Everful

Wholesale flower clips

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Flower Clips

Find the perfect pieces: hair claws, hair clips, hair bands & headbands and more

All products in flower clips

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
18K Gold Plated Stainless Steel Hair Clips Shell Starfish Artificial Pearl Flower Waterproof Hypoallergenic Hair Accessories For Women
18K Gold Plated Stainless Steel Hair Clips Shell Starfish Artificial Pearl Flower Waterproof Hypoallergenic Hair Accessories For Women
like
Find Similar
18k gold plated stainless steel hair clip featuring three shell flowers in golden finish - Gold Three Flowers Style (NB-H1017)
18K gold plated stainless steel hair clip with textured shell design, 86mm length - Gold Textured Curved Style (NB-H1018)
Gold hammered finish stainless steel bar hair clip measuring 77mm for hair styling - Gold Hammered Pattern Style (NB-H1019)
Golden stainless steel double flower hair clip with sparkling zircon centers - Gold Double Flower Zircon Style (NB-H1020)
+19
18K Gold Plated Stainless Steel Hair Clips Shell Starfish Artificial Pearl Flower Waterproof Hypoallergenic Hair Accessories For Women
$2.97-8.41
No MOQ
 · 
34 views
Free Shipping
Tropical Hibiscus Flower Print Large Hair Claw Clip For Women Fashion Non-Slip PVC Shark Clip Hair Styling Accessory Vacation
Tropical Hibiscus Flower Print Large Hair Claw Clip For Women Fashion Non-Slip PVC Shark Clip Hair Styling Accessory Vacation
like
Find Similar
Floral PVC large hair claw clip with pink and blue tropical flowers on white base - 8.3cm / Purple Flower
Floral printed rectangle hair claw clip with tropical hibiscus pattern in white and red - 8.3cm / Pink Flower
Floral print hair claw clip with tropical hibiscus pattern for thick hair - 8.3cm / Orange Flower
Large PVC hair claw clip with colorful floral pattern for thick hair styling - 8.3cm / Dark Orange Flowers
+1
Tropical Hibiscus Flower Print Large Hair Claw Clip For Women Fashion Non-Slip PVC Shark Clip Hair Styling Accessory Vacation
$1.30
Mix MOQ : 3
Mini Rhinestone Flower Hair Claw Clips Sparkling Small Hair Pins Floral Hair Accessories For Women Girls Kids
Mini Rhinestone Flower Hair Claw Clips Sparkling Small Hair Pins Floral Hair Accessories For Women Girls Kids
like
Find Similar
Mini black metal hair claw clips with red rhinestone flower design in a pair - Red
Set of two mini black hair claw clips with pink rhinestone flower design on white background - Pink
Mini metal hair claw clips with blue and iridescent rhinestones in a flower shape - Sapphire Blue
Set of two black mini plum blossom hair claws with amber orange rhinestones decoration - Champagne
+13
Mini Rhinestone Flower Hair Claw Clips Sparkling Small Hair Pins Floral Hair Accessories For Women Girls Kids
$0.08
Mix MOQ : 8
 · 
10 views
Sweet Houndstooth Fabric Flower Hair Clip And Elastic Hair Tie For Kids Girls Pastoral Floral Fabric Hair Accessories
Sweet Houndstooth Fabric Flower Hair Clip And Elastic Hair Tie For Kids Girls Pastoral Floral Fabric Hair Accessories
like
Find Similar
Detail of plaid flower hair clips featuring blue and red houndstooth fabric texture - Orange Houndstooth Flower Hair Clip
Detail of pink houndstooth flower hair clips with checkered center on display card - Pink Houndstooth Flower Hair Clip
Detailed macro view of two sweet checkered floral hair clips on a cream display card - Blue Houndstooth Flower Hair Clip
Detail of sweet floral hair clips with purple plaid fabric petals and a safe cloth wrap - Purple Houndstooth Flower Hair Clip
+6
NewSweet Houndstooth Fabric Flower Hair Clip And Elastic Hair Tie For Kids Girls Pastoral Floral Fabric Hair Accessories
$1.10-1.33
No MOQ
Free Shipping
Rhinestone Flower Hair Clip Duckbill Hairpin Gradient Elegant Floral Headwear Resin Accessory For Women Styling
Rhinestone Flower Hair Clip Duckbill Hairpin Gradient Elegant Floral Headwear Resin Accessory For Women Styling
like
Find Similar
Elegant flower hair clip with sparkling rhinestones in brown and golden finish - Small / Champagne Coffee
Elegant duckbill hair clip featuring dual rhinestone flower designs in deep blue and silver - Large / Ink Blue Grey
Elegant flower hair clip featuring sparkling blue and champagne crystal rhinestones - Large / Ink Blue Champagne
Elegant purple rhinestone flower hair clip for women featuring dual blossoms - Small / Elegant Purple
+8
Rhinestone Flower Hair Clip Duckbill Hairpin Gradient Elegant Floral Headwear Resin Accessory For Women Styling
$1.04-1.10
No MOQ
 · 
18 views
Flower Hair Claw Clip Matte Acrylic Double Floral Design Korean Style Elegant Large Hairpins Accessories For Women
Flower Hair Claw Clip Matte Acrylic Double Floral Design Korean Style Elegant Large Hairpins Accessories For Women
like
Find Similar
Matte navy blue hair claw clip with double flower design for secure hair styling - Navy Blue
Matte brick red semi-circular hair claw clip with frosted flower design for women - Orange Red
Elegant matte black large hair claw clip featuring double 3D flower decorative design - Black
Matte ginger yellow hair claw clip with floral accents for elegant hair styling - Yellow
+7
Flower Hair Claw Clip Matte Acrylic Double Floral Design Korean Style Elegant Large Hairpins Accessories For Women
-4%
$0.69
No MOQ
 · 
61 sold recently
French Vintage Frangipani Hair Claw Clip Acrylic Flower Leopard Print Tortoiseshell Pattern Retro Hairpin For Women
French Vintage Frangipani Hair Claw Clip Acrylic Flower Leopard Print Tortoiseshell Pattern Retro Hairpin For Women
like
Find Similar
Close-up of a floral hair claw clip in grey translucent gradient finish on a plate - Smoke Gray
Detailed view of leopard print frangipani hair claw clip on a decorative plate - Light Leopard
Close-up of amber translucent leopard print flower hair claw clip on a ceramic tray - Dark Leopard Print
French Vintage Frangipani Hair Claw Clip Acrylic Flower Leopard Print Tortoiseshell Pattern Retro Hairpin For Women
$0.52
No MOQ
 · 
18 sold recently
Flower Hair Claw Clips Iridescent Plastic Resin Gradient Frangipani Shark Clip Sweet Elegant Accessories For Women
Flower Hair Claw Clips Iridescent Plastic Resin Gradient Frangipani Shark Clip Sweet Elegant Accessories For Women
