elements for kids bedroom decor - Space Adventure Watercolor Style (YB651)
Watercolor Space Astronaut Rocket Wall Stickers Waterproof PVC Decorative Decals For Kids Boys Room Nursery Home Decor
$2.16
Mix MOQ : 4
Modern PVC Wall Sticker Mountain Forest Cycling Silhouette Black Decorative Wall Decals For Home Office Bedroom Decor
Modern PVC Wall Sticker Mountain Forest Cycling Silhouette Black Decorative Wall Decals For Home Office Bedroom Decor
like
Find Similar
Detail showing dimensions and layout of the mountain bike forest wall sticker - 35x60cm
NewModern PVC Wall Sticker Mountain Forest Cycling Silhouette Black Decorative Wall Decals For Home Office Bedroom Decor
$1.21
No MOQ
Inspirational English Quote Wall Sticker PVC Removable Life Lettering Decal With Heart Floral Pattern For Living Room Bedroom Decor
Inspirational English Quote Wall Sticker PVC Removable Life Lettering Decal With Heart Floral Pattern For Living Room Bedroom Decor
like
Find Similar
Detail showing Life is Beautiful wall sticker layout and dimensions 40x60cm - 40x60cm
Inspirational English Quote Wall Sticker PVC Removable Life Lettering Decal With Heart Floral Pattern For Living Room Bedroom Decor
-4%
$1.37
No MOQ
Halloween Spooky Black Cat Silhouette Wall Sticker PVC Self-Adhesive Gothic Cat Decal For Bedroom Living Room Home Decor
Halloween Spooky Black Cat Silhouette Wall Sticker PVC Self-Adhesive Gothic Cat Decal For Bedroom Living Room Home Decor
like
Find Similar
Halloween scary cat wall sticker, self-adhesive black devil cat silhouette decor - Large Size (KST-60) / Black
NewHalloween Spooky Black Cat Silhouette Wall Sticker PVC Self-Adhesive Gothic Cat Decal For Bedroom Living Room Home Decor
$1.04
Mix MOQ : 4
Her Vibe Is Pretty English Slogan Wall Sticker With Black Butterflies Removable PVC DIY Wall Decal For Bedroom Home Decor
Her Vibe Is Pretty English Slogan Wall Sticker With Black Butterflies Removable PVC DIY Wall Decal For Bedroom Home Decor
like
Find Similar
Black vinyl wall decal featuring Her vibe is pretty quote with butterfly accents - 20x60cm
Her Vibe Is Pretty English Slogan Wall Sticker With Black Butterflies Removable PVC DIY Wall Decal For Bedroom Home Decor
$1.01
Mix MOQ : 2
Boho Watercolor Rainbow Heart Wall Stickers For Kids Room Nursery Removable PVC Decorative Decals For Bedroom Home Decor
Boho Watercolor Rainbow Heart Wall Stickers For Kids Room Nursery Removable PVC Decorative Decals For Bedroom Home Decor
like
Find Similar
Detailed view of watercolor rainbow wall stickers showing received size and layout dimensions - Watercolor Rainbow Heart (HY-B093)
Boho Watercolor Rainbow Heart Wall Stickers For Kids Room Nursery Removable PVC Decorative Decals For Bedroom Home Decor
$1.15
No MOQ
Valentine's Day Cupid Heart Wall Stickers PVC Self Adhesive Decals For Bedroom Living Room Romantic Home Decoration
Valentine's Day Cupid Heart Wall Stickers PVC Self Adhesive Decals For Bedroom Living Room Romantic Home Decoration
like
Find Similar
Cupid angel Valentine's Day wall sticker with red hearts and gold stars 40x30cm - Cartoon Cupid Style (ZA303_30*60)
Valentine's Day red Cupid silhouettes and heart wall stickers decoration kit - Red Silhouette Cupid Style (ZA302_30*60)
NewValentine's Day Cupid Heart Wall Stickers PVC Self Adhesive Decals For Bedroom Living Room Romantic Home Decoration
