Everful

Wholesale art posters

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Art Posters

Find the perfect pieces: wall stickers, window stickers, kitchen stickers and more

All products in art posters

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Zinc Alloy Beer Bottle Opener Keychain Portable Beverage Opener Key Ring With Multiple Charms Father's Day Gifts Party Accessory
Zinc Alloy Beer Bottle Opener Keychain Portable Beverage Opener Key Ring With Multiple Charms Father's Day Gifts Party Accessory
like
Find Similar
Portable metal beer bottle opener keychain with glass gem and beer-themed pendants - Sun Moon
Super Dad bottle opener keychain with beer mug and bottle charms in silver metal - Super Dad Comic
Detail view of Dad themed bottle opener keychain with beer charms and size measurements - Dad Pop Art
Silver Best Dad beer bottle opener keychain with charms and size dimensions shown - Best Dad
+9
Zinc Alloy Beer Bottle Opener Keychain Portable Beverage Opener Key Ring With Multiple Charms Father's Day Gifts Party Accessory
-8%
$0.92
Mix MOQ : 2
 · 
133 sold recently
Embroidered Cartoon Animal Patches For Clothing DIY Outdoor Adventure Landscape Iron On Patch For Bags Hats Decorative Accessories
Embroidered Cartoon Animal Patches For Clothing DIY Outdoor Adventure Landscape Iron On Patch For Bags Hats Decorative Accessories
like
Find Similar
Square motivational patch with 'HUMBLE BUT I'M STILL that girl' text and pink stars - Humble Girl Slogan Style (PE15427CT)
Embroidered Mexican patch with cactus, guitar and cocktail, 7.5cm x 5.7cm iron-on badge - Mexico Elements Style (PE15473CT)
Embroidered iced coffee patch with text COFFEE IS THE WD-40 OF ADULTHOOD 8.3cm - Coffee Slogan Style (PE15477CT)
Pink Play Ball baseball embroidery patch with 8cm checkered design for DIY clothing - Baseball Sports Style (PE15480CT)
+11
Embroidered Cartoon Animal Patches For Clothing DIY Outdoor Adventure Landscape Iron On Patch For Bags Hats Decorative Accessories
$0.36-0.98
Mix MOQ : 10
 · 
35 sold recently
Embroidered Patch Iron On Sewing Patch For Clothing DIY Applique Heart Dinosaur Animal Pattern Retro Punk Denim Patch
Embroidered Patch Iron On Sewing Patch For Clothing DIY Applique Heart Dinosaur Animal Pattern Retro Punk Denim Patch
like
Find Similar
Pop art style heart shaped embroidery patch with female faces, size 7.6x6.8cm - Pop Art Faces Heart Style (PE9204CT)
Close-up of robot dinosaur embroidery patch with dimensions showing 8.7x8.5cm details - Robot Riding Dinosaur Style (PE9205CT)
Embroidered Catch Meow cat patch with punk star motif for denim DIY projects - Cat Magic Circle Style (PE9206CT)
Butterfly embroidered iron-on patch with eye pattern and tiger texture, 7.2x6.5cm size - Eye Butterfly Style (PE9215CT)
+6
Embroidered Patch Iron On Sewing Patch For Clothing DIY Applique Heart Dinosaur Animal Pattern Retro Punk Denim Patch
$0.32-1.07
Mix MOQ : 10
Free Shipping
Punk Butterfly Skull Embroidery Patch Polyester Iron On Moth Patches For Clothing T-Shirt DIY Decoration Gothic Embroidered Applique
Punk Butterfly Skull Embroidery Patch Polyester Iron On Moth Patches For Clothing T-Shirt DIY Decoration Gothic Embroidered Applique
like
Find Similar
Punk butterfly skull embroidery patch for denim jackets and shirts, size 7.6x6.1cm - Black and White Butterfly Skull (PE4860CT)
Punk style skull butterfly embroidered patch for DIY jackets, size 7.8x6.6cm black and white - Line Art Butterfly Skull (PE6650CT)
Macro shot of skull butterfly embroidery patch with orange wings and size detail - Orange Butterfly Skull (PE6708CT)
Macro shot of butterfly skull embroidery patch showing 7x6.5cm size and purple stitching - Purple Butterfly Skull (PE6709CT)
+7
Punk Butterfly Skull Embroidery Patch Polyester Iron On Moth Patches For Clothing T-Shirt DIY Decoration Gothic Embroidered Applique