like
Find Similar
Frangipani hair claw clip with orange-to-purple gradient pearl finish and matte texture - Magenta & Orange AB
Glossy gradient plumeria hair claw clip in orange and yellow hues on a white tray - Yellow & Orange-Red AB
Gradient purple and pink resin flower hair claw clip with glossy finish - Purple & Pink AB
Frangipani hair claw clip with yellow, green, and blue gradient pearlescent finish - Yellow & Teal Green AB
+2
Flower Hair Claw Clips Iridescent Plastic Resin Gradient Frangipani Shark Clip Sweet Elegant Accessories For Women
$0.45
Mix MOQ : 2
 · 
33 sold recently
Elegant Silver Metal Hair Claw Clip Alloy Shark Hair Catch Barrette Non Slip Geometric Bowknot Rose Flower For Women
Elegant Silver Metal Hair Claw Clip Alloy Shark Hair Catch Barrette Non Slip Geometric Bowknot Rose Flower For Women
like
Find Similar
Elegant silver S-curve hair claw clip with large white pearl accent and polished finish - 13# Pearl Wave Silver
Elegant large silver metal rose shark hair clip for women with strong hold design - 23# Rose Claw Silver
Minimalist silver wavy metal shark hair claw clip for women with a sleek polished finish - 15# M-Shape Silver
Polished silver metal hair claw clip in a streamlined abstract minimalist design - 21# Linear Style Silver
+8
Elegant Silver Metal Hair Claw Clip Alloy Shark Hair Catch Barrette Non Slip Geometric Bowknot Rose Flower For Women
-4%
$0.69-0.82
No MOQ
 · 
10 sold recently
Rose Flower Metal Hair Claw Clip Alloy Heart Frame Vintage French Style Elegant Nonslip Hairgrip Headpiece For Women
Rose Flower Metal Hair Claw Clip Alloy Heart Frame Vintage French Style Elegant Nonslip Hairgrip Headpiece For Women
like
Find Similar
French style metallic rose hair claw clip in gunmetal grey finish with vintage texture - Gun Black
Rose Flower Metal Hair Claw Clip Alloy Heart Frame Vintage French Style Elegant Nonslip Hairgrip Headpiece For Women
$0.75
Mix MOQ : 2
 · 
10 sold recently
Flower Hair Claw Clips Plumeria Matte Plastic Resin Large Gradient Color Summer Beach Vacation Hair Accessories For Women
Flower Hair Claw Clips Plumeria Matte Plastic Resin Large Gradient Color Summer Beach Vacation Hair Accessories For Women
like
Find Similar
Sky blue frangipani flower hair claw clip with 7.5cm diameter for summer beach styling - Blue
Summer vacation plumeria hair claw clip in white and yellow for beach styling - Yellow/White
Pink frangipani flower hair claw clip with matte finish for summer beach vacation style - Pink
Yellow plumeria flower hair claw clip, 7.5cm matte finish summer hair accessory - Yellow
+14
Flower Hair Claw Clips Plumeria Matte Plastic Resin Large Gradient Color Summer Beach Vacation Hair Accessories For Women
$0.49
No MOQ
 · 
18 views
Women Fashion UV Printed Flower Hair Claw Clip Sweet Frangipani Heart Bow Pattern Shark Clip For Seaside Holiday Accessory
Women Fashion UV Printed Flower Hair Claw Clip Sweet Frangipani Heart Bow Pattern Shark Clip For Seaside Holiday Accessory
like
Find Similar
Detail of lavender gradient hair claw clip with white heart patterns and floral decor - Purple Gradient Heart (10.5cm)
Detail view of large pastel hair claw clip with colorful UV heart prints and lucky motifs - Multicolor Gradient Lucky Sun Style (165-2)
Macro detail of gradient purple hair claw clip with lucky text and colorful heart patterns - Dreamy Gradient Lucky Heart Style (165-3)
Detail of marble pink hair claw clip featuring Happy Day text and smile pattern - Pink Gray Marble Smile Style (165-4)
+98
Women Fashion UV Printed Flower Hair Claw Clip Sweet Frangipani Heart Bow Pattern Shark Clip For Seaside Holiday Accessory
-5%
$0.38-0.41
No MOQ
Plumeria Flower Hair Claw Clip Acrylic Gradient Color Non-Slip Beach Holiday Hair Styling Accessory For Women
Plumeria Flower Hair Claw Clip Acrylic Gradient Color Non-Slip Beach Holiday Hair Styling Accessory For Women
like
Find Similar
Translucent grey-green frangipani flower hair claw clip with sparkly gold glitter finish - Transparent Black
Blue gradient acrylic plumeria hair claw clip with silver glitter and metal spring - Transparent Blue
Pink and green gradient frangipani flower hair claw clip with subtle glitter finish - Transparent Cyan
Pink gradient frangipani hair claw clip on a white plate with tropical green leaves - Orange Flower
+13
Plumeria Flower Hair Claw Clip Acrylic Gradient Color Non-Slip Beach Holiday Hair Styling Accessory For Women
$0.57
No MOQ
 · 
59 sold recently
Leopard Flower Hair Clips And Hair Ties Rhinestone Inlaid Cellulose Acetate Duckbill Clips Korean Style For Women Girls
Leopard Flower Hair Clips And Hair Ties Rhinestone Inlaid Cellulose Acetate Duckbill Clips Korean Style For Women Girls
like
Find Similar
Detail of leopard print flower hair clip with rhinestones and France Handmade text - 1# Coffee Bead Duckbill Clip
Leopard print flower hair tie with rhinestones and elastic band for women - 4# Coffee Bead Hair Tie
Detail of leopard print flower hair tie with green bead and sparkling rhinestones - 6# Green Bead Hair Tie
Macro shot of leopard print acetate flower clip with rhinestones and handmade engraving - 2# Black Bead Duckbill Clip
Leopard Flower Hair Clips And Hair Ties Rhinestone Inlaid Cellulose Acetate Duckbill Clips Korean Style For Women Girls
-4%
$0.77-0.96
No MOQ
 · 
16 sold recently
Tulip Flower Hair Claw Clip Elegant Metal Alloy Shark Clip Artificial Pearl Rhinestone Hairpin For Women Sweet Floral Hair Accessories
Tulip Flower Hair Claw Clip Elegant Metal Alloy Shark Clip Artificial Pearl Rhinestone Hairpin For Women Sweet Floral Hair Accessories
like
Find Similar
Elegant gold metal tulip hair claw clip with white pearls for women's hairstyles - Pearl Style
Golden tulip hair claw clip with inlaid pearls and rhinestones in hand display - Pearl & Rhinestone Style
Golden tulip hair claw clip with rhinestones and pearls for women elegant hair accessory - Zirconia Style
Tulip Flower Hair Claw Clip Elegant Metal Alloy Shark Clip Artificial Pearl Rhinestone Hairpin For Women Sweet Floral Hair Accessories
$1.41
No MOQ
 · 
12 views
Double Flower Hair Clip Acrylic Frosted Matte Rhinestone Duckbill Hairpin Korean Style Elegant Accessories For Women Girls