$1.04
No MOQ
Boho Rainbow Affirmations Wall Decals For Kids Nursery Bedroom PVC Positive Quotes Removable Wall Stickers Home Decor
Boho Rainbow Affirmations Wall Decals For Kids Nursery Bedroom PVC Positive Quotes Removable Wall Stickers Home Decor
like
Find Similar
Rainbow wall sticker in Morandi colors with inspirational phrases like I AM KIND - Rainbow (PC875-M)
NewBoho Rainbow Affirmations Wall Decals For Kids Nursery Bedroom PVC Positive Quotes Removable Wall Stickers Home Decor
$1.79
Mix MOQ : 4
Creative Black Gorilla Wall Sticker PVC Self Adhesive Removable Decal For Home Living Room Bedroom Artistic Animal Wall Decor
Creative Black Gorilla Wall Sticker PVC Self Adhesive Removable Decal For Home Living Room Bedroom Artistic Animal Wall Decor
like
Find Similar
Size guide for creative gorilla wall sticker showing layout and finished dimensions - Gorilla
Creative Black Gorilla Wall Sticker PVC Self Adhesive Removable Decal For Home Living Room Bedroom Artistic Animal Wall Decor
-4%
$0.99
No MOQ
Motivational Quote Be Your Own Kind Of Beautiful Wall Sticker Black Hand Drawn Heart PVC DIY Home Decor Mural Decal
Motivational Quote Be Your Own Kind Of Beautiful Wall Sticker Black Hand Drawn Heart PVC DIY Home Decor Mural Decal
like
Find Similar
Black handwritten wall sticker featuring be your own kind of beautiful with heart motif - Motivational Quote Style (PH_QTB184)
NewMotivational Quote Be Your Own Kind Of Beautiful Wall Sticker Black Hand Drawn Heart PVC DIY Home Decor Mural Decal
$0.75
No MOQ
Cartoon Owl Coffee Cup Wall Sticker Removable PVC Decorative Mural For Kids Room Bedroom Kitchen Cafe Home Wall Decor
Cartoon Owl Coffee Cup Wall Sticker Removable PVC Decorative Mural For Kids Room Bedroom Kitchen Cafe Home Wall Decor
like
Find Similar
1 option
Cartoon Owl Coffee Cup Wall Sticker Removable PVC Decorative Mural For Kids Room Bedroom Kitchen Cafe Home Wall Decor
$0.92
Mix MOQ : 2
Heart Wall Stickers PVC Removable Morandi Earth Tones Minimalist Hand Drawn Heart Decals For Kids Nursery Bedroom Decor
Heart Wall Stickers PVC Removable Morandi Earth Tones Minimalist Hand Drawn Heart Decals For Kids Nursery Bedroom Decor
like
Find Similar
Detail showing Morandi earth tone heart wall decals with dimension markings - 20x30cm x 2 Sheets Layout
Heart Wall Stickers PVC Removable Morandi Earth Tones Minimalist Hand Drawn Heart Decals For Kids Nursery Bedroom Decor
$0.62
No MOQ
Artistic Baseball Player Splatter Art PVC Wall Sticker Colorful Athlete Silhouette Decal For Bedroom Living Room Home Decor
Artistic Baseball Player Splatter Art PVC Wall Sticker Colorful Athlete Silhouette Decal For Bedroom Living Room Home Decor
like
Find Similar
Detailed size chart for baseball player silhouette wall sticker measuring 60x40cm with splatter art - 40*60CM/fun-e29
Artistic Baseball Player Splatter Art PVC Wall Sticker Colorful Athlete Silhouette Decal For Bedroom Living Room Home Decor
$1.44
No MOQ
Watercolor Elephant Star Wall Sticker For Nursery Kids Room Sweet Quote PVC Removable Home Decoration Background Mural
Watercolor Elephant Star Wall Sticker For Nursery Kids Room Sweet Quote PVC Removable Home Decoration Background Mural
like
Find Similar
Watercolor elephant and stars wall stickers for kids nursery bedroom decor, 120x60cm - Watercolor Elephant Family
