Everful

Wholesale art posters

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Art Posters

Find the perfect pieces: wall stickers, window stickers, kitchen stickers and more

All products in art posters

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Cartoon Rainbow Unicorn Stars Clouds Wall Stickers For Kids Nursery Bedroom PVC Removable DIY Printed Wall Decals Home Decor
Cartoon Rainbow Unicorn Stars Clouds Wall Stickers For Kids Nursery Bedroom PVC Removable DIY Printed Wall Decals Home Decor
like
Find Similar
Rainbow unicorn wall decal with stars and clouds for nursery decor, 60x30cm layout size - Rainbow Unicorn Style (ZB335) / 30x60cm
Cartoon Rainbow Unicorn Stars Clouds Wall Stickers For Kids Nursery Bedroom PVC Removable DIY Printed Wall Decals Home Decor
$1.21
Mix MOQ : 4
In These Moments Time Stood Still Quote Wall Decal PVC Removable Art Sticker For Bedroom Living Room Home Decor Black
In These Moments Time Stood Still Quote Wall Decal PVC Removable Art Sticker For Bedroom Living Room Home Decor Black
like
Find Similar
Detail view showing dimensions of black In These Moments wall decal sticker 71x29cm - 29*71CM
NewIn These Moments Time Stood Still Quote Wall Decal PVC Removable Art Sticker For Bedroom Living Room Home Decor Black
-4%
$1.15
No MOQ
Music Notes Staff Wall Sticker PVC DIY Vinyl Decal Musical Lettering For Living Room Bedroom Home Decor Minimalist Black
Music Notes Staff Wall Sticker PVC DIY Vinyl Decal Musical Lettering For Living Room Bedroom Home Decor Minimalist Black
like
Find Similar
Detailed dimension layout for Music Notes wall sticker with product size specifications - Music Notes Combination Style (FX-F395)
Music Notes Staff Wall Sticker PVC DIY Vinyl Decal Musical Lettering For Living Room Bedroom Home Decor Minimalist Black
$1.21
No MOQ
Fairy Butterfly Silhouette Inspirational Quote Wall Sticker Black PVC Removable Wall Decal For Living Room Bedroom Decor
Fairy Butterfly Silhouette Inspirational Quote Wall Sticker Black PVC Removable Wall Decal For Living Room Bedroom Decor
like
Find Similar
Fairy and butterfly wall sticker in black finish with Everything Better artistic font - Large Size (SC116) / Black
NewFairy Butterfly Silhouette Inspirational Quote Wall Sticker Black PVC Removable Wall Decal For Living Room Bedroom Decor
$1.64
Mix MOQ : 3
Colorful Rainbow Paint Splash Letter Wall Stickers PVC Play Explore Create Artistic Decor For Kids Bedroom Nursery
Colorful Rainbow Paint Splash Letter Wall Stickers PVC Play Explore Create Artistic Decor For Kids Bedroom Nursery
like
Find Similar
Detail view of colorful splatter paint wall stickers with explore play create letters - Rainbow Letters Splash Style (FX-F153)
Colorful Rainbow Paint Splash Letter Wall Stickers PVC Play Explore Create Artistic Decor For Kids Bedroom Nursery
-4%
$1.15
No MOQ
Hand Drawn Kitchen Utensils Wall Sticker PVC Self Adhesive Coffee Theme Wall Decal For Kitchen Dining Room Home Decor
Hand Drawn Kitchen Utensils Wall Sticker PVC Self Adhesive Coffee Theme Wall Decal For Kitchen Dining Room Home Decor
like
Find Similar
Detailed view of kitchen wall stickers with teapot and coffee canister illustrations - Standard Kitchen Theme
Hand Drawn Kitchen Utensils Wall Sticker PVC Self Adhesive Coffee Theme Wall Decal For Kitchen Dining Room Home Decor
-4%
$1.15
No MOQ
Morandi Geometric Wall Stickers PVC Polka Dot Triangle Gift Box Decals For Kids Nursery Bedroom Living Room Home Decoration
Morandi Geometric Wall Stickers PVC Polka Dot Triangle Gift Box Decals For Kids Nursery Bedroom Living Room Home Decoration
like
Find Similar
Morandi geometric wall decal set with pink and green dots and triangles layout view - HM-SK4 / 28*30cm 4 Sheets (No Bag)
Morandi Geometric Wall Stickers PVC Polka Dot Triangle Gift Box Decals For Kids Nursery Bedroom Living Room Home Decoration
$0.61
Mix MOQ : 2
Astronaut Music Wall Stickers Guitar Planet Space Theme Self Adhesive PVC Decals For Children Bedroom Living Room Home Decor