Double Flower Hair Clip Acrylic Frosted Matte Rhinestone Duckbill Hairpin Korean Style Elegant Accessories For Women Girls
like
Find Similar
Close-up of dark brown floral hair clip with inlaid sparkling rhinestones for women - Brown
Close-up of elegant matte black acrylic hair clip with double flower and rhinestones - Classic Black
Elegant dark green acrylic floral hair claw clip with silver rhinestones and matte finish - Green
Double Flower Hair Clip Acrylic Frosted Matte Rhinestone Duckbill Hairpin Korean Style Elegant Accessories For Women Girls
$0.32
No MOQ
 · 
22 sold recently
Sweet Fruit Print Flower Hair Clip Plastic Shark Claw Clip Tropical Vacation Style Fresh Headwear Hair Accessory For Women
Sweet Fruit Print Flower Hair Clip Plastic Shark Claw Clip Tropical Vacation Style Fresh Headwear Hair Accessory For Women
like
Find Similar
Detailed set of three yellow tropical plumeria flower hair clips on a display card - Plumeria Floral Style (162-1) / Large And Small Clips Combination
Three-piece hair clip set featuring pitaya dragon fruit pattern on a display card - Dragon Fruit Style (162-2) / Large And Small Clips Combination
Detailed view of green kiwi-patterned flower hair clips on a white presentation card - Kiwi Fruit Style (162-3) / Large And Small Clips Combination
Close-up of lemon print flower hair clips set including one large and two small claw clips - Lemon Style (162-4) / Large And Small Clips Combination
+14
Sweet Fruit Print Flower Hair Clip Plastic Shark Claw Clip Tropical Vacation Style Fresh Headwear Hair Accessory For Women
$0.20-0.86
No MOQ
Flower Hair Claw Clip Fabric Handmade Camellia Rose Butterfly Decor Elegant Sweet Hairpins For Women Holiday Accessories
Flower Hair Claw Clip Fabric Handmade Camellia Rose Butterfly Decor Elegant Sweet Hairpins For Women Holiday Accessories
like
Find Similar
Pink fabric camellia flower hair claw clip worn by a model in an outdoor setting - Pink Camellia (Large Claw)
Red fabric flower hair claw clip shown worn on back of head in a casual car setting - Red Double Flower (Large Claw)
Elegant large black fabric flower hair claw clip worn by a model in warm indoor lighting - Black Large Flower (Large Claw)
Detail of pink fabric rose hair clip showing layers of petals on side braided hairstyle - Pink Gradient Camellia (Duckbill Clip)
+8
Flower Hair Claw Clip Fabric Handmade Camellia Rose Butterfly Decor Elegant Sweet Hairpins For Women Holiday Accessories
$0.89-3.46
No MOQ
Free Shipping
Alloy Flower Bowknot Hair Clip With Artificial Pearls And Rhinestones Elegant Spring Clip Ponytail Holder Accessories For Women
Alloy Flower Bowknot Hair Clip With Artificial Pearls And Rhinestones Elegant Spring Clip Ponytail Holder Accessories For Women
like
Find Similar
Rose gold bow hair clip with white pearls and sparkling rhinestone leaf details - Large 5 Pearls White
Golden leaf hair clip with white pearls and purple rhinestones on a white background - Large 5 Pearls Purple
Large butterfly hair clip with elegant pearls and blue gradient rhinestones on metal base - Large 5 Pearls Blue
Golden hair clip with white pearls and pink rhinestones in elegant branch design - Large 5 Pearls Pink
+6
Alloy Flower Bowknot Hair Clip With Artificial Pearls And Rhinestones Elegant Spring Clip Ponytail Holder Accessories For Women
$0.97
No MOQ
 · 
12 sold recently
Plumeria Flower Hair Claw Clip Resin Gradient Colorful Summer Beach Vacation Hair Styling Accessory For Women
Plumeria Flower Hair Claw Clip Resin Gradient Colorful Summer Beach Vacation Hair Styling Accessory For Women
like
Find Similar
8cm plumeria flower hair claw clip with yellow and white gradient finish on white background - Milky Yellow
Tropical white and orange gradient plumeria flower hair claw clip in resin - Lotus root pink
Pink and orange gradient plumeria flower hair claw clip for elegant bun hairstyles - Watermelon red
8cm purple gradient plumeria hair claw clip with glossy resin flower design for women - Lavender Purple
+2
Plumeria Flower Hair Claw Clip Resin Gradient Colorful Summer Beach Vacation Hair Styling Accessory For Women
$0.46
Mix MOQ : 5
 · 
214 sold recently
Matte Flower Hair Claw Clip Large Five Petal ABS Plastic Frosted Shark Clip Non-Slip Hair Accessories For Women Daily Party
Matte Flower Hair Claw Clip Large Five Petal ABS Plastic Frosted Shark Clip Non-Slip Hair Accessories For Women Daily Party
like
Find Similar
Neon green matte flower hair claw clip with durable metal spring for daily styling - Bulk Packaging / Flower Motif Style / Grass Green
Matte orange flower hair claw clip with large shark teeth design for thick hair - Bulk Packaging / Flower Motif Style / Orange Red
Matte dark brown flower hair claw clip with elegant five-petal floral design - Bulk Packaging / Flower Motif Style / Dark Brown
Macro shot of a translucent flower-shaped hair claw clip with a gold metal spring - Bulk Packaging / Flower Motif Style / Clear
+80
Matte Flower Hair Claw Clip Large Five Petal ABS Plastic Frosted Shark Clip Non-Slip Hair Accessories For Women Daily Party
$0.40-0.43
No MOQ
Flower Hair Claw Clips Matte Gradient Acrylic Iridescent Plumeria Shape Strong Hold Hair Clamps For Women Girls Accessories
Flower Hair Claw Clips Matte Gradient Acrylic Iridescent Plumeria Shape Strong Hold Hair Clamps For Women Girls Accessories
like
Find Similar
Detailed macro view of holographic gradient flower hair claw clip with transparent texture - Iridescent Grey
Detailed view of iridescent floral hair claw clip with rainbow finish on white porcelain - Iridescent Transparent White
Detail of blue iridescent flower claw clip with gradient multi-color luster finish - Iridescent Light Blue
Macro view of translucent iridescent flower hair claw clip with golden metal spring - Iridescent Yellow
+42
Flower Hair Claw Clips Matte Gradient Acrylic Iridescent Plumeria Shape Strong Hold Hair Clamps For Women Girls Accessories
$0.43
No MOQ
 · 
11 views
Cute Cartoon Dog UV Printed Hair Claw Clips For Women ABS Flower Square Shape Large Shark Clips Hair Accessories
Cute Cartoon Dog UV Printed Hair Claw Clips For Women ABS Flower Square Shape Large Shark Clips Hair Accessories
like
Find Similar
Close-up of cream floral hair claw clip featuring cute dachshund dog and pink heart prints - 8cm Printed Plumeria Style 1