Watercolor Elephant Star Wall Sticker For Nursery Kids Room Sweet Quote PVC Removable Home Decoration Background Mural
$1.79
Mix MOQ : 2
Vintage Camera Sunflower Wall Sticker FOCUS On The Good Watercolor Floral PVC Decal For Living Room Bedroom Home Decor
Vintage Camera Sunflower Wall Sticker FOCUS On The Good Watercolor Floral PVC Decal For Living Room Bedroom Home Decor
like
Find Similar
Floral camera wall sticker with Focus on the Good text in watercolor style for home decor - 30*90cm*2pcs (No Bag)
Vintage Camera Sunflower Wall Sticker FOCUS On The Good Watercolor Floral PVC Decal For Living Room Bedroom Home Decor
$1.87
Mix MOQ : 2
Romantic Red Kissing Lips And Heart PVC Wall Sticker Self Adhesive Waterproof DIY Art Mural For Bedroom Valentine's Day Decor
Romantic Red Kissing Lips And Heart PVC Wall Sticker Self Adhesive Waterproof DIY Art Mural For Bedroom Valentine's Day Decor
like
Find Similar
Detailed view of red lips and hearts wall sticker showing sheet size 60cm x 30cm - 30*60cm
Romantic Red Kissing Lips And Heart PVC Wall Sticker Self Adhesive Waterproof DIY Art Mural For Bedroom Valentine's Day Decor
$1.21
No MOQ
Monthly Planner Wall Sticker Blackboard Decal This Month Removable PVC Chalkboard Grid Wall Sticker For Home Office Classroom
Monthly Planner Wall Sticker Blackboard Decal This Month Removable PVC Chalkboard Grid Wall Sticker For Home Office Classroom
like
Find Similar
2 options
Monthly Planner Wall Sticker Blackboard Decal This Month Removable PVC Chalkboard Grid Wall Sticker For Home Office Classroom
$1.73
No MOQ
Rainbow Wall Sticker PVC Hand Painted Style Self Adhesive Removable Decal For Nursery Kids Room Bedroom Home Decor
Rainbow Wall Sticker PVC Hand Painted Style Self Adhesive Removable Decal For Nursery Kids Room Bedroom Home Decor
like
Find Similar
Detailed size specification for rainbow wall sticker measuring 60cm by 35cm with FX-E223 code - 35*60cm
Rainbow Wall Sticker PVC Hand Painted Style Self Adhesive Removable Decal For Nursery Kids Room Bedroom Home Decor
-4%
$1.15
No MOQ
Be Your Own Kind Of Beautiful Quote Wall Sticker Black PVC Removable Inspirational Lettering For Bedroom Living Room Home Decor
Be Your Own Kind Of Beautiful Quote Wall Sticker Black PVC Removable Inspirational Lettering For Bedroom Living Room Home Decor
like
Find Similar
Be Your Own Kind of Beautiful wall sticker in black PVC with size dimensions - CTX4006 / 15*60cm (No Bag)
Be Your Own Kind Of Beautiful Quote Wall Sticker Black PVC Removable Inspirational Lettering For Bedroom Living Room Home Decor
$0.78
Mix MOQ : 2
Modern Minimalist PVC Waterproof Eye Wall Sticker With Butterfly Floral Patterns Inspirational Quote Wall Mural Decor
Modern Minimalist PVC Waterproof Eye Wall Sticker With Butterfly Floral Patterns Inspirational Quote Wall Mural Decor
like
Find Similar
Beauty quotes wall decal with female eyes and butterflies for bedroom home decor - Artistic Eyes and Inspirational Quote (PH-QT1038)
Modern Minimalist PVC Waterproof Eye Wall Sticker With Butterfly Floral Patterns Inspirational Quote Wall Mural Decor
-5%
$1.04
No MOQ
German Quote Liebe Ist Removable Waterproof PVC Wall Sticker Heart Home Decor For Living Room Bedroom Black Decal