Astronaut Music Wall Stickers Guitar Planet Space Theme Self Adhesive PVC Decals For Children Bedroom Living Room Home Decor
like
Find Similar
Detailed dimensions of musical astronaut wall stickers with guitar and planet themes - 40x60cm (2 Sheets)
Astronaut Music Wall Stickers Guitar Planet Space Theme Self Adhesive PVC Decals For Children Bedroom Living Room Home Decor
$1.87
No MOQ
Halloween Black Cat Pumpkin Ghost Wall Stickers PVC Removable Decals For Living Room Bedroom Kitchen Holiday Party Decor
Halloween Black Cat Pumpkin Ghost Wall Stickers PVC Removable Decals For Living Room Bedroom Kitchen Holiday Party Decor
like
Find Similar
Detailed sheet showing 30x90cm Halloween wall stickers with cat, ghost, and pumpkin motifs - Halloween Black Cat Pumpkin (HY-D040) / 30x90cm
Halloween Black Cat Pumpkin Ghost Wall Stickers PVC Removable Decals For Living Room Bedroom Kitchen Holiday Party Decor
$1.30
No MOQ
Welcome Lettering Wall Sticker Black Removable PVC Art Decal For Living Room Entryway Bedroom Home Decor Mural
Welcome Lettering Wall Sticker Black Removable PVC Art Decal For Living Room Entryway Bedroom Home Decor Mural
like
Find Similar
Black cursive Welcome wall sticker PVC decal 40x10cm layout size for home decor - 10*40cm 1 Sheet / Black
Welcome Lettering Wall Sticker Black Removable PVC Art Decal For Living Room Entryway Bedroom Home Decor Mural
$0.78
Mix MOQ : 6
Halloween Pumpkin Wall Sticker Removable PVC Jack-O-Lantern Crow Spider Rose Gothic Decorative Mural For Bedroom Living Room
Halloween Pumpkin Wall Sticker Removable PVC Jack-O-Lantern Crow Spider Rose Gothic Decorative Mural For Bedroom Living Room
like
Find Similar
Halloween pumpkin wall sticker set with roses and crows for living room decor - Halloween Pumpkin Crow Style / Brown
NewHalloween Pumpkin Wall Sticker Removable PVC Jack-O-Lantern Crow Spider Rose Gothic Decorative Mural For Bedroom Living Room
$1.38
Mix MOQ : 2
Autumn Vintage Bicycle Wall Sticker With Pumpkin And Maple Leaves Watercolor Art PVC Decal For Living Room Home Decor
Autumn Vintage Bicycle Wall Sticker With Pumpkin And Maple Leaves Watercolor Art PVC Decal For Living Room Home Decor
like
Find Similar
Autumn bicycle wall sticker with pumpkin and maple leaves layout and paste effect size - Autumn Bicycle Pattern / 29*60cm
Autumn Vintage Bicycle Wall Sticker With Pumpkin And Maple Leaves Watercolor Art PVC Decal For Living Room Home Decor
$1.10
Mix MOQ : 2
Vintage Map Hexagon Wall Stickers PVC Self Adhesive Removable Hexagonal Puzzle Wall Decals For Living Room Bedroom Decor
Vintage Map Hexagon Wall Stickers PVC Self Adhesive Removable Hexagonal Puzzle Wall Decals For Living Room Bedroom Decor
like
Find Similar
Hexagonal self-adhesive wall stickers featuring a vintage nautical map and compass design - Vintage Map Hexagon (30x90cm)
Vintage Map Hexagon Wall Stickers PVC Self Adhesive Removable Hexagonal Puzzle Wall Decals For Living Room Bedroom Decor
$1.44
Mix MOQ : 4
Watercolor Elephant Butterfly Flower Wall Stickers For Kids Nursery Bedroom PVC Decorative Animal Floral Mural Home Decor
Watercolor Elephant Butterfly Flower Wall Stickers For Kids Nursery Bedroom PVC Decorative Animal Floral Mural Home Decor
like
Find Similar
Detailed dimensions of watercolor elephant wall stickers showing 30x90cm sheet size - Watercolor Elephant Floral (fun-c41)
Watercolor Elephant Butterfly Flower Wall Stickers For Kids Nursery Bedroom PVC Decorative Animal Floral Mural Home Decor
$2.02
No MOQ
Valentine's Day I Love You Wall Sticker Kissing Boy Girl Silhouette Romantic PVC Self Adhesive Decal For Bedroom Decor
Valentine's Day I Love You Wall Sticker Kissing Boy Girl Silhouette Romantic PVC Self Adhesive Decal For Bedroom Decor
like
Find Similar
I LOVE YOU wall sticker with boy and girl silhouette, size 57x32cm layout black PVC decal - 32*57cm (Without Bag) / Black
