Everful

Wholesale flower clips

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Flower Clips

Find the perfect pieces: hair claws, hair clips, hair bands & headbands and more

All products in flower clips

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Women Festive Red Cotton Middle Tube Socks Golden Embroidery Ribbed Knit Autumn Winter Warm Casual Fashion Socks
Women Festive Red Cotton Middle Tube Socks Golden Embroidery Ribbed Knit Autumn Winter Warm Casual Fashion Socks
like
Find Similar
Festive red cotton crew socks with golden plum blossom embroidery and ribbed texture - One Size / Flower Pattern
Deep red cotton crew socks with vertical knit and gold zodiac embroidery for New Year - One Size / Fu Character Pattern
Festive red cotton crew socks featuring a golden heart embroidery on the ribbed cuff - One Size / Heart Embroidered Style
Red cotton mid-calf socks with gold bow embroidery and ribbed knit texture - One Size / Bow Embroidery Style
+1
Women Festive Red Cotton Middle Tube Socks Golden Embroidery Ribbed Knit Autumn Winter Warm Casual Fashion Socks
$1.35
No MOQ
Women Transparent Mesh Crew Socks Floral Embroidery Glass Silk Thin Summer Socks Sweet Ruffle Cuff Breathable Fashion Socks
Women Transparent Mesh Crew Socks Floral Embroidery Glass Silk Thin Summer Socks Sweet Ruffle Cuff Breathable Fashion Socks
like
Find Similar
Sheer crystal mesh crew socks with pink ribbed cuffs and colorful floral embroidery - One Size / Flower Garland
Pink tulip floral mesh sheer mid-calf socks with transparent crystal silk fabric - One Size / Single Large Tulip
Sheer glass silk crew socks with blue contrast toe and pink ruffled hem design - One Size / Tree Pattern
Sheer mesh crew socks with pink and blue plaid pattern and yellow contrast trim - One Size / Plaid
+4
Women Transparent Mesh Crew Socks Floral Embroidery Glass Silk Thin Summer Socks Sweet Ruffle Cuff Breathable Fashion Socks
$1.01
No MOQ
 · 
15 sold recently
Women Winter Thickened Coral Fleece Mid-Tube Socks Luxury Bow Artificial Pearl Decoration Plush Sweet Home Sleep Socks
Women Winter Thickened Coral Fleece Mid-Tube Socks Luxury Bow Artificial Pearl Decoration Plush Sweet Home Sleep Socks
like
Find Similar
Coral fleece mid-tube socks in black featuring a large white lace bow with pearl detail - Pearl Bowknot / Black
White coral fleece socks with black lace bows and faux pearl accent for winter comfort - Pearl Bowknot / White
Thick black coral fleece socks featuring elegant white checkered bows for winter comfort - Triple Bow Decoration / Black
White coral fleece socks with black and white bow accents for a cozy winter look - Triple Bow Decoration / White
+6
Women Winter Thickened Coral Fleece Mid-Tube Socks Luxury Bow Artificial Pearl Decoration Plush Sweet Home Sleep Socks
$1.38
No MOQ
Women Combed Cotton Mid-Calf Crew Socks Tulip Embroidery Lettuce Edge Hem Casual Fresh Style Floral Knit Socks Gift
Women Combed Cotton Mid-Calf Crew Socks Tulip Embroidery Lettuce Edge Hem Casual Fresh Style Floral Knit Socks Gift
like
Find Similar
Grass green crew socks for women featuring delicate pink tulip floral embroidery - One Size / 3D Tulip
Light green combed cotton mid-calf socks with pink flower embroidery and wavy cuffs - One Size / Lace Ruffle Edge
Mid-calf cream socks with pink tulips and green accents in a stylish minimalist setting - One Size / Sole Tulip Pattern
Mid-calf green cotton socks featuring red tulip floral patterns and white wavy edges - One Size / Single Flower Row
+1
Women Combed Cotton Mid-Calf Crew Socks Tulip Embroidery Lettuce Edge Hem Casual Fresh Style Floral Knit Socks Gift
$0.81
No MOQ
Women Thickened Coral Fleece Socks Winter Warm Mid-Calf Sleep Socks Cozy Fuzzy Floor Socks With Tulip Bear Floral Pattern Japanese Style Home Wear