German Quote Liebe Ist Removable Waterproof PVC Wall Sticker Heart Home Decor For Living Room Bedroom Black Decal
like
Find Similar
2 options
German Quote Liebe Ist Removable Waterproof PVC Wall Sticker Heart Home Decor For Living Room Bedroom Black Decal
$1.01-4.03
No MOQ
Morandi Color Irregular Pebble Wall Stickers Removable PVC Terrazzo Style Wall Decals For Bedroom Living Room Home Decor
Morandi Color Irregular Pebble Wall Stickers Removable PVC Terrazzo Style Wall Decals For Bedroom Living Room Home Decor
like
Find Similar
Morandi colorful terrazzo dot wall stickers showing layout and paste effect dimensions - Morandi Irregular Pebble Style (FX-D161) / 30x90cm
Morandi Color Irregular Pebble Wall Stickers Removable PVC Terrazzo Style Wall Decals For Bedroom Living Room Home Decor
$1.38
Mix MOQ : 4
Lashes and Brows Wall Decal Eye Lash Eyebrow Wall Sticker Waterproof PVC Vinyl Art Mural For Beauty Salon Bedroom Home Decor
Lashes and Brows Wall Decal Eye Lash Eyebrow Wall Sticker Waterproof PVC Vinyl Art Mural For Beauty Salon Bedroom Home Decor
like
Find Similar
Detailed view of Lashes and Brows wall sticker showing 60cm x 40cm dimensions - 40*60cm
Lashes and Brows Wall Decal Eye Lash Eyebrow Wall Sticker Waterproof PVC Vinyl Art Mural For Beauty Salon Bedroom Home Decor
$1.44
No MOQ
Pink Light Bulb Wall Sticker Retro Hand Painted PVC Decorative Decal For Bedroom Living Room Modern Home Decor Wall Art
Pink Light Bulb Wall Sticker Retro Hand Painted PVC Decorative Decal For Bedroom Living Room Modern Home Decor Wall Art
like
Find Similar
Pink light bulb wall stickers for festive decor showing paste effect and layout size - 30x30 / Pink
Pink Light Bulb Wall Sticker Retro Hand Painted PVC Decorative Decal For Bedroom Living Room Modern Home Decor Wall Art
$0.72
Mix MOQ : 4
Audio Mixer Console Wall Sticker Black PVC DIY Music Studio Decor Self Adhesive Level Meter Decal For Home Office Studio
Audio Mixer Console Wall Sticker Black PVC DIY Music Studio Decor Self Adhesive Level Meter Decal For Home Office Studio
like
Find Similar
Detailed size guide for DIY audio control wall decal showing layout and finished dimensions - 30x90cm (FX-D401)
Audio Mixer Console Wall Sticker Black PVC DIY Music Studio Decor Self Adhesive Level Meter Decal For Home Office Studio
$1.44
No MOQ
Retro Pixel Game Console Controller Wall Stickers Waterproof PVC Decorative Decals For Kids Room Gaming Space Decor
Retro Pixel Game Console Controller Wall Stickers Waterproof PVC Decorative Decals For Kids Room Gaming Space Decor
like
Find Similar
Detailed dimension layout of retro pixel game controller wall stickers 50x40cm - 40*50cm
Retro Pixel Game Console Controller Wall Stickers Waterproof PVC Decorative Decals For Kids Room Gaming Space Decor
-5%
$1.23
No MOQ
Nordic Geometric Triangle Wall Stickers PVC Removable Abstract Mountain Peak Design Inkjet Printing Wall Murals For Home Decor
Nordic Geometric Triangle Wall Stickers PVC Removable Abstract Mountain Peak Design Inkjet Printing Wall Murals For Home Decor
like
Find Similar
Detail of geometric triangle wall stickers in navy blue, teal, orange, and grey patterns - Geometric Triangle (FX82036) / 45*60cm*2pcs
Nordic Geometric Triangle Wall Stickers PVC Removable Abstract Mountain Peak Design Inkjet Printing Wall Murals For Home Decor
-4%
$1.92
No MOQ