Detail of flower hair claw clip with colorful cartoon dog prints and purple dog text - 8cm Printed Plumeria Style 2
Detail of white flower hair claw clip with cute cartoon dachshund prints and pet slogan - 8cm Printed Plumeria Style 3
Detail showing cartoon dachshund dog UV print on white flower-shaped hair claw clip - 8cm Printed Plumeria Style 4
+20
Cute Cartoon Dog UV Printed Hair Claw Clips For Women ABS Flower Square Shape Large Shark Clips Hair Accessories
-5%
$0.38-0.41
No MOQ
Fashion Frangipani Flower Hair Claw Clip For Women Holiday Style Marble Texture Glitter Edge PS Resin Hairpin Hair Accessories
Fashion Frangipani Flower Hair Claw Clip For Women Holiday Style Marble Texture Glitter Edge PS Resin Hairpin Hair Accessories
like
Find Similar
Detailed view of pink marble resin plumeria hair claw clip with sparkly glitter edges - Pink Purple
Detailed view of blue marble plumeria hair claw with silver glitter edges and translucent finish - Grey Blue
Detailed close-up of a white flower hair claw clip with silver glitter petal edges - Beige
Close-up of blue marble-textured frangipani hair claw with silver glitter edges - Lake Blue
+16
Fashion Frangipani Flower Hair Claw Clip For Women Holiday Style Marble Texture Glitter Edge PS Resin Hairpin Hair Accessories
-4%
$0.44
No MOQ
Flower Hair Claw Clips Acrylic Plumeria Gradient Summer Beach Vacation Elegant Non-Slip Hair Styling For Women
Flower Hair Claw Clips Acrylic Plumeria Gradient Summer Beach Vacation Elegant Non-Slip Hair Styling For Women
like
Find Similar
Detail of purple acrylic floral hair claw clip on a rustic woven background for summer - Purple
Detail of tropical frangipani hair claw clip with white resin petals and yellow center - White
Detailed close-up of a three-flower acrylic hair claw clip with pink gradient petals - Pink
Detail of yellow translucent acrylic frangipani hair claw clip for summer resort styling - Yellow
Flower Hair Claw Clips Acrylic Plumeria Gradient Summer Beach Vacation Elegant Non-Slip Hair Styling For Women
$0.58
No MOQ
 · 
15 sold recently
Handmade Crochet Hair Clips Cute Cartoon Bear Fruit Flower BB Clips For Kids Girls Sweet Pastoral Style Hair Accessories
Handmade Crochet Hair Clips Cute Cartoon Bear Fruit Flower BB Clips For Kids Girls Sweet Pastoral Style Hair Accessories
like
Find Similar
Macro shot of handcrafted crochet painter's palette hair clip with colorful wool details - Handmade Crochet BB-Palette
Close-up of handmade crochet bear hair clip with a red wool hat and blue bow detail - Handmade Crochet BB-Bear
Close-up of a handmade red knitted hair clip with white scalloped edges on a wooden tray - Handmade Crochet BB-Red Orange
Detailed macro view of a handmade crochet hair clip with orange fruit and blue base - Handmade Crochet BB-Blue Peach
+10
Handmade Crochet Hair Clips Cute Cartoon Bear Fruit Flower BB Clips For Kids Girls Sweet Pastoral Style Hair Accessories
$0.86-1.15
No MOQ
Free Shipping
Marble Pattern Plumeria Flower Hair Claw Clip For Women ABS UV Printed Frangipani Hair Shark Clip Elegant Hair Accessory
Marble Pattern Plumeria Flower Hair Claw Clip For Women ABS UV Printed Frangipani Hair Shark Clip Elegant Hair Accessory
like
Find Similar
Elegant marble pattern white flower hair claw clip with blue and yellow highlights - 8cm UV Printed Plumeria - ABS Beige 23-3
Elegant frangipani hair claw clip with blue marble pattern on white resin petals - 8cm UV Printed Plumeria - ABS Beige 23-4
Elegant marble pattern plumeria hair claw clip with creamy white and gold finish - 8cm UV Printed Plumeria - ABS Beige 23-5
Blue and white gradient frangipani hair claw clip with yellow center in resin finish - 8cm UV Printed Plumeria - ABS Beige 27-1
+28
Marble Pattern Plumeria Flower Hair Claw Clip For Women ABS UV Printed Frangipani Hair Shark Clip Elegant Hair Accessory
-5%
$0.49
No MOQ
Matte Mini Hair Claw Clips Collection For Women Girls Korean Style Small Flower Bear Heart Shape Geometric Hairpins Accessories
Matte Mini Hair Claw Clips Collection For Women Girls Korean Style Small Flower Bear Heart Shape Geometric Hairpins Accessories
like
Find Similar
Detailed view of matte flower mini claw clips in a clear storage box, multiple colors - Flower Warm Tone Style (Boxed)
Mini matte hair clips set in colorful Morandi tones with transparent storage box - Pumpkin Warm Tone Style (Boxed)
Set of mini matte hair claws in macaron colors displayed in clear packaging box - Square Warm Tone Style (Boxed)
Detailed set of mini matte hair claws in Morandi colors with a transparent storage box - Crescent Warm Tone Style (Boxed)
+27
Matte Mini Hair Claw Clips Collection For Women Girls Korean Style Small Flower Bear Heart Shape Geometric Hairpins Accessories
-4%
$0.88
No MOQ
Mini Hair Claw Clips Colorful Plastic Candy Color Cute Small Hairpins Hair Accessories For Kids Girls Flower Star Crown
Mini Hair Claw Clips Colorful Plastic Candy Color Cute Small Hairpins Hair Accessories For Kids Girls Flower Star Crown
like
Find Similar
Detailed view of colorful flower mini hair claws in a transparent plastic storage box - 1-Daisy 20pcs Mixed Colors
Top view of multi-colored flower mini hair claws inside a transparent plastic storage box - 2-Four-leaf Clover 20pcs Mixed Colors
Close-up of mini crown-shaped hair claws in assorted macaron colors with storage box - 3-Crown 20pcs Mixed Colors
Close-up of colorful flower-shaped mini hair claws in a transparent storage box - 4-Small Flower 20pcs Mixed Colors
+4
Mini Hair Claw Clips Colorful Plastic Candy Color Cute Small Hairpins Hair Accessories For Kids Girls Flower Star Crown
$0.81
Mix MOQ : 2
 · 
40 sold recently
Flower Hair Clips Acrylic Resin Colorful Floral Matte Korean Style Hairpins Barrettes Side Clips For Girls Kids Toddlers
Flower Hair Clips Acrylic Resin Colorful Floral Matte Korean Style Hairpins Barrettes Side Clips For Girls Kids Toddlers
like
Find Similar
Detail of mint green flower hair clip on beige linen cloth with a natural wood background - Grass Green
Close-up of a blue flower hair clip with hollow center on a rustic linen background - Dark Blue
Detail of single green flower hair clip on rustic linen mat with natural studio lighting - Fruit Green