Women Thickened Coral Fleece Socks Winter Warm Mid-Calf Sleep Socks Cozy Fuzzy Floor Socks With Tulip Bear Floral Pattern Japanese Style Home Wear
like
Find Similar
Thick coral fleece crew socks featuring a white bear and red tulip pattern in winter - One Size / Bear on Flower
Creamy white coral fleece winter socks with colorful tulip embroidery and soft texture - One Size / All-over Tulip
Plush coral fleece socks with cream white color and cute cartoon bear floral pattern - One Size / Grass Bear
Women Thickened Coral Fleece Socks Winter Warm Mid-Calf Sleep Socks Cozy Fuzzy Floor Socks With Tulip Bear Floral Pattern Japanese Style Home Wear
$0.81
No MOQ
Women's Cotton No Show Socks Sweet Embroidered Animal Heart Argyle Pattern Breathable Low Cut Boat Socks For Daily Wear
Women's Cotton No Show Socks Sweet Embroidered Animal Heart Argyle Pattern Breathable Low Cut Boat Socks For Daily Wear
like
Find Similar
Breathable cotton ankle socks in sky blue and beige with white bear embroidery detail - One Size / Blue Embroidered Cat
White cotton boat socks featuring yellow tulip and blue heart embroidery with knit texture - One Size / White Wave Small Yellow Flower
Women's Cotton No Show Socks Sweet Embroidered Animal Heart Argyle Pattern Breathable Low Cut Boat Socks For Daily Wear
$0.75
No MOQ
Women Transparent Crystal Silk Crew Socks Floral Embroidery Sheer Mesh Thin Breathable Summer Socks Japanese Sweet Pattern
Women Transparent Crystal Silk Crew Socks Floral Embroidery Sheer Mesh Thin Breathable Summer Socks Japanese Sweet Pattern
like
Find Similar
Sheer mid-calf socks featuring green flower stems and 3D yellow tulip decorations - One Size / 3D Yellow Flower
Sheer mid-calf socks with 3D tulip patterns and contrasting toe and heel details - One Size / 3D Tulip
Sheer white mesh calf socks featuring yellow daisy embroidery and green ribbed cuffs - One Size / Flower Pattern
Sweet Korean style sheer white crew socks with pink floral heart patterns and red cuffs - One Size / Vertical Stripe Heart
+2
Women Transparent Crystal Silk Crew Socks Floral Embroidery Sheer Mesh Thin Breathable Summer Socks Japanese Sweet Pattern
$1.01
No MOQ
 · 
10 sold recently
Women Summer Thin Mesh Crew Socks Cotton Cute Floral Embroidery Ruffle Trim Breathable Slouchy Socks Fashion Hosiery
Women Summer Thin Mesh Crew Socks Cotton Cute Floral Embroidery Ruffle Trim Breathable Slouchy Socks Fashion Hosiery
like
Find Similar
Sage green mesh socks for women featuring white ruffle edges and pink rose embroidery - One Size / Green Flower
Women Summer Thin Mesh Crew Socks Cotton Cute Floral Embroidery Ruffle Trim Breathable Slouchy Socks Fashion Hosiery
$1.30
No MOQ
Women Cotton Sweet Japanese Style No Show Socks Ruffle Edge Cartoon Rabbit Floral Striped Pattern Soft Low Cut Boat Socks
Women Cotton Sweet Japanese Style No Show Socks Ruffle Edge Cartoon Rabbit Floral Striped Pattern Soft Low Cut Boat Socks
like
Find Similar
White low cut cotton ankle socks with rabbit pattern and sweet ruffle cuff detail - All-over Rabbit Ruffle (CY)
Green and white striped low-cut cotton ankle socks in a stylish lifestyle setting - Stripe Ruffle (CY)
Women's cotton socks in cream and sage green with floral argyle pattern and ruffle cuffs - Diamond Pattern Flower (CY)
Cute beige cotton ankle socks with green trim and strawberry pattern in a minimal setting - Peach Ruffle Edge (CY)
+1
Women Cotton Sweet Japanese Style No Show Socks Ruffle Edge Cartoon Rabbit Floral Striped Pattern Soft Low Cut Boat Socks
$0.55
No MOQ
Women Transparent Tulip Embroidery Crew Socks Mesh Thin Breathable Polyamide Nylon Sweet Fairy Style Summer Hosiery
Women Transparent Tulip Embroidery Crew Socks Mesh Thin Breathable Polyamide Nylon Sweet Fairy Style Summer Hosiery
like
Find Similar