-5%
$0.47-0.96
No MOQ
Free Shipping
Embroidered Patch For Clothing Iron On DIY Applique Badge Wave Landscape Wolf Bear For Jacket Backpack Jeans T-Shirt
Embroidered Patch For Clothing Iron On DIY Applique Badge Wave Landscape Wolf Bear For Jacket Backpack Jeans T-Shirt
like
Find Similar
7.5cm round Save the Ocean whale embroidery patch for DIY clothing iron-on applique - Save The Ocean Whale (PE5517CT) / Adhesive Backing Patch
Embroidered 7.3cm patch featuring an artistic woman kissing a golden moon on peacock blue - Woman Kissing Moon (PE5531CT) / Adhesive Backing Patch
Embroidered starry night iron-on patch with mountain design for DIY clothing 6.8x7cm - Geometric Star Moon Mountain (PE5952CT) / Adhesive Backing Patch
Embroidered 7cm round patch featuring Japanese Ukiyo-e wave and moon design - Ukiyo-e Wave Crescent Moon (PE5974CT) / Adhesive Backing Patch
+14
Embroidered Patch For Clothing Iron On DIY Applique Badge Wave Landscape Wolf Bear For Jacket Backpack Jeans T-Shirt
-6%
$0.36-1.09
Mix MOQ : 10
Free Shipping
Fashion Girl Embroidery Patch DIY Clothing Iron On Patch Cartoon Skull Moon Decorative Fabric Applique For T-Shirt Bag
Fashion Girl Embroidery Patch DIY Clothing Iron On Patch Cartoon Skull Moon Decorative Fabric Applique For T-Shirt Bag
like
Find Similar
Embroidered 7.3cm patch featuring an artistic woman kissing a golden moon on peacock blue - Moon Kissing Girl (PE5531CT)
Detail of embroidered patch showing a skull hug design with size 5.7x8.2cm on white background - Skull Hug Portrait (PE6448CT)
Bohemian crescent moon and girl embroidery patch for DIY clothing, size 8x9.7cm - Crescent Cloud Girl (PE6532CT)
7.4cm round embroidered crescent moon patch with woman profile silhouette in yellow and black - Black and Yellow Moon Silhouette (PE6533CT)
+4
Fashion Girl Embroidery Patch DIY Clothing Iron On Patch Cartoon Skull Moon Decorative Fabric Applique For T-Shirt Bag
-6%
$0.27-1.10
Mix MOQ : 10
Embroidery Patches Iron On Applique For Clothing Bags DIY Artistic Mt Fuji Starry Sky Wave Decorative Embroidered Patches
Embroidery Patches Iron On Applique For Clothing Bags DIY Artistic Mt Fuji Starry Sky Wave Decorative Embroidered Patches
like
Find Similar
Starry Night embroidered patch inspired by Van Gogh, rectangular shape 9.2x7cm - Starry Night Art Style (PE3312CT)
UFO and forest embroidered iron-on patch with I WANT TO BELIEVE text 9.9x7.8cm - UFO Forest Style (PE4123CT)
Round punk embroidery patch with black and white mountain forest and moon scenery 8x8cm - Snowy Mountain Night Style (PE4731CT)
Embroidered mountain van patch Find Your Road 7.6cm circular adventure badge for clothing - Adventure Camper Style (PE5514CT)
+12
Embroidery Patches Iron On Applique For Clothing Bags DIY Artistic Mt Fuji Starry Sky Wave Decorative Embroidered Patches
-6%
$0.44-1.10
No MOQ
 · 
12 sold recently
Free Shipping
Artistic Embroidered Patch Iron On Applique Van Gogh Starry Night Wave Heart Decorative Embroidery For Clothing Bags
Artistic Embroidered Patch Iron On Applique Van Gogh Starry Night Wave Heart Decorative Embroidery For Clothing Bags
like
Find Similar
Starry Night embroidered patch inspired by Van Gogh, rectangular shape 9.2x7cm - Rectangular Starry Night Style (PE3312CT)
7.7cm Van Gogh Starry Night embroidered iron-on patch for DIY clothing decoration - Round Starry Night Style (PE4828CT)
Anatomical heart embroidery patch with blue wave pattern, size 12.4x8.8cm - Wave Heart Style (PE5096CT)
Detail of anatomical heart embroidery patch with ocean waves and 14.2x9cm size label - Anatomical Heart Wave Boat Style (PE5101CT)
+5
Artistic Embroidered Patch Iron On Applique Van Gogh Starry Night Wave Heart Decorative Embroidery For Clothing Bags
-5%
$0.22-1.18
Mix MOQ : 10
Free Shipping