Valentine's Day I Love You Wall Sticker Kissing Boy Girl Silhouette Romantic PVC Self Adhesive Decal For Bedroom Decor
$1.21
Mix MOQ : 2
Watercolor Rainbow And Flowers Wall Sticker PVC Self-Adhesive Removable Decal For Kids Room Nursery Bedroom Home Decor
Watercolor Rainbow And Flowers Wall Sticker PVC Self-Adhesive Removable Decal For Kids Room Nursery Bedroom Home Decor
like
Find Similar
Detail view of rainbow flower wall stickers showing layout and finished dimensions - 40*50cm (fun-f868)
Watercolor Rainbow And Flowers Wall Sticker PVC Self-Adhesive Removable Decal For Kids Room Nursery Bedroom Home Decor
$1.30
No MOQ
Watercolor Sailboat Wall Sticker For Bedroom Living Room Artistic Removable PVC Home Decor Mural Art Decal Decoration
Watercolor Sailboat Wall Sticker For Bedroom Living Room Artistic Removable PVC Home Decor Mural Art Decal Decoration
like
Find Similar
Detail view of watercolor sailboat wall sticker with product size 30x60cm specifications - 30*60cm/HY-B021
Watercolor Sailboat Wall Sticker For Bedroom Living Room Artistic Removable PVC Home Decor Mural Art Decal Decoration
$1.12
No MOQ
Life Is Beautiful Motivational Quote Wall Sticker PVC Black Butterfly Heart DIY Removable Decal For Living Room Bedroom Decor
Life Is Beautiful Motivational Quote Wall Sticker PVC Black Butterfly Heart DIY Removable Decal For Living Room Bedroom Decor
like
Find Similar
Detail showing Life is Beautiful wall sticker with butterfly motifs and 59x30cm dimensions - 30*59cm
Life Is Beautiful Motivational Quote Wall Sticker PVC Black Butterfly Heart DIY Removable Decal For Living Room Bedroom Decor
$1.21
No MOQ
With God All Things Are Possible Wall Sticker Religious Quote PVC Waterproof Decal For Living Room Bedroom Home Decor
With God All Things Are Possible Wall Sticker Religious Quote PVC Waterproof Decal For Living Room Bedroom Home Decor
like
Find Similar
Detail of With God All Things Are Possible wall sticker showing 56x32cm dimensions - 32*56CM / Black
With God All Things Are Possible Wall Sticker Religious Quote PVC Waterproof Decal For Living Room Bedroom Home Decor
$1.12
No MOQ
Bohemian Rainbow Wall Stickers For Kids Room Bedroom DIY PVC Heart Cloud Decorative Decals Morandi Weather Wall Art Decoration
Bohemian Rainbow Wall Stickers For Kids Room Bedroom DIY PVC Heart Cloud Decorative Decals Morandi Weather Wall Art Decoration
like
Find Similar
1 option
Bohemian Rainbow Wall Stickers For Kids Room Bedroom DIY PVC Heart Cloud Decorative Decals Morandi Weather Wall Art Decoration
$1.21
No MOQ
Removable PVC Wall Sticker With Blue Gold Moon And Stars Patterns Bohemian Style Artistic Home Decor Wall Decal For Living Room
Removable PVC Wall Sticker With Blue Gold Moon And Stars Patterns Bohemian Style Artistic Home Decor Wall Decal For Living Room
like
Find Similar
Blue moon and stars wall sticker layout showing product size 60cm by 40cm detail - 40*60CM (FX-E321)
Removable PVC Wall Sticker With Blue Gold Moon And Stars Patterns Bohemian Style Artistic Home Decor Wall Decal For Living Room
$1.44
No MOQ
But First Coffee English Quote Wall Sticker PVC Removable Coffee Cup Heartbeat Line Art Decal For Kitchen Cafe Home Decor
But First Coffee English Quote Wall Sticker PVC Removable Coffee Cup Heartbeat Line Art Decal For Kitchen Cafe Home Decor
like
Find Similar
Detailed size specifications for But first coffee wall sticker measuring 60cm by 30cm - 30x60cm
But First Coffee English Quote Wall Sticker PVC Removable Coffee Cup Heartbeat Line Art Decal For Kitchen Cafe Home Decor
$1.12
No MOQ
Black Modern World Map Silhouette Wall Sticker PVC Self Adhesive Decal For Living Room Bedroom Office Home Wall Decor
Black Modern World Map Silhouette Wall Sticker PVC Self Adhesive Decal For Living Room Bedroom Office Home Wall Decor
like
Find Similar
Detailed world map wall sticker dimensions 45x60cm in black creative silhouette style - 45x60cm x 2 Sheets Layout