Sheer tulip socks with pink flowers and pastel yellow and pink contrast heel and toe - One Size / Pink Large Flower
Sheer beige tulip embroidered tulle socks with delicate ruffled cuffs and bow textures - One Size / Vertical Small Flowers
Sheer mesh crew socks with pink tulip embroidery and cream cotton heel and toe accents - One Size / Allover Small Flowers
Women Transparent Tulip Embroidery Crew Socks Mesh Thin Breathable Polyamide Nylon Sweet Fairy Style Summer Hosiery
$1.01
No MOQ
Vintage Bronze Alloy Keychain Set Peace Sign Mask Pharaoh Mandala Pendant Personalized Retro Key Ring Gift Jewelry
Vintage Bronze Alloy Keychain Set Peace Sign Mask Pharaoh Mandala Pendant Personalized Retro Key Ring Gift Jewelry
like
Find Similar
Creative bronze alloy keychain featuring a unique tribal mask pendant with braided details - Mask
Vintage bronze Egyptian Pharaoh Tutankhamun keychain made of durable zinc alloy metal - Pharaoh Head
Vintage bronze peace sign keychain with metal chain and split ring on white background - Peace Sign
Vintage bronze teardrop keychain with intricate hollow mandala pattern and keyring - Mandala Flower
Vintage Bronze Alloy Keychain Set Peace Sign Mask Pharaoh Mandala Pendant Personalized Retro Key Ring Gift Jewelry
-9%
$0.65
No MOQ
S925 Sterling Silver Four Pointed Star Hoop Earrings For Women Minimalist Celestial Zirconia Earrings Inlaid Jewelry Gift
S925 Sterling Silver Four Pointed Star Hoop Earrings For Women Minimalist Celestial Zirconia Earrings Inlaid Jewelry Gift
like
Find Similar
925 silver star hoop earrings with clear zircon stones in a polished silver finish - 925 Silver / 925 Sterling Silver Star Ear Clip (White Gold Color)
925 silver gold-plated double-hoop earrings with sparkling zircon and starburst motif - 925 Silver / 925 Sterling Silver Star Ear Clip (Yellow Gold Color)
S925 Sterling Silver Four Pointed Star Hoop Earrings For Women Minimalist Celestial Zirconia Earrings Inlaid Jewelry Gift
-6%
$15.46
No MOQ
Free Shipping
Summer Fedora Hat Polyester Palm Tree Printed Straw Style Sun Beach Hat Vintage Casual Wide Brim Trilby Hat Outdoor Sunshade
Summer Fedora Hat Polyester Palm Tree Printed Straw Style Sun Beach Hat Vintage Casual Wide Brim Trilby Hat Outdoor Sunshade
like
Find Similar
Classic straw fedora hat with black palm tree prints and elegant ribbon band for summer - One Size 58cm / Lala Grass Khaki
Summer straw fedora with black palm tree prints and ribbon detail on white background - One Size 58cm / Lala Grass Beige
Dark blue summer straw fedora hat with white palm tree prints and black ribbon band - One Size 58cm / Lala Grass Blue
White straw fedora hat for men with navy palm tree prints and black ribbon trim - One Size 58cm / Lala Grass Off-White
+18
NewSummer Fedora Hat Polyester Palm Tree Printed Straw Style Sun Beach Hat Vintage Casual Wide Brim Trilby Hat Outdoor Sunshade
$2.59
Mix MOQ : 2
Vintage Bohemian Hat Band For Women Western Cowboy Bull Head PU Leather Hat Belt With Tassels Embroidery Hat Decoration Accessory
Vintage Bohemian Hat Band For Women Western Cowboy Bull Head PU Leather Hat Belt With Tassels Embroidery Hat Decoration Accessory
like
Find Similar
Vintage brown leather hat band with bull head ornament and silver studs for hats - Riveted Bull Head Belt
Detail of western style hat band featuring vintage bull skull pendant and metal studs - Small Bull Head Belt
Detail of bohemian hat band featuring turquoise stone, ethnic beads and silver coins - Ethnic Style Belt
Detail of thin black elastic hat band with gold leaf-shaped buckle and textured metal finish - Fish Scale Pattern Belt
+15
Vintage Bohemian Hat Band For Women Western Cowboy Bull Head PU Leather Hat Belt With Tassels Embroidery Hat Decoration Accessory
$1.73-2.88
Mix MOQ : 3
Free Shipping
Unisex Winter Trapper Hat With Detachable Mask Breathing Valve Warm Ear Protection Windproof Cycling Faux Fur Cap