Vintage Scrapbooking Material Cardstock For DIY Junk Journal Retro European American Style Aesthetic Decorative Floral Craft Paper
Vintage Scrapbooking Material Cardstock For DIY Junk Journal Retro European American Style Aesthetic Decorative Floral Craft Paper
like
Find Similar
12-sheet retro vintage scrapbook paper set for DIY junk journal and paper craft materials - Literary Retro Collage Style (12566 Plant Art Nouveau)
Vintage Scrapbooking Material Cardstock For DIY Junk Journal Retro European American Style Aesthetic Decorative Floral Craft Paper
$1.10
No MOQ
Vintage Japanese Style Scrapbooking Background Paper Pad Acid Free Decorative Cardstock For DIY Crafts Junk Journaling
Vintage Japanese Style Scrapbooking Background Paper Pad Acid Free Decorative Cardstock For DIY Crafts Junk Journaling
like
Find Similar
1 option
Vintage Japanese Style Scrapbooking Background Paper Pad Acid Free Decorative Cardstock For DIY Crafts Junk Journaling
$1.38
No MOQ
Vintage Victorian People Scrapbooking Stickers Waterproof Retro Gothic Decals For DIY Journal Laptop Phone Case Decor
Vintage Victorian People Scrapbooking Stickers Waterproof Retro Gothic Decals For DIY Journal Laptop Phone Case Decor
like
Find Similar
1 option
NewVintage Victorian People Scrapbooking Stickers Waterproof Retro Gothic Decals For DIY Journal Laptop Phone Case Decor
-4%
$0.69
No MOQ
Ballet Girl Embroidery Patches Set Dance Theme Iron On Appliques For Clothing Backpack DIY Decorative Embroidered Patches
Ballet Girl Embroidery Patches Set Dance Theme Iron On Appliques For Clothing Backpack DIY Decorative Embroidered Patches
like
Find Similar
Rainbow ballerina silhouette embroidery patch for yoga wear with size dimensions - Yoga Dance Silhouette (1#)
Star-shaped Dance to the Music embroidered patch for clothing DIY decoration - Star Dance Slogan (2#)
Cartoon ballet dancer DANCE embroidery patch with size measurements 7.4x6.5 cm - Color Block DANCE Dancer (3#)
Colorful HAPPY embroidered ballet dance patches for clothing with ironing adhesive back - HAPPY Colorful Dance Steps (4#)
+15
Ballet Girl Embroidery Patches Set Dance Theme Iron On Appliques For Clothing Backpack DIY Decorative Embroidered Patches
$0.22-4.80
No MOQ
Free Shipping
Cartoon Black Girl Magic Embroidery Patches For Clothing DIY Iron On Applique For Afro Women Fashion Jackets Decorative Patch
Cartoon Black Girl Magic Embroidery Patches For Clothing DIY Iron On Applique For Afro Women Fashion Jackets Decorative Patch
like
Find Similar
Cartoon embroidered patch of a Black girl with pink bow and afro hair, size 6.5x6.8cm - Pink Bow Afro Girl (6036869923012)
Embroidered black woman with plants patch for clothing, size 7.1cm x 4.2cm - Woman With Green Plants Art (6036869923013)
Embroidered black girl magic patch with yellow headwrap and vibrant gold hoop earrings - Girl In Yellow Headband (6036869923014)
Embroidered Black Girl Magic patch for clothing with Afro hair design and pink lettering - Afro Girl With Text Design (6036869923015)
+12
Cartoon Black Girl Magic Embroidery Patches For Clothing DIY Iron On Applique For Afro Women Fashion Jackets Decorative Patch
$0.17-5.14
No MOQ
Free Shipping
Stainless Steel Christmas Spoon Laser Engraved Coffee Dessert Spoon Silver Mirror Polished Holiday Gift Tableware
Stainless Steel Christmas Spoon Laser Engraved Coffee Dessert Spoon Silver Mirror Polished Holiday Gift Tableware
like
Find Similar
Polished black rectangular gift boxes for stainless steel spoons in open and closed views - Black Rectangle Gift Box (5519276005637)
Merry Christmas stainless steel spoon with laser engraved stars and holiday greetings - Santa Claus Style (XG201)
Macro detail of Merry Christmas engraving and festive icons on stainless steel spoon - Christmas Gingerbread Man Style (XG202)