Black Modern World Map Silhouette Wall Sticker PVC Self Adhesive Decal For Living Room Bedroom Office Home Wall Decor
-4%
$1.92
No MOQ
Halloween Witch Bat Stars Wall Stickers Removable PVC Self Adhesive Decorative Decals For Home Party Festival Wall Decor
Halloween Witch Bat Stars Wall Stickers Removable PVC Self Adhesive Decorative Decals For Home Party Festival Wall Decor
like
Find Similar
Halloween wall sticker set with cartoon witch, bats and stars, 30x35cm dimensions - BM4079-ZC(30*35cm)
Halloween Witch Bat Stars Wall Stickers Removable PVC Self Adhesive Decorative Decals For Home Party Festival Wall Decor
$1.24
Mix MOQ : 2
Watercolor Wildflowers Butterflies Wall Stickers Bohemian PVC Removable Floral Wall Decals For Bedroom Living Room Home Decor
Watercolor Wildflowers Butterflies Wall Stickers Bohemian PVC Removable Floral Wall Decals For Bedroom Living Room Home Decor
like
Find Similar
Bohemian floral wall decals with butterfly motif in watercolor layout and sizing - 30x90cm x 2 Pieces (ZB877)
Watercolor Wildflowers Butterflies Wall Stickers Bohemian PVC Removable Floral Wall Decals For Bedroom Living Room Home Decor
$2.02
Mix MOQ : 4
Halloween Monster Silhouette Wall Sticker Black Removable PVC Decal Creepy Ghost For Party Living Room Home Decoration
Halloween Monster Silhouette Wall Sticker Black Removable PVC Decal Creepy Ghost For Party Living Room Home Decoration
like
Find Similar
1 option
Halloween Monster Silhouette Wall Sticker Black Removable PVC Decal Creepy Ghost For Party Living Room Home Decoration
$1.73
No MOQ
Modern Minimalist Coffee Cup Heartbeat Line Wall Sticker PVC Removable Heart Pattern Decor For Kitchen Cafe Restaurant
Modern Minimalist Coffee Cup Heartbeat Line Wall Sticker PVC Removable Heart Pattern Decor For Kitchen Cafe Restaurant
like
Find Similar
Detail view of coffee cup heartbeat wall sticker with dimensions 60cm by 25cm - DZ796 Style / 25*60cm
Modern Minimalist Coffee Cup Heartbeat Line Wall Sticker PVC Removable Heart Pattern Decor For Kitchen Cafe Restaurant
$0.72
No MOQ
Inspirational Colored Pencil Wall Stickers For Kids Room Bedroom Classroom PVC Waterproof Self Adhesive Removable Wall Decals Decor
Inspirational Colored Pencil Wall Stickers For Kids Room Bedroom Classroom PVC Waterproof Self Adhesive Removable Wall Decals Decor
like
Find Similar
Colorful pencil wall decals for kids with inspirational phrases and polka dot stickers - ZB888 Style
Inspirational Colored Pencil Wall Stickers For Kids Room Bedroom Classroom PVC Waterproof Self Adhesive Removable Wall Decals Decor
$1.79
Mix MOQ : 4
Inspirational English Quotes PVC Wall Sticker The Best Things In Life Art Decal Removable Waterproof Black Wall Decor For Living Room Bedroom
Inspirational English Quotes PVC Wall Sticker The Best Things In Life Art Decal Removable Waterproof Black Wall Decor For Living Room Bedroom
like
Find Similar
1 option
Inspirational English Quotes PVC Wall Sticker The Best Things In Life Art Decal Removable Waterproof Black Wall Decor For Living Room Bedroom
-5%
$1.64
No MOQ
Hand Painted Bread Fruit Food Kitchen Wall Sticker PVC Self Adhesive Decorative Wall Decal For Home Dining Room Decor
Hand Painted Bread Fruit Food Kitchen Wall Sticker PVC Self Adhesive Decorative Wall Decal For Home Dining Room Decor
like
Find Similar
Detailed sheet size 40x50cm and finish size 41x47cm of food theme wall stickers - Hand Painted Kitchen Theme(fun-f720)
NewHand Painted Bread Fruit Food Kitchen Wall Sticker PVC Self Adhesive Decorative Wall Decal For Home Dining Room Decor
$1.30
No MOQ
We're All Mad Here Cheshire Cat Smile Wall Sticker Waterproof PVC Art Mural Decal For Home Living Room Bedroom Decoration
We're All Mad Here Cheshire Cat Smile Wall Sticker Waterproof PVC Art Mural Decal For Home Living Room Bedroom Decoration
like
Find Similar
6 options
We're All Mad Here Cheshire Cat Smile Wall Sticker Waterproof PVC Art Mural Decal For Home Living Room Bedroom Decoration
$1.04-2.31