Close-up of a pink floral hair clip with metal base on rustic linen fabric background - Light Pink
+6
Flower Hair Clips Acrylic Resin Colorful Floral Matte Korean Style Hairpins Barrettes Side Clips For Girls Kids Toddlers
$0.46
No MOQ
 · 
38 sold recently
Free Shipping
Large Hair Claw Clip Resin Connected Flower Design Gradient Translucent Matte Summer Style Accessory For Women
Large Hair Claw Clip Resin Connected Flower Design Gradient Translucent Matte Summer Style Accessory For Women
like
Find Similar
Three-flower claw clip with gradient blue-green petals and yellow stamens on wood - Triple Five-Petal Flowers / Blue
Pink translucent resin hair claw clip with three layered frangipani gradient flowers - Triple Five-Petal Flowers / Rose Red
Pink gradient resin hair claw clip with three frangipani flowers on a wooden stand - Triple Five-Petal Flowers / Watermelon red
Three-flower hair claw clip featuring white to orange gradient plumeria design - Triple Five-Petal Flowers / Orange
+8
Large Hair Claw Clip Resin Connected Flower Design Gradient Translucent Matte Summer Style Accessory For Women
$0.39
Mix MOQ : 2
French Retro Rose Flower Hair Clip Satin Bow Long Ribbon Tassel Hair Rope Elegant Balletcore Style Accessories For Women
French Retro Rose Flower Hair Clip Satin Bow Long Ribbon Tassel Hair Rope Elegant Balletcore Style Accessories For Women
like
Find Similar
Detailed close-up of a handmade red 3D satin rose with long black ribbon ties - Hair Tie / Black Ribbon Red Rose
Pink ribbon bow hair clips with cream rose detail and long flowing satin streamers - Hair Clip / Pink Ribbon White Rose
Elegant light blue ribbon bow hair clip with a cream rose and long flowing streamers - Hair Clip / Blue Ribbon White Rose
Detail of elegant black ribbon bow hair ties with handmade red roses and velvet texture - Hair Clip / Black Ribbon Red Rose
French Retro Rose Flower Hair Clip Satin Bow Long Ribbon Tassel Hair Rope Elegant Balletcore Style Accessories For Women
$0.37
No MOQ
Tropical Plumeria Flower Hair Claw Clip For Women Gradient Color Lacquered Plastic Hair Clamp For Summer Beach Vacation
Tropical Plumeria Flower Hair Claw Clip For Women Gradient Color Lacquered Plastic Hair Clamp For Summer Beach Vacation
like
Find Similar
Pink and orange gradient frangipani hair claw clip with glossy resin finish - Bulk Packaging / Coral
Close-up of orange gradient flower hair claw clip with a glossy finish for hair styling - Bulk Packaging / Orange Gradient
Frangipani hair claw clip with yellow and white gradient finish for tropical styling - Bulk Packaging / Yellow Gradient
Macro detail of a gradient purple and yellow plumeria flower hair claw clip on white - Bulk Packaging / Fuchsia Gradient
+22
NewTropical Plumeria Flower Hair Claw Clip For Women Gradient Color Lacquered Plastic Hair Clamp For Summer Beach Vacation
$0.57-0.60
No MOQ
Flower Hair Claw Clip Matte Plastic Frangipani Large Shark Hairpin For Women Elegant Headwear Accessories
Flower Hair Claw Clip Matte Plastic Frangipani Large Shark Hairpin For Women Elegant Headwear Accessories
like
Find Similar
Matte flower hair clip in light pink plastic finish for elegant hairstyling - Bulk Packaging / Matte-Milk White
Matte light green flower hair claw clip with sleek duckbill design and plastic finish - Bulk Packaging / Matte-Green
Matte orange frangipani flower hair claw clip for elegant women styling - Bulk Packaging / Matte-Yellow
Matte pink flower hair claw clip with frosted texture for elegant updo hairstyles - Bulk Packaging / Matte-Lotus Pink
+8
Flower Hair Claw Clip Matte Plastic Frangipani Large Shark Hairpin For Women Elegant Headwear Accessories
$0.57-0.60
No MOQ
Flower And Round Bead Hair Clips Plastic Resin Candy Color Korean Style For Kids Girls Sweet Daily Hairpieces
Flower And Round Bead Hair Clips Plastic Resin Candy Color Korean Style For Kids Girls Sweet Daily Hairpieces
like
Find Similar
Detail of colorful floral and bead hair clips for girls set on a green card - Flower and Bead / Green
Cute Korean floral and beaded hair clips set for girls on a purple display card - Flower and Bead / Purple
Set of 2 colorful flower and bead hair clips for girls on a white card display - Flower and Bead / Pink Scalloped
Detail of cute flower and bead hair clips on pink display card for young girls - Checkerboard Flower / Pink Plaid
+2
Flower And Round Bead Hair Clips Plastic Resin Candy Color Korean Style For Kids Girls Sweet Daily Hairpieces
$0.55
No MOQ
Hair Clips Acetate Resin Alloy Rhinestone Flower Star Heart Wing Duckbill Barrettes French Vintage Elegant For Women
Hair Clips Acetate Resin Alloy Rhinestone Flower Star Heart Wing Duckbill Barrettes French Vintage Elegant For Women
like
Find Similar
Purple metal hair clip with sparkling pink rhinestones and a star pattern design - Purple Star
Pink resin hair clip with flower rhinestones and minimalist Korean duckbill design - Rice Pink Diamond
Red flower hair clip with heart rhinestone detail in protective packaging - Red Heart
Elegant black hair clip featuring a heart pattern made of sparkling rhinestones - Black Heart
+15
Hair Clips Acetate Resin Alloy Rhinestone Flower Star Heart Wing Duckbill Barrettes French Vintage Elegant For Women
$1.32-2.01
No MOQ
Free Shipping
Flower Hair Claw Clips Gradient Plumeria Frangipani Acrylic Transparent Large Shark Hairpin Accessories For Women
Flower Hair Claw Clips Gradient Plumeria Frangipani Acrylic Transparent Large Shark Hairpin Accessories For Women
like
Find Similar
Detail of purple gradient plumeria hair claw clip with a strong metal spring mechanism - 1# Purple Gradient
Close-up of translucent gradient blue plumeria hair claw clip with glossy resin finish - 2# Retro Blue
Translucent yellow and green gradient plumeria hair claw clip for elegant styling - 3# Corn Yellow
Pink translucent frangipani hair claw clip with a glossy gradient resin flower finish - 4# Transparent Pink
+9
Flower Hair Claw Clips Gradient Plumeria Frangipani Acrylic Transparent Large Shark Hairpin Accessories For Women
$0.46
Mix MOQ : 2
 · 
11 views
Elegant Large Flower Banana Hair Clip Fabric Chiffon Floral Ponytail Holder Handmade Styling Accessory For Women
Elegant Large Flower Banana Hair Clip Fabric Chiffon Floral Ponytail Holder Handmade Styling Accessory For Women
