Everful

Wholesale flower clips

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Flower Clips

Find the perfect pieces: hair claws, hair clips, hair bands & headbands and more

All products in flower clips

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Halloween Enamel Pins Gothic Skull Pumpkin Ghost Brooches Alloy Metal Badges For Clothes Bags Backpacks Women Men Jewelry
Halloween Enamel Pins Gothic Skull Pumpkin Ghost Brooches Alloy Metal Badges For Clothes Bags Backpacks Women Men Jewelry
like
Find Similar
Creative Halloween enamel skeleton ribcage brooch with colorful flowers on a white background - Skull Ribs Flower Style (xz1767)
Halloween pumpkin enamel brooch featuring a black cat and ghost with Happy Halloween banner - Pumpkin Black Cat Ghost Style (xz2343)
Halloween melting pumpkin and skull enamel pin badge for clothes and bags decoration - Melting Pumpkin Skeleton Style (XZ3111)
Close-up of a Halloween ghost enamel pin with orange and black BOO flag detail - Ghost With Flag Style (xz5274)
+1
Halloween Enamel Pins Gothic Skull Pumpkin Ghost Brooches Alloy Metal Badges For Clothes Bags Backpacks Women Men Jewelry
-9%
$0.45-0.65
No MOQ
Free Shipping
Creative Graduation Theme Enamel Brooch Set Alloy Academic Cap Diploma Floral Lettering Lapel Pin For Graduates School Party Gift
Creative Graduation Theme Enamel Brooch Set Alloy Academic Cap Diploma Floral Lettering Lapel Pin For Graduates School Party Gift
like
Find Similar
Black and gold graduation enamel pin featuring a mortarboard and creative lettering - Creative Graduation Text (xz6241)
Doctoral cap and red rose enamel brooch pin set with gold trim for graduation - Cap with Flowers and Books (xz6242)
Enamel graduation brooch featuring black mortarboard and white diploma with red tassel - Cap with Graduation Diploma (xz6243)
Graduation enamel pin featuring a black and gold mortarboard with education level checklist - Education Levels Hierarchy (xz6244)
NewCreative Graduation Theme Enamel Brooch Set Alloy Academic Cap Diploma Floral Lettering Lapel Pin For Graduates School Party Gift
-8%
$0.42
No MOQ
Japanese Cartoon Animal Enamel Brooch Pin Set Cute Fox Polar Bear Hedgehog Cat Badge For Clothes Bag Decoration Jewelry
Japanese Cartoon Animal Enamel Brooch Pin Set Cute Fox Polar Bear Hedgehog Cat Badge For Clothes Bag Decoration Jewelry
like
Find Similar
Detailed close-up of a creative hedgehog enamel pin with pink and white detailing - Pink Flower Hedgehog Style (XZ3356)
Cute cartoon red fox enamel brooch pin with gold-plated edges and hollowed leaf tail design - Red Geometric Fox Style (XZ3359)
Detailed view of black cat enamel pin with white daisy patterns and gold metal edges - Daisy Pattern Black Cat Style (XZ3358)
Artistic polar bear enamel pin featuring forest landscape silhouette in golden finish - Forest Silhouette Polar Bear Style (XZ3357)
Japanese Cartoon Animal Enamel Brooch Pin Set Cute Fox Polar Bear Hedgehog Cat Badge For Clothes Bag Decoration Jewelry
-9%
$0.47
No MOQ
Free Shipping
Cartoon Enamel Cat Brooch Pin Zinc Alloy Floral Wreath Gentleman Cat Badge For Clothing Bag Decorative Jewelry Gift For Women Men
Cartoon Enamel Cat Brooch Pin Zinc Alloy Floral Wreath Gentleman Cat Badge For Clothing Bag Decorative Jewelry Gift For Women Men
like
Find Similar
Funny enamel cat pin with grumpy face and colorful flower wreath for bags and clothes - Multicolor Flower Wreath Cat Style (QHXZ5495)
Cute cartoon white cat enamel brooch with white curly hair and elegant black outfit - Gentleman Judge Cat Style (QHXZ5496)
Cartoon Enamel Cat Brooch Pin Zinc Alloy Floral Wreath Gentleman Cat Badge For Clothing Bag Decorative Jewelry Gift For Women Men
-8%
$0.45
No MOQ
Free Shipping
Cute Cartoon Enamel Whale Brooches Funny Whale Pun Enamel Pins For Backpacks Jackets Unique Animal Badge Jewelry Gift For Women Men
Cute Cartoon Enamel Whale Brooches Funny Whale Pun Enamel Pins For Backpacks Jackets Unique Animal Badge Jewelry Gift For Women Men
like
Find Similar
Cute cartoon blue whale enamel pin with red heart and I Whaley Like You slogan - Heart Whale (QHXZ5330)
Cute sky blue enamel whale pin with pink bouquet and You are Whale-come pun text - Flower Bouquet Whale (QHXZ5332)
Cute Cartoon Enamel Whale Brooches Funny Whale Pun Enamel Pins For Backpacks Jackets Unique Animal Badge Jewelry Gift For Women Men
-9%
$0.39
No MOQ
Free Shipping
Funny Cartoon Meme Enamel Pin Cute White Stick Figure Brooch For Backpack Clothing Hat Accessory Zinc Alloy Badge Gift
Funny Cartoon Meme Enamel Pin Cute White Stick Figure Brooch For Backpack Clothing Hat Accessory Zinc Alloy Badge Gift