No MOQ
Good Morning Coffee Cup Heart Wall Sticker PVC Waterproof DIY Art Decal For Kitchen Dining Room Coffee Corner Home Decor
Good Morning Coffee Cup Heart Wall Sticker PVC Waterproof DIY Art Decal For Kitchen Dining Room Coffee Corner Home Decor
like
Find Similar
Good Morning coffee cup wall sticker with stars and hearts layout size 30x30cm - Coffee Cup Style (PB706)
NewGood Morning Coffee Cup Heart Wall Sticker PVC Waterproof DIY Art Decal For Kitchen Dining Room Coffee Corner Home Decor
$0.92
Mix MOQ : 4
Gaming Theme PVC Wall Decals Self Adhesive Eat Sleep Game Repeat Lettering Stickers For Boys Bedroom Playroom Wall Decor
Gaming Theme PVC Wall Decals Self Adhesive Eat Sleep Game Repeat Lettering Stickers For Boys Bedroom Playroom Wall Decor
like
Find Similar
Eat Sleep Game Repeat wall decal with colorful game controller icons for kids bedroom decor - Gaming Theme Style (HP-YX-027)
Gaming Theme PVC Wall Decals Self Adhesive Eat Sleep Game Repeat Lettering Stickers For Boys Bedroom Playroom Wall Decor
$1.38
No MOQ
Bohemian Watercolor Volcano Clouds Wall Stickers PVC Self-Adhesive Art Mural Decor For Kids Room Nursery Bedroom Playroom
Bohemian Watercolor Volcano Clouds Wall Stickers PVC Self-Adhesive Art Mural Decor For Kids Room Nursery Bedroom Playroom
like
Find Similar
Detail view of 30x30cm volcano wall stickers set with precise size specifications - 30*30cm / Volcano Clouds Pattern (UV24Y12826T_T)
Bohemian Watercolor Volcano Clouds Wall Stickers PVC Self-Adhesive Art Mural Decor For Kids Room Nursery Bedroom Playroom
$1.21
Mix MOQ : 2
Vintage Retro Furniture Guitar PVC Wall Sticker For Living Room Bedroom Self Adhesive Hand Drawn Style Flower Cabinet Art Decal
Vintage Retro Furniture Guitar PVC Wall Sticker For Living Room Bedroom Self Adhesive Hand Drawn Style Flower Cabinet Art Decal
like
Find Similar
Detailed sheet of self-adhesive PVC wall decals with vintage guitar and sofa graphics - 40*60cm
Vintage Retro Furniture Guitar PVC Wall Sticker For Living Room Bedroom Self Adhesive Hand Drawn Style Flower Cabinet Art Decal
$1.21
No MOQ
Romantic Couple Silhouette Switch Sticker Removable PVC Wall Decal For Living Room Bedroom Decor Wedding Gift Black Silhouette
Romantic Couple Silhouette Switch Sticker Removable PVC Wall Decal For Living Room Bedroom Decor Wedding Gift Black Silhouette
like
Find Similar
Detail view of KG112 romantic couple silhouette wall sticker with PVC texture - Couple Silhouette (KG112印) / 12*17cm
Romantic Couple Silhouette Switch Sticker Removable PVC Wall Decal For Living Room Bedroom Decor Wedding Gift Black Silhouette
$0.43
No MOQ
Cartoon Dinosaur Reading Girl Wall Sticker PVC Waterproof Beach Starfish Floral Home Decor Self Adhesive Art Mural Decal
Cartoon Dinosaur Reading Girl Wall Sticker PVC Waterproof Beach Starfish Floral Home Decor Self Adhesive Art Mural Decal
like
Find Similar
Watercolor wall decal of girl reading on books, product dimensions 40x30cm measurement - Reading Girl (B18608) / 30x40cm
Watercolor cartoon dinosaur and school books wall decal set, 2 sheets 30x40cm size - Reading Dinosaur (B18609) / 30x40cm
3D beach starfish shell wall sticker for bathroom decor, self-adhesive, 30x20cm - Beach Starfish (B18610) / 20x30cm
Blue hydrangea and red rose self-adhesive wall stickers 30x30cm for home decor - Floral Painting (B18611) / 30x30cm
Cartoon Dinosaur Reading Girl Wall Sticker PVC Waterproof Beach Starfish Floral Home Decor Self Adhesive Art Mural Decal
$0.86-1.18
Mix MOQ : 2
Creative Poker Card Ace Of Clubs Door Sticker Self Adhesive PVC Wall Decal For Bedroom Living Room Modern Home Decor
Creative Poker Card Ace Of Clubs Door Sticker Self Adhesive PVC Wall Decal For Bedroom Living Room Modern Home Decor
like
Find Similar
Ace of Clubs playing card door sticker wall decal in black and white minimalist design - Ace of Clubs Poker D087 62x48cm
Creative Poker Card Ace Of Clubs Door Sticker Self Adhesive PVC Wall Decal For Bedroom Living Room Modern Home Decor
$1.73
Mix MOQ : 2
The Good Life English Quote Wall Decal Artistic Gradient PVC Self-Adhesive Wall Sticker For Bedroom Living Room Decor
The Good Life English Quote Wall Decal Artistic Gradient PVC Self-Adhesive Wall Sticker For Bedroom Living Room Decor
like
Find Similar
Detail showing Good Life wall sticker dimensions 39cm x 39cm with blue gradient font - 39*39CM
The Good Life English Quote Wall Decal Artistic Gradient PVC Self-Adhesive Wall Sticker For Bedroom Living Room Decor
$1.04
No MOQ
Artistic Eyelashes Eyebrows Eyes Wall Sticker Waterproof PVC Decal For Bedroom Beauty Salon Living Room Home Decoration
Artistic Eyelashes Eyebrows Eyes Wall Sticker Waterproof PVC Decal For Bedroom Beauty Salon Living Room Home Decoration
like
Find Similar
Detailed view of black vinyl eye lash wall stickers showing 58x20cm size dimensions - Curved Eyelashes Style (KSA-9A)
Detailed dimension guide for black vinyl eyelash and eyebrow wall decals 58cm by 20cm size - Minimalist Closed Eyes Style (KSA-9B)
Size dimensions 20x58cm for black vinyl eyelash wall decal stickers with eye pattern - Slender Eyelashes Style (KSA-9C)
Detailed dimension guide for black vinyl eyelash wall decal 30x60cm for bedroom decor - Thick Wide Style (KSA-9D)
+2
Artistic Eyelashes Eyebrows Eyes Wall Sticker Waterproof PVC Decal For Bedroom Beauty Salon Living Room Home Decoration
-4%
$0.96
No MOQ
Watercolor Feather Dreamcatcher Wall Stickers PVC DIY Butterfly Floral Wall Decals For Bedroom Living Room Home Decor
Watercolor Feather Dreamcatcher Wall Stickers PVC DIY Butterfly Floral Wall Decals For Bedroom Living Room Home Decor
like
Find Similar
1 option
Watercolor Feather Dreamcatcher Wall Stickers PVC DIY Butterfly Floral Wall Decals For Bedroom Living Room Home Decor
$1.44
No MOQ
Modern Kitchen Seasoned With Love Wall Decal Quote Sticker Removable PVC Vinyl Art Decor For Kitchen Dining Room Home
Modern Kitchen Seasoned With Love Wall Decal Quote Sticker Removable PVC Vinyl Art Decor For Kitchen Dining Room Home
like
Find Similar
Detail view of Kitchen seasoned with Love wall sticker including sizes and dimensions - Medium Size
Modern Kitchen Seasoned With Love Wall Decal Quote Sticker Removable PVC Vinyl Art Decor For Kitchen Dining Room Home
$1.30
Mix MOQ : 2
Nordic Watercolor Flamingo Unicorn Wall Sticker Dream Big Quote Pink PVC Waterproof Decal For Bedroom Nursery Home Decor
Nordic Watercolor Flamingo Unicorn Wall Sticker Dream Big Quote Pink PVC Waterproof Decal For Bedroom Nursery Home Decor
like
Find Similar
1 option
Nordic Watercolor Flamingo Unicorn Wall Sticker Dream Big Quote Pink PVC Waterproof Decal For Bedroom Nursery Home Decor
$1.44
No MOQ
Halloween Skeleton Wizard Wall Sticker Removable PVC Decal For Bedroom Living Room Scary Wizard Pumpkin Bat Moon Home Decor
Halloween Skeleton Wizard Wall Sticker Removable PVC Decal For Bedroom Living Room Scary Wizard Pumpkin Bat Moon Home Decor
like
Find Similar
Layout detail showing 60x40cm Halloween wizard skull wall sticker with pumpkins and bats - 40*60CM/fun-e98
Halloween Skeleton Wizard Wall Sticker Removable PVC Decal For Bedroom Living Room Scary Wizard Pumpkin Bat Moon Home Decor
$1.44
No MOQ
Bohemian Watercolor Rainbow Wall Stickers PVC Removable Sunburst Geometric Wall Decals For Kids Room Bedroom Home Decor
Bohemian Watercolor Rainbow Wall Stickers PVC Removable Sunburst Geometric Wall Decals For Kids Room Bedroom Home Decor
like
Find Similar
Detailed view of bohemian rainbow wall sticker set with 17 pieces and size dimensions - 90*30cm*2 Sheets / Colorful
Bohemian Watercolor Rainbow Wall Stickers PVC Removable Sunburst Geometric Wall Decals For Kids Room Bedroom Home Decor
$3.23
Mix MOQ : 2
Removable PVC Music Notes Staff Pattern Wall Sticker Artistic Music Art Wall Decal For Piano Room Bedroom Living Room Home Decor
Removable PVC Music Notes Staff Pattern Wall Sticker Artistic Music Art Wall Decal For Piano Room Bedroom Living Room Home Decor