Detailed macro view of stainless steel coffee spoon with Let It Snow engraving - Snowflake Element Style (XG203)
+18
Stainless Steel Christmas Spoon Laser Engraved Coffee Dessert Spoon Silver Mirror Polished Holiday Gift Tableware
$0.43-0.63
Mix MOQ : 5
Creative Cereal Killer Engraved Stainless Steel Spoon Mirror Polished Long Handle Coffee Dessert Tableware Gift For Adults
Creative Cereal Killer Engraved Stainless Steel Spoon Mirror Polished Long Handle Coffee Dessert Tableware Gift For Adults
like
Find Similar
Macro shot of polished stainless steel spoon engraved with Cereal Killer text - Bold Font Style (3101.1)
Polished stainless steel spoon featuring a Cereal Killer engraved slogan design - Standard Serif Style (3101.2)
Close-up of a silver stainless steel spoon with Cereal Killer engraved text detail - Skull Pattern Style (3101.3)
Polished stainless steel spoon with Cereal Killer engraved text on white background - Classic Block Style (3101.4)
+2
Creative Cereal Killer Engraved Stainless Steel Spoon Mirror Polished Long Handle Coffee Dessert Tableware Gift For Adults
$0.63
Mix MOQ : 10
Vintage Aesthetic Decorative Stickers For Scrapbooking Journaling Laptop Luggage Waterproof Retro Botanical Animal Decals
Vintage Aesthetic Decorative Stickers For Scrapbooking Journaling Laptop Luggage Waterproof Retro Botanical Animal Decals
like
Find Similar
Set of 100 vintage art stickers featuring animals and flowers for journals and scrapbooks - Retro Art Style
Vintage Aesthetic Decorative Stickers For Scrapbooking Journaling Laptop Luggage Waterproof Retro Botanical Animal Decals
$1.91
No MOQ
 · 
18 views
Ins Style Ocean Theme Stickers Waterproof Blue Mermaid Sea Life Decals For Luggage Water Bottle Laptop Phone DIY Decor
Ins Style Ocean Theme Stickers Waterproof Blue Mermaid Sea Life Decals For Luggage Water Bottle Laptop Phone DIY Decor
like
Find Similar
50pcs blue ocean themed waterproof stickers for DIY decoration on luggage and phone - Ocean Art Series
Ins Style Ocean Theme Stickers Waterproof Blue Mermaid Sea Life Decals For Luggage Water Bottle Laptop Phone DIY Decor
$0.95
No MOQ
Vintage Oil Painting Stickers Retro Artistic Fairy Angel Waterproof Vinyl Decals For DIY Scrapbook Luggage Laptop Decor
Vintage Oil Painting Stickers Retro Artistic Fairy Angel Waterproof Vinyl Decals For DIY Scrapbook Luggage Laptop Decor
like
Find Similar
50pcs vintage art oil painting stickers featuring retro flower fairies and angels for DIY - Retro Art Style(sku_766647378221)
Vintage Oil Painting Stickers Retro Artistic Fairy Angel Waterproof Vinyl Decals For DIY Scrapbook Luggage Laptop Decor
$0.96
No MOQ
Removable Waterproof Chalkboard Stickers Matte Black PVC Labels Decorative Frame Tags For Kitchen Jars Bottles Pantry
Removable Waterproof Chalkboard Stickers Matte Black PVC Labels Decorative Frame Tags For Kitchen Jars Bottles Pantry
like
Find Similar
Detail of waterproof chalkboard labels roll with three vintage decorative border designs - Wavy Frame Style (HF13)
Detail of Style-2 waterproof chalkboard labels with three vintage frame designs on roll - Fancy Art Style (HF14)
Removable Waterproof Chalkboard Stickers Matte Black PVC Labels Decorative Frame Tags For Kitchen Jars Bottles Pantry
$1.44
No MOQ
Vintage Paper Stamp Stickers For Scrapbooking DIY Decorative Stickers With Botanical Mushroom Space Insect Patterns
Vintage Paper Stamp Stickers For Scrapbooking DIY Decorative Stickers With Botanical Mushroom Space Insect Patterns
like
Find Similar
Vintage mushroom stamp stickers for scrapbooking with detailed botanical illustrations - Mushroom Notes
Vintage postage stamp stickers with animal and nature motifs for scrapbooking - Vintage Art Collection
Vintage botanical stamp stickers set with lavender and sunflower motifs for DIY journals - Botanical Love Poem