like
Find Similar
Funny Flork of Cows white cartoon enamel pin with expressive character gesture - Doubting Style (QHXZ4914)
Detailed view of enamel pin featuring a crying cartoon figure wiping tears with a yellow cloth - Crying Style (QHXZ4910)
Flork cartoon enamel pin featuring a pink flower headpiece and heart hand gesture - Pink Flower Heart Style (QHXZ4911)
Detail of white enamel ghost badge with three red hearts and durable metal pin back - Hearts On Head Style (QHXZ4912)
+1
Funny Cartoon Meme Enamel Pin Cute White Stick Figure Brooch For Backpack Clothing Hat Accessory Zinc Alloy Badge Gift
-8%
$0.42
No MOQ
 · 
25 sold recently
Inspirational Healing Quotes Enamel Pins Mental Health Awareness Rainbow Zinc Alloy Metal Brooch Badge For Clothing Backpack Accessories
Inspirational Healing Quotes Enamel Pins Mental Health Awareness Rainbow Zinc Alloy Metal Brooch Badge For Clothing Backpack Accessories
like
Find Similar
Rainbow neurodivergent enamel pin badge with colorful lettering on black background - Neurodivergent Rainbow Style(QHXZ4501)
Round humor badge with radioactive symbol and Forget Lab Safety text on white background - Lab Safety Humor Round Style(QHXZ027)
Cat Mom Enamel Pin featuring a white cloud design with cute cartoon kittens and paw prints - Stay at Home Cat Mom Healing Cloud(QHXZ3441)
Enamel brooch pin featuring 'CREATE YOUR OWN SUNSHINE' text with sun and flower motif - Create Your Own Sunshine Sun Flower(qhxz3509)
+23
Inspirational Healing Quotes Enamel Pins Mental Health Awareness Rainbow Zinc Alloy Metal Brooch Badge For Clothing Backpack Accessories
-9%
$0.37-0.50
No MOQ
 · 
12 sold recently
Free Shipping
Book Enamel Pin Collection Cute Cartoon Metal Badges For Book Lovers Cat Coffee Novelty Brooches Backpack Clothes Lapel Pin
Book Enamel Pin Collection Cute Cartoon Metal Badges For Book Lovers Cat Coffee Novelty Brooches Backpack Clothes Lapel Pin
like
Find Similar
Artistic enamel book stack brooch featuring moon and floral patterns on metal pin - Starry Moon Books Stack (qhxz2066)
Cartoon enamel book brooch with red spine and inspiring English quote on white pages - Lose Ourselves In Books (QHXZ2120)
Cute black cat book enamel pin with Go away I'm busy text for student bags - Go Away I'm Busy Cat (xz1584)
Exquisite floral book lover enamel brooch with golden borders and colorful flowers - Book Lover Flower Badge (xz8190)
+9
Book Enamel Pin Collection Cute Cartoon Metal Badges For Book Lovers Cat Coffee Novelty Brooches Backpack Clothes Lapel Pin
-10%
$0.45-0.63
No MOQ
 · 
87 sold recently
Creative Drift Bottle Frog Enamel Brooch Cartoon Animal Painted Badge For Clothing Backpack Accessories Painted Alloy Pins
Creative Drift Bottle Frog Enamel Brooch Cartoon Animal Painted Badge For Clothing Backpack Accessories Painted Alloy Pins
like
Find Similar
Cute enamel pin featuring two green frogs on a mushroom inside a glass bottle charm - Mushroom Frog Bottle (QHXZ4255)
Creative enamel frog drifting bottle pin with colorful flowers and yellow frogs - Flower Frog Bottle (QHXZ4256)
Cute enamel pin featuring three cartoon frogs in a transparent glass wishing bottle - Star Moon Frog Bottle (QHXZ4257)
NewCreative Drift Bottle Frog Enamel Brooch Cartoon Animal Painted Badge For Clothing Backpack Accessories Painted Alloy Pins
-7%
$0.58
No MOQ
Cute Cartoon Frog Mushroom Enamel Pins Alloy Inspirational Quotes Badge Aesthetic Lapel Jewelry For Backpack Jacket Women
Cute Cartoon Frog Mushroom Enamel Pins Alloy Inspirational Quotes Badge Aesthetic Lapel Jewelry For Backpack Jacket Women
like
Find Similar
Wizard frog enamel pin with motivational quote and purple hat on a white background - Wizard Frog Style (QHXZ3835)
Cartoon enamel pin featuring a frog on a mushroom with 'Good things take time' text - Frog With Flower Style (QHXZ3836)
NewCute Cartoon Frog Mushroom Enamel Pins Alloy Inspirational Quotes Badge Aesthetic Lapel Jewelry For Backpack Jacket Women
-9%
$0.47
No MOQ
Free Shipping
Cartoon Black Cat Enamel Brooch Pin Potted Plant Floral Kitty Badge Cute Painted Alloy Brooch For Bags Clothing Jewelry Gift
Cartoon Black Cat Enamel Brooch Pin Potted Plant Floral Kitty Badge Cute Painted Alloy Brooch For Bags Clothing Jewelry Gift
like
Find Similar
Cute black cat hiding behind green potted plant cartoon enamel lapel pin badge - Black Cat behind Hanging Plant (xz7438)
Cute black cat enamel pin with vibrant green leaves and bright yellow eyes brooch - Black Cat in Green Leaves (xz7441)
Cute black cat enamel pin in green potted