like
Find Similar
Detailed dimensions of self-adhesive music notes wall decal in 60x34cm layout - 34x60cm
Removable PVC Music Notes Staff Pattern Wall Sticker Artistic Music Art Wall Decal For Piano Room Bedroom Living Room Home Decor
$0.86
No MOQ
Colorful Watercolor Galaxy Cat And Butterflies Wall Sticker For Kids Room Bedroom DIY PVC Waterproof Self-Adhesive Home Decoration
Colorful Watercolor Galaxy Cat And Butterflies Wall Sticker For Kids Room Bedroom DIY PVC Waterproof Self-Adhesive Home Decoration
like
Find Similar
Detailed size layout of cat and butterfly wall stickers measuring 60cm by 40cm - 40*60cm Layout
Colorful Watercolor Galaxy Cat And Butterflies Wall Sticker For Kids Room Bedroom DIY PVC Waterproof Self-Adhesive Home Decoration
-4%
$1.15
No MOQ
Motivational Quote Reading Will Take You Everywhere Wall Sticker Educational Cartoon Globe Book PVC Decor For Kids Study Room
Motivational Quote Reading Will Take You Everywhere Wall Sticker Educational Cartoon Globe Book PVC Decor For Kids Study Room
like
Find Similar
Self-adhesive Reading wall decal with globe and books for kids room decor, 120x30cm - PD633-A-English-30x120cm
Motivational Quote Reading Will Take You Everywhere Wall Sticker Educational Cartoon Globe Book PVC Decor For Kids Study Room
$1.79
Mix MOQ : 4
Watercolor Ramadan Moon Star Book Lantern Floral Wall Sticker PVC Decorative Decal For Living Room Bedroom Home Decor
Watercolor Ramadan Moon Star Book Lantern Floral Wall Sticker PVC Decorative Decal For Living Room Bedroom Home Decor
like
Find Similar
Visual layout of Islamic moon star wall sticker showing sheet size and finish size details - Painted Style (fun-e233)
Watercolor Ramadan Moon Star Book Lantern Floral Wall Sticker PVC Decorative Decal For Living Room Bedroom Home Decor
$1.44
No MOQ
Inspirational Do Something Amazing Quote Wall Sticker PVC Removable Matte Black Decal For Living Room Bedroom Home Decor
Inspirational Do Something Amazing Quote Wall Sticker PVC Removable Matte Black Decal For Living Room Bedroom Home Decor
like
Find Similar
Detail view of motivational quote wall sticker with 26.5cm by 8.9cm dimensions - 8.9x26.5cm
Inspirational Do Something Amazing Quote Wall Sticker PVC Removable Matte Black Decal For Living Room Bedroom Home Decor
$0.10
No MOQ
Robots And Numbers Wall Stickers Watercolor Steampunk PVC Decals For Boys Room Nursery Classroom Home Wall Decoration
Robots And Numbers Wall Stickers Watercolor Steampunk PVC Decals For Boys Room Nursery Classroom Home Wall Decoration
like
Find Similar
1 option
NewRobots And Numbers Wall Stickers Watercolor Steampunk PVC Decals For Boys Room Nursery Classroom Home Wall Decoration
$1.96
No MOQ
Watercolor Blue Bow Polka Dot Wall Stickers PVC Decorative Decals For Kids Nursery Bedroom Bohemian Interior Home Decor
Watercolor Blue Bow Polka Dot Wall Stickers PVC Decorative Decals For Kids Nursery Bedroom Bohemian Interior Home Decor
like
Find Similar
Detailed sheet dimensions of watercolor blue bow and polka dot wall decals for nursery - Blue Bow Polka Dot (CT24Y11082T_T) / 20x30cm
Watercolor Blue Bow Polka Dot Wall Stickers PVC Decorative Decals For Kids Nursery Bedroom Bohemian Interior Home Decor
$1.73
No MOQ
Valentine's Day Wall Sticker Romantic Hugs Kisses Wishes Lettering Heart Pattern PVC Removable Decal For Home Bedroom Decor
Valentine's Day Wall Sticker Romantic Hugs Kisses Wishes Lettering Heart Pattern PVC Removable Decal For Home Bedroom Decor
like
Find Similar
Detailed size specifications for red heart and black lettering Valentine wall sticker decal - Artistic Lettering and Heart Style (PH_QTB330)
Valentine's Day Wall Sticker Romantic Hugs Kisses Wishes Lettering Heart Pattern PVC Removable Decal For Home Bedroom Decor
$0.55
No MOQ
Watercolor Butterfly Tapestry Wall Hanging Polyester Fabric Artistic Animal Pattern Background For Home Living Room Bedroom Decor