like
Find Similar
Large burgundy fabric flower banana hair clip showing side and back styling views - Burgundy
Close-up of a large bright yellow artificial flower hair clip with layered petals detail - Yellow
Detailed view of the purple multi-layered chiffon flower headband for women hair accessory - Purple
Detailed view of large fabric flower banana hair clips in red, black, and lavender tones - Black
Elegant Large Flower Banana Hair Clip Fabric Chiffon Floral Ponytail Holder Handmade Styling Accessory For Women
$2.16
No MOQ
Flower Hair Claw Clip Matte Acrylic Shark Hairpin Non Slip Styling Tool For Women Girls Elegant Hollow Out Design
Flower Hair Claw Clip Matte Acrylic Shark Hairpin Non Slip Styling Tool For Women Girls Elegant Hollow Out Design
like
Find Similar
Macro view of matte black floral hair claw clip with cutout five-petal flower design - Bulk Packaging / Hollow-Black
Macro view of a translucent pink flower hair claw clip with a durable metal spring - Bulk Packaging / Solid - Jelly Pink
Matte peach pink flower hair claw clip in translucent acrylic for elegant hair styling - Bulk Packaging / Solid - Jelly Orange
Detailed macro view of pink matte flower hair claw clip with sturdy metal spring mechanism - Bulk Packaging / Hollow - Pink
+106
Flower Hair Claw Clip Matte Acrylic Shark Hairpin Non Slip Styling Tool For Women Girls Elegant Hollow Out Design
$0.39-0.42
No MOQ
Flower Hair Claw Clip Acetate Marble Texture Strong Hold Non Slip Hair Jaw Clip Hair Accessories For Women Girls Korean Style
Flower Hair Claw Clip Acetate Marble Texture Strong Hold Non Slip Hair Jaw Clip Hair Accessories For Women Girls Korean Style
like
Find Similar
Detail shot of the pink marble floral hair claw clip with smooth acetate texture - Light Pink
Macro detail of cream-white marble texture acetate flower hair claw clip with golden spring - Off White
Macro shot of purple flower claw clip with white marble ink texture detail - Light Purple
Detailed macro view of mint green marble flower hair claw clip with resin texture - Fresh Green
+6
Flower Hair Claw Clip Acetate Marble Texture Strong Hold Non Slip Hair Jaw Clip Hair Accessories For Women Girls Korean Style
$0.69
No MOQ
 · 
49 sold recently
Elegant Alloy Wheat Ear Flower Hair Claw Clip For Women Metal Artificial Pearl Rhinestone Drip Oil Tulip Strawberry Hair Clip Accessories
Elegant Alloy Wheat Ear Flower Hair Claw Clip For Women Metal Artificial Pearl Rhinestone Drip Oil Tulip Strawberry Hair Clip Accessories
like
Find Similar
Detail of elegant gold wheat-shaped hair claw with yellow and green enamel finish - Large Wheat Claw-Enamel Style
Close-up of golden wheat ear hair claw clip with yellow rhinestones and green enamel leaves - Large Wheat Claw-Full Rhinestone Style
Detailed view of the yellow sunflower metal hair claw clip with colorful enamel and rhinestones - Enamel Sunflower
Detail of elegant gold tulip hair claw clip with pink enamel petals and green leaf accents - Enamel Dusty Pink Tulip
+18
Elegant Alloy Wheat Ear Flower Hair Claw Clip For Women Metal Artificial Pearl Rhinestone Drip Oil Tulip Strawberry Hair Clip Accessories
$1.03-2.10
No MOQ
Elegant Flower Butterfly Hair Claw Clip With Long Faux Artificial Pearl Tassel Alloy Rhinestone Hair Accessories For Women
Elegant Flower Butterfly Hair Claw Clip With Long Faux Artificial Pearl Tassel Alloy Rhinestone Hair Accessories For Women
like
Find Similar
Detailed view of metal hair claw with white lotus flowers and pearl tassels - G4 Rhinestone Curtain Flower
Macro shot of a floral pearl hair claw with tassels and detailed size specifications - M35 White Five-petal Flower
Detail of red rose hair claw with white pearls and long gold tassel fringe, 5cm diameter - M34 Red Rose
Detail of red velvet rose hair claw with butterfly crystals and pearl tassels - M36 Cherry Artificial Pearl
+8
Elegant Flower Butterfly Hair Claw Clip With Long Faux Artificial Pearl Tassel Alloy Rhinestone Hair Accessories For Women
-6%
$0.86
No MOQ
 · 
30 views
Flower Hair Claw Clips Matte Translucent Resin Plumeria Sunflower Hair Clips For Women Beach Vacation Hair Accessories
Flower Hair Claw Clips Matte Translucent Resin Plumeria Sunflower Hair Clips For Women Beach Vacation Hair Accessories
like
Find Similar
Detailed top view of a yellow plumeria flower hair claw clip on a white fabric surface - Light Yellow Sunflower
Close-up of translucent ice blue frangipani flower hair claw clip with orange center - Blue Sunflower
Macro detail of purple gradient plumeria hair claw clip with acetate flower texture - White Purple Core Sunflower
Detailed top view of pink gradient sunflower hair claw clip with semi-transparent petals - Pink Sunflower
+8
Flower Hair Claw Clips Matte Translucent Resin Plumeria Sunflower Hair Clips For Women Beach Vacation Hair Accessories
$0.52
No MOQ
Elegant Acetic Acid Flower Hair Claw Clip With Artificial Pearl Korean Style Sweet Floral Hair Accessories For Women
Elegant Acetic Acid Flower Hair Claw Clip With Artificial Pearl Korean Style Sweet Floral Hair Accessories For Women
like
Find Similar
Close-up of translucent yellow flower hair claw clip with a silver pearl center - Mermaid Color
Elegant tortoiseshell flower hair claw clip with central pearl accent for women - Blue Brown Gradient
Detail of smoky gray acetic acid hair claw with white pearl center flower design - Gray
Detailed macro view of acetate floral hair claw clip with pearl center and green shimmer - Pink and Green
+2
Elegant Acetic Acid Flower Hair Claw Clip With Artificial Pearl Korean Style Sweet Floral Hair Accessories For Women
-4%
$2.55
No MOQ
Free Shipping
Alloy Gold Plated Artificial Cat Eye Rhinestone Hair Clips Butterfly Flower Leaf Shapes Elegant Hair Accessories For Women
Alloy Gold Plated Artificial Cat Eye Rhinestone Hair Clips Butterfly Flower Leaf Shapes Elegant Hair Accessories For Women
like
Find Similar
Elegant gold butterfly hair clip set with cat eye stones and rhinestones for women - Butterfly Style
Detailed close-up of gold butterfly hair clips set with cream cat-eye stones - Teardrop Butterfly Style
Detailed macro view of two gold rabbit ear hair clips with cream cat-eye stones - Rabbit Style