Modern Minimalist Couple Kissing Artistic Line Art PVC Wall Sticker Removable Waterproof Decal For Living Room Bedroom Decor
Modern Minimalist Couple Kissing Artistic Line Art PVC Wall Sticker Removable Waterproof Decal For Living Room Bedroom Decor
like
Find Similar
Minimalist kiss couple vinyl wall sticker 60x52cm for modern home decor - Large Size
Modern Minimalist Couple Kissing Artistic Line Art PVC Wall Sticker Removable Waterproof Decal For Living Room Bedroom Decor
$2.31
No MOQ
Gamer Creative Wall Sticker Black PVC Graffiti Style Gaming Room Bedroom Decor DIY Waterproof Removable Wall Decal Art
Gamer Creative Wall Sticker Black PVC Graffiti Style Gaming Room Bedroom Decor DIY Waterproof Removable Wall Decal Art
like
Find Similar
Black GAMER wall decal with crack design, gaming room decor, size 58cm x 20cm - 57*20CM / Black
Gamer Creative Wall Sticker Black PVC Graffiti Style Gaming Room Bedroom Decor DIY Waterproof Removable Wall Decal Art
$0.86
No MOQ
Removable PVC Black Tree Photo Frame Wall Sticker DIY Botanical Tree Branch With Leaves Birds Home Decor For Living Room Bedroom
Removable PVC Black Tree Photo Frame Wall Sticker DIY Botanical Tree Branch With Leaves Birds Home Decor For Living Room Bedroom
like
Find Similar
1 option
Removable PVC Black Tree Photo Frame Wall Sticker DIY Botanical Tree Branch With Leaves Birds Home Decor For Living Room Bedroom
-5%
$1.23
No MOQ
Bohemian Multicolor Geometric Line Wall Sticker For Kids Room PVC Self Adhesive Rainbow Sun Nursery Kindergarten Decoration
Bohemian Multicolor Geometric Line Wall Sticker For Kids Room PVC Self Adhesive Rainbow Sun Nursery Kindergarten Decoration
like
Find Similar
Detailed size chart of Bohemian rainbow and sun wall stickers showing dimensions on sheet - Bohemian Sun Rainbow Style (UV26Y80206T_R) / 90*30cm
Bohemian Multicolor Geometric Line Wall Sticker For Kids Room PVC Self Adhesive Rainbow Sun Nursery Kindergarten Decoration
$1.87
Mix MOQ : 2
Astronaut Playing Guitar In Space Wall Sticker PVC Self Adhesive Removable Decal For Kids Bedroom Living Room Home Decor
Astronaut Playing Guitar In Space Wall Sticker PVC Self Adhesive Removable Decal For Kids Bedroom Living Room Home Decor
like
Find Similar
Detailed size specifications for astronaut playing guitar self-adhesive wall sticker - 39*45CM (HY-F149)
Astronaut Playing Guitar In Space Wall Sticker PVC Self Adhesive Removable Decal For Kids Bedroom Living Room Home Decor
$1.15
No MOQ
Watercolor Bow Wall Stickers For Girls Bedroom Nursery Decoration Bohemian Style Pink Purple Bowknot PVC Wall Decals
Watercolor Bow Wall Stickers For Girls Bedroom Nursery Decoration Bohemian Style Pink Purple Bowknot PVC Wall Decals
like
Find Similar
Boho pink bow wall stickers set with 8 sheets of 60 pieces for girls room decor - Pink Style (UV24Y12643T_T)
Detail view of 60pcs purple bow wall stickers in 8 sheets with watercolor and plaid patterns - Purple Style (UV24Y12008T_T)
Watercolor Bow Wall Stickers For Girls Bedroom Nursery Decoration Bohemian Style Pink Purple Bowknot PVC Wall Decals
$2.74
Mix MOQ : 2
Go to

More in home & kitchen

Explore more in art posters

wallhangingdecorativepolyestertasselsheartgirlsheadfacewoman
living roomkidsstylecardsdisplayframelessmagneticdesignsunparty

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access