Watercolor Butterfly Tapestry Wall Hanging Polyester Fabric Artistic Animal Pattern Background For Home Living Room Bedroom Decor
like
Find Similar
Watercolor butterfly wall tapestry with pink and orange patterns for home wall decor - Artistic Gradient Butterfly (1) / Small
Artistic watercolor butterfly wall tapestry hanging over a sofa in a modern home - Symmetrical Illustrated Butterfly (2) / Small
Wall hanging tapestry with a geometric blue watercolor butterfly on white polyester fabric - Geometric Style Blue Butterfly (3) / Small
Artistic watercolor butterfly tapestry wall hanging for living room sofa decor - Colorful Vibrant Butterfly (4) / Small
+116
Watercolor Butterfly Tapestry Wall Hanging Polyester Fabric Artistic Animal Pattern Background For Home Living Room Bedroom Decor
-5%
$2.46-8.49
No MOQ
Family Quote Wall Sticker With Photo Frames English Letters PVC Waterproof Decal For Living Room Bedroom Home Decor
Family Quote Wall Sticker With Photo Frames English Letters PVC Waterproof Decal For Living Room Bedroom Home Decor
like
Find Similar
Creative black PVC Family wall sticker with photo frames and quotes for living room decor - 58*30CM Black
Detail of creative Family wall stickers with inspirational quotes in a modern living room - 58*30CM Purple
Family Quote Wall Sticker With Photo Frames English Letters PVC Waterproof Decal For Living Room Bedroom Home Decor
-5%
$1.64
No MOQ
Bohemian Kitchen Wall Sticker PVC Waterproof Teapot Fruit Cake Pattern DIY Cabinet Removable Creative Home Decoration
Bohemian Kitchen Wall Sticker PVC Waterproof Teapot Fruit Cake Pattern DIY Cabinet Removable Creative Home Decoration
like
Find Similar
DIY tea cup and fruit wall decals with Persian style teapot and citrus patterns - 30*60CM/FX-B279
Bohemian Kitchen Wall Sticker PVC Waterproof Teapot Fruit Cake Pattern DIY Cabinet Removable Creative Home Decoration
$1.21
No MOQ
Halloween 3D Black Bat Wall Stickers Removable PVC Bat Silhouette Decals For Party Home Decor DIY Window Stickers
Halloween 3D Black Bat Wall Stickers Removable PVC Bat Silhouette Decals For Party Home Decor DIY Window Stickers
like
Find Similar
1 option
Halloween 3D Black Bat Wall Stickers Removable PVC Bat Silhouette Decals For Party Home Decor DIY Window Stickers
$0.86
No MOQ
Halloween Sugar Skull Wall Sticker PVC Self Adhesive Removable Mexican Day Of The Dead Decoration For Home Living Room Wall
Halloween Sugar Skull Wall Sticker PVC Self Adhesive Removable Mexican Day Of The Dead Decoration For Home Living Room Wall
like
Find Similar
1 option
Halloween Sugar Skull Wall Sticker PVC Self Adhesive Removable Mexican Day Of The Dead Decoration For Home Living Room Wall
$2.02
No MOQ
Coffee And Jesus Quote Removable Vinyl Wall Sticker For Kitchen Dining Room Decor Minimalist Coffee Cup Silhouette Decal
Coffee And Jesus Quote Removable Vinyl Wall Sticker For Kitchen Dining Room Decor Minimalist Coffee Cup Silhouette Decal
like
Find Similar
Kitchen wall decal featuring Jesus and coffee text quote with 56cm x 32cm dimensions - 56x32cm / Black
Coffee And Jesus Quote Removable Vinyl Wall Sticker For Kitchen Dining Room Decor Minimalist Coffee Cup Silhouette Decal
$1.30
No MOQ
Halloween Horror Black Fanged Cat Wall Stickers PVC Bat Silhouette Decal For Living Room Bedroom Party Home Decor
Halloween Horror Black Fanged Cat Wall Stickers PVC Bat Silhouette Decal For Living Room Bedroom Party Home Decor
like
Find Similar
Detail of Halloween black cat and bat wall stickers with product dimensions and sizing - Fanged Kitten (PH_QTC15)
Halloween Horror Black Fanged Cat Wall Stickers PVC Bat Silhouette Decal For Living Room Bedroom Party Home Decor
$0.95
No MOQ
Go to

More in home & kitchen

Explore more in art posters

wallhangingdecorativepolyestertasselsheartgirlsheadfacewoman
living roomkidsstylecardsdisplayframelessmagneticdesignsunparty

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access