Retro astronomy stamp stickers with moon phases and vintage space exploration designs - Space Odyssey
+1
Vintage Paper Stamp Stickers For Scrapbooking DIY Decorative Stickers With Botanical Mushroom Space Insect Patterns
$0.88
No MOQ
Vintage Material Paper 100 Sheets Retro Scrapbooking Supplies For DIY Crafts Journaling Decoupage Floral Portrait Decorative Paper
Vintage Material Paper 100 Sheets Retro Scrapbooking Supplies For DIY Crafts Journaling Decoupage Floral Portrait Decorative Paper
like
Find Similar
Vintage scrapbooking paper set with antique receipts and handwritten notes for DIY crafts - Handwritten Letter
Vintage Art Collage scrapbook paper kit with dark green cover and nostalgic motifs - Art Collage
Vintage astronomy theme decorative scrapbooking paper set with planets and star charts - Milky Way World
Vintage scrapbooking paper set with owl and celestial patterns for DIY crafts - Magic Notes
Vintage Material Paper 100 Sheets Retro Scrapbooking Supplies For DIY Crafts Journaling Decoupage Floral Portrait Decorative Paper
-9%
$1.09
No MOQ
 · 
40 views
Vintage Fashion Lady Planner Stickers Writable Paper Decorative DIY Scrapbooking Materials 1950s Style Illustration Stationery
Vintage Fashion Lady Planner Stickers Writable Paper Decorative DIY Scrapbooking Materials 1950s Style Illustration Stationery
like
Find Similar
Vintage fashion stickers set with 10 elegant red retro character designs on writing paper - Socialite Style
Vintage fashion lady stickers set with 10 classic designs for DIY scrapbooking decor - Royal Beauty
Retro fashion lady stickers set for journaling, featuring 30 pieces of vintage style paper - Party Girl
Vintage fashion stickers set in green tones with 10 lady designs for DIY scrapbooking - Green Shadow
+4
Vintage Fashion Lady Planner Stickers Writable Paper Decorative DIY Scrapbooking Materials 1950s Style Illustration Stationery
-10%
$0.75
No MOQ
 · 
24 sold recently
Vintage Newspaper Clippings Washi Paper Sticker Pack For Scrapbooking Journaling DIY Decorative Retro Material Stickers
Vintage Newspaper Clippings Washi Paper Sticker Pack For Scrapbooking Journaling DIY Decorative Retro Material Stickers
like
Find Similar
Vintage yellowed poster stickers set made of washi paper with 50 unique retro designs - Yellowed Poster
50 pieces of red vintage washi stickers set for scrapbooking and DIY decoration - Red Title
Vintage blue washi sticker pack with 50 unique ticket and label designs for DIY journals - Blue Ticket
50pcs vintage American advertising washi stickers for DIY journals and decoration - Colored Era
+2
NewVintage Newspaper Clippings Washi Paper Sticker Pack For Scrapbooking Journaling DIY Decorative Retro Material Stickers
-10%
$0.96
No MOQ
 · 
43 sold recently
Isometric Deco Scene PET Stickers Miniature Room Shop Interior DIY Journaling Scrapbooking Materials Decorative Stickers
Isometric Deco Scene PET Stickers Miniature Room Shop Interior DIY Journaling Scrapbooking Materials Decorative Stickers
like
Find Similar
Flower Market PET sticker set with scenery background for DIY scrapbooking craft - Bird and Flower Market
Art museum theme DIY planner sticker set with 1 scene card and 2 PET stickers - Art Exhibition
DIY electronics store miniature scene stickers with PET material and cardboard backing - Electrical City
Garden Cafe DIY scene sticker kit with 2 PET sheets and a decorative background card - Courtyard Coffee
Isometric Deco Scene PET Stickers Miniature Room Shop Interior DIY Journaling Scrapbooking Materials Decorative Stickers
$0.80
No MOQ
Go to

More in home & kitchen

Explore more in art posters

wallhangingdecorativepolyestertasselsheartgirlsheadfacewoman
living roomkidsstylecardsdisplayframelessmagneticdesignsunparty

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access