Elegant gold hair clip set with cat eye stones and flower leaf design on card - Floral Style
Alloy Gold Plated Artificial Cat Eye Rhinestone Hair Clips Butterfly Flower Leaf Shapes Elegant Hair Accessories For Women
-5%
$1.15-1.31
No MOQ
Colorful Rhinestone Hair Clips Alloy Sparkling Flower Geometric Bobby Pins Fashion Hair Accessories For Women Girls
Colorful Rhinestone Hair Clips Alloy Sparkling Flower Geometric Bobby Pins Fashion Hair Accessories For Women Girls
like
Find Similar
Colorful rhinestone gold hair clip set with vibrant crystals for women fashion styling - Flower Style / Gold/Multicolor
Golden alloy hair clips set with colorful rhinestones in yellow, blue and pink - Geometric Style / Gold/Multicolor
Golden bobby pin with colorful crystals in red, blue, and orange on white background - Round Style / Gold/Multicolor
Colorful Rhinestone Hair Clips Alloy Sparkling Flower Geometric Bobby Pins Fashion Hair Accessories For Women Girls
-4%
$0.69-0.88
Mix MOQ : 2
French Style Acetate Flower Duckbill Hair Clip Elegant Rhinestone Side Clip For Women Handmade Floral Bangs Clip Hair Accessories
French Style Acetate Flower Duckbill Hair Clip Elegant Rhinestone Side Clip For Women Handmade Floral Bangs Clip Hair Accessories
like
Find Similar
Detailed macro view of the handmade acetate floral hair clip with crystal stamen decoration - Acetate Rhinestone Flower Hair Clip / Blue Pink
Detailed close-up of brown acetate floral hair clip with crystal rhinestones on a metal grip - Acetate Rhinestone Flower Hair Clip / Coffee
Detail of golden metal hair clip with France Handmade engraving and black acrylic petals - Acetate Rhinestone Flower Hair Clip / Blue and Purple
Close-up of floral acetate hair clip with rhinestones and France Handmade gold metal detail - Acetate Rhinestone Flower Hair Clip / Clear White
+1
French Style Acetate Flower Duckbill Hair Clip Elegant Rhinestone Side Clip For Women Handmade Floral Bangs Clip Hair Accessories
$1.15
No MOQ
Free Shipping
Elegant Acrylic Plastic Hair Claw Clips Shark Clips Floral Flower Heart Star Design Hair Accessories For Women
Elegant Acrylic Plastic Hair Claw Clips Shark Clips Floral Flower Heart Star Design Hair Accessories For Women
like
Find Similar
Hair claw clip with colorful rainbow beads for women styling a classic bun hairstyle - 10# Hair Claw-White-Small Round
Transparent hair claw clip with colorful beads on hair, Korean style fashion accessory - 12# Hair Claw-White-Large Round
Side view of a floral hair claw clip with cream pearls on an elegant updo hairstyle - 13# Hair Claw-Pink Flower
Detail of large grey and white fabric flowers on hair claw clip worn by a model - 14# Hair Claw-Grey Flower
+17
Elegant Acrylic Plastic Hair Claw Clips Shark Clips Floral Flower Heart Star Design Hair Accessories For Women
$0.77-3.30
No MOQ
Mini Flower Hair Claws Candy Color Matte Acrylic Daisy Sunflower Small Hair Clips Sweet Korean Style For Kids
Mini Flower Hair Claws Candy Color Matte Acrylic Daisy Sunflower Small Hair Clips Sweet Korean Style For Kids
like
Find Similar
Pastel flower mini hair claws set on a decorative mirror with white display card - Five-Petal Flower
Matte candy-colored daisy flower hair clips in a colorful set on a display card - Daisy
Colorful candy-colored daisy hair clips for kids in a variety pack with pastel tones - Sunflower
Mini Flower Hair Claws Candy Color Matte Acrylic Daisy Sunflower Small Hair Clips Sweet Korean Style For Kids
$1.30
No MOQ
 · 
15 views
Vintage Alloy Heart Flower Hair Clips For Women Rhinestone Faux Artificial Pearl Duckbill Clips Elegant Black Gold Hair Barrettes Accessories
Vintage Alloy Heart Flower Hair Clips For Women Rhinestone Faux Artificial Pearl Duckbill Clips Elegant Black Gold Hair Barrettes Accessories
like
Find Similar
Detail view of heart shaped floral hair clip with marble and crystal stones on beige linen - Heart Marble & Grey Crystal Style
Detailed macro view of silver floral hair clip with black gems and sparkling crystals - Black Five-Petal Flower Style
Macro shot of vintage leaf-shaped hair clip with black gems and grey rhinestones - Black Marquise Gem Leaf Style
Detailed view of elegant black gemstone and pearl hair clip on beige velvet tray - Black Oval Gem & Grey Pearl Style
+19
Vintage Alloy Heart Flower Hair Clips For Women Rhinestone Faux Artificial Pearl Duckbill Clips Elegant Black Gold Hair Barrettes Accessories
$0.52-1.04
Mix MOQ : 2
Handmade Lily Of The Valley Flower Tassel Hair Clip Satin Fabric Floral Duckbill Clip Imitation Pearl Elegant Accessory
Handmade Lily Of The Valley Flower Tassel Hair Clip Satin Fabric Floral Duckbill Clip Imitation Pearl Elegant Accessory
like
Find Similar
Detail of purple silk lily of the valley hair clip with elegant pearl tassel charms - Purple
Detail of cream Lily of the Valley hair clip with pearl tassels and petal textures - White
Handmade Lily Of The Valley Flower Tassel Hair Clip Satin Fabric Floral Duckbill Clip Imitation Pearl Elegant Accessory
$6.05
No MOQ
Free Shipping
Matte Flower Hair Claw Clip Large Multi Petal Plastic Candy Color Non Slip Hair Accessory For Women Girls Updo Styling
Matte Flower Hair Claw Clip Large Multi Petal Plastic Candy Color Non Slip Hair Accessory For Women Girls Updo Styling
like
Find Similar
Large yellow flower claw clip hair accessory worn by model at a sunny summer beach side - Yellow
Matte pink flower hair claw clip worn by a model against a beach and blue sky backdrop - Pink
Matte soft pink flower claw clip in a five-petal design for hair styling buns - Rose Red
Detail of green matte flower hair claw clip on aesthetic white decorative background - Green
+5
Matte Flower Hair Claw Clip Large Multi Petal Plastic Candy Color Non Slip Hair Accessory For Women Girls Updo Styling
$0.40
No MOQ
 · 
106 sold recently
UV Printed Plumeria Flower Hair Claw Clip Sweet Fruit Cartoon Dinosaur Pattern ABS Large Shark Clip For Women Hair Styling
UV Printed Plumeria Flower Hair Claw Clip Sweet Fruit Cartoon Dinosaur Pattern ABS Large Shark Clip For Women Hair Styling
like
Find Similar
Detail of floral hair claw clip with watermelon print on glossy white acetate finish - Watermelon Print (146-1)
Detailed view of floral hair claw clip featuring fresh lemon print and white petals - Lemon Slice Print (146-2)