Unisex Winter Trapper Hat With Detachable Mask Breathing Valve Warm Ear Protection Windproof Cycling Faux Fur Cap
like
Find Similar
Close-up of camouflage trapper hat with thick plush lining and integrated face mask - One Size 58cm / Camo Blue Grey
Detail of red camouflage trapper hat with grey faux fur lining and snap-on face mask - One Size 58cm / Camo Purple Red
Close-up of camouflage trapper hat with gray faux fur lining and detachable face mask - One Size 58cm / Camo Flower Green
Detail view of pink camouflage winter bomber hat with gray faux fur and a breathing valve mask - One Size 58cm / Camo Skin Pink
Unisex Winter Trapper Hat With Detachable Mask Breathing Valve Warm Ear Protection Windproof Cycling Faux Fur Cap
$3.75
Mix MOQ : 2
Women Vintage Cotton Bucket Hat Foldable Sun Protection Basin Hat With Bow Floral Polka Dot Printed Short Brim Fisherman Hat
Women Vintage Cotton Bucket Hat Foldable Sun Protection Basin Hat With Bow Floral Polka Dot Printed Short Brim Fisherman Hat
like
Find Similar
Purple cotton bucket hat featuring printed brim and bow detail on a magazine - Adjustable 57-58cm / Fan Flower Purple
Close-up of pink cotton linen bucket hat with geometric patterns and 3D floral accent - Adjustable 57-58cm / Fan Flower Pink
Detail of dark pink floral cotton bucket hat with a fabric bow on white desk backdrop - Adjustable 57-58cm / Small Dots Deep Red
Detail of dark grey bucket hat featuring woven texture and a decorative side flower - Adjustable 57-58cm / Fan Flower Dark Gray
+5
Women Vintage Cotton Bucket Hat Foldable Sun Protection Basin Hat With Bow Floral Polka Dot Printed Short Brim Fisherman Hat
$3.46
Mix MOQ : 5
Summer Fedora Hat For Men Women Breathable Polyester Plaid Palm Tree Printed Beach Sun Hat Outdoor Casual Jazz Hat
Summer Fedora Hat For Men Women Breathable Polyester Plaid Palm Tree Printed Beach Sun Hat Outdoor Casual Jazz Hat
like
Find Similar
Classic summer fedora straw hat with brown checkered pattern and black ribbon band - One Size 58cm / Coffee Mahjong Lattice
Classic summer straw fedora with brown and white geometric weave and black decorative band - One Size 58cm / Beige Mahjong Lattice
Classic black and white checkered summer straw fedora hat with elegant black ribbon band - One Size 58cm / Black Mahjong Lattice
Detail of woven straw fedora hat featuring a brown and beige checkered pattern and black band - One Size 58cm / Tricolor Grass Brown
+18
Summer Fedora Hat For Men Women Breathable Polyester Plaid Palm Tree Printed Beach Sun Hat Outdoor Casual Jazz Hat
$2.59
Mix MOQ : 2
Women's Floral Print Bucket Hat Foldable Polyester Sun Hat With Adjustable Drawstring Vintage Summer Fishing Cap For Women
Women's Floral Print Bucket Hat Foldable Polyester Sun Hat With Adjustable Drawstring Vintage Summer Fishing Cap For Women
like
Find Similar
Foldable navy floral bucket hat for women with adjustable drawstring on white background - One Size 58cm / Blue with Red Floral
Foldable wine red floral bucket hat for women with adjustable drawstring and cotton fabric - One Size 58cm / Red Style Dotted Flowers
Navy floral sun hat for women with foldable brim and adjustable windproof drawstring - One Size 58cm / Large Blue Flower
Foldable dark red floral bucket hat with adjustable drawcord and stitched brim for women - One Size 58cm / Dark Red Small Flowers
+3
Women's Floral Print Bucket Hat Foldable Polyester Sun Hat With Adjustable Drawstring Vintage Summer Fishing Cap For Women
$2.31
Mix MOQ : 2
Go to

More in accessories

Explore more in flower clips

clawartificialsharkhairpinsenamelgoldsmallponytaildiysquare
stylealloyshark cliphandmadetasseldesignalloy enamelstargirls hair accessoriesresin hair

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access