Detailed view of flower hair claw clip with yellow lemon and green leaf UV prints - Lemon Print (146-3)
Detailed macro view of plumeria hair claw clip with sweet strawberry print pattern - Strawberry Print (146-4)
+54
UV Printed Plumeria Flower Hair Claw Clip Sweet Fruit Cartoon Dinosaur Pattern ABS Large Shark Clip For Women Hair Styling
$0.43
No MOQ
Rhinestone Fruit Flower Hair Clips Sparkly Fabric Wrapped Snap Clips Sweet Hair Accessories For Kids Girls
Rhinestone Fruit Flower Hair Clips Sparkly Fabric Wrapped Snap Clips Sweet Hair Accessories For Kids Girls
like
Find Similar
Pair of yellow pineapple BB hair clips with sparkling rhinestones for children - Pineapple BB Clips (Pair)
Orange cherry rhinestone BB hair clips set with ribbon wrap on a white card display - Cherry BB Clips (Pair)
Sparkling pink rhinestone watermelon hair clips for kids on a handmade design card - Watermelon BB Clips (Pair)
Set of two blue glitter crown BB hair clips with rhinestones on a white gift card - Small Blue Crown BB Clips (Pair)
+7
Rhinestone Fruit Flower Hair Clips Sparkly Fabric Wrapped Snap Clips Sweet Hair Accessories For Kids Girls
$0.69-0.89
No MOQ
Free Shipping
Handmade Cute Embroidery Floral Hair Clips For Girls Multiple Styles Lace Fabric Flower Bow Hairpin Kids Hair Accessory
Handmade Cute Embroidery Floral Hair Clips For Girls Multiple Styles Lace Fabric Flower Bow Hairpin Kids Hair Accessory
like
Find Similar
5-piece set of cute baby hair clips with white embroidery and lace floral details - Milk White Lace Style (5C1)
Five-piece cute baby hair clip set featuring yellow and white daisy floral embroidery - Yellow White Fresh Combination (5D1)
5-piece set of cute floral hair clips with daisy and cherry patterns for girls - Orange Cherry Combination (5BB)
Set of 6 daisy embroidery hair clips with woven fabric texture for girls and kids - Dark Brown Daisy (6B)
+12
Handmade Cute Embroidery Floral Hair Clips For Girls Multiple Styles Lace Fabric Flower Bow Hairpin Kids Hair Accessory
$1.12
Mix MOQ : 2
Mini Plumeria Hair Claw Clips Cute Translucent Flower Hair Accessories For Women Beach Vacation Style Small Hairpins
Mini Plumeria Hair Claw Clips Cute Translucent Flower Hair Accessories For Women Beach Vacation Style Small Hairpins
like
Find Similar
6 options
Mini Plumeria Hair Claw Clips Cute Translucent Flower Hair Accessories For Women Beach Vacation Style Small Hairpins
$0.43
No MOQ
Luxury Metal Zirconia Hair Clip For Women Elegant Leaf Flower Crystal Hairpin Bangs Clip Fashion Commuting Hair Accessories
Luxury Metal Zirconia Hair Clip For Women Elegant Leaf Flower Crystal Hairpin Bangs Clip Fashion Commuting Hair Accessories
like
Find Similar
Leaf-shaped zircon hair clip with sparkling marquise crystals on gray background - Silver Banquet Leaf Style (HS-J6379S) / Silver (HS-J6379S)
Elegant gold-tone hair clip with leaf-shaped marquise crystals for women's daily style - Gold Banquet Leaf Style (HS-J6379G) / Gold (HS-J6379G)
Elegant gold hair clip featuring sparkling zircon crystal flower designs for women - Gold Flower Zircon Style (HS-J6384G) / Gold (HS-J6384G)
Elegant silver-toned hair clip featuring marquise-cut zircon crystals in a leaf design - Silver Foliage Zircon Style (HS-J6383S) / Silver (HS-J6383S)
+53
Luxury Metal Zirconia Hair Clip For Women Elegant Leaf Flower Crystal Hairpin Bangs Clip Fashion Commuting Hair Accessories
-5%
$1.73-3.97
No MOQ
Free Shipping
Flower Hair Claw Clip Gradient Plastic Resin Frangipani Hawaiian Sweet Elegant Hair Accessory For Women Girls
Flower Hair Claw Clip Gradient Plastic Resin Frangipani Hawaiian Sweet Elegant Hair Accessory For Women Girls
like
Find Similar
Blue gradient frangipani flower hair claw clip in glossy resin on a vintage book - 8cm / Blue
Pearlescent white frangipani flower hair claw clip with yellow center on a book - 8cm / Yellow
Floral hair claw clip in gradient green and yellow resin on an aesthetic book background - 8cm / Grass Green
Sweet purple gradient plumeria flower hair claw clip with a glossy candy finish - 8cm / Purple
+3
Flower Hair Claw Clip Gradient Plastic Resin Frangipani Hawaiian Sweet Elegant Hair Accessory For Women Girls
-4%
$0.58
No MOQ
Vintage Palace Style Hollow Out Brass Hair Clip Ancient Butterfly Flower Filigree Duckbill Hairpin For Women Hair Jewelry
Vintage Palace Style Hollow Out Brass Hair Clip Ancient Butterfly Flower Filigree Duckbill Hairpin For Women Hair Jewelry
like
Find Similar
Classic golden butterfly hair clip with vintage hollow filigree design and duckbill clamp - Cloud Pattern (Gold)
Silver vintage butterfly hair clip with hollow filigree pattern on metal duckbill clamp - Cloud Pattern (White K)
Vintage silver hollow floral butterfly hair clip with metallic filigree diamond design - Cloud Pattern (Silver)
Vintage bronze filigree butterfly hair clip with intricate hollow metal design - Cloud Pattern (Antique Bronze)
+20
Vintage Palace Style Hollow Out Brass Hair Clip Ancient Butterfly Flower Filigree Duckbill Hairpin For Women Hair Jewelry
$0.42-0.51
No MOQ
Vintage Hair Clip Alloy Rhinestone Crystal Hollow Butterfly Flower Spring Ponytail Holder Retro Elegant Hairpin Women
Vintage Hair Clip Alloy Rhinestone Crystal Hollow Butterfly Flower Spring Ponytail Holder Retro Elegant Hairpin Women
like
Find Similar
Detail of vintage silver butterfly hair clip with grey crystals and blue gemstone - Retro Hollow Butterfly - Blue
Close-up of vintage peacock hair clip with grey crystals and silver alloy relief - Retro Peacock Relief - Grey
Detail of vintage peacock feather hair clip with blue gemstone and rhinestones - Peacock Feather - Sapphire Blue
Detailed view of vintage silver butterfly hair clip with grey crystals and rhinestones - Butterfly Hollow - Antique Silver Grey
+7
Vintage Hair Clip Alloy Rhinestone Crystal Hollow Butterfly Flower Spring Ponytail Holder Retro Elegant Hairpin Women
-4%
$1.10
No MOQ
 · 
11 sold recently
Go to

More in accessories

Explore more in flower clips

clawartificialsharkhairpinsenamelgoldsmallponytaildiysquare
stylealloyshark cliphandmadetasseldesignalloy enamelstargirls hair accessoriesresin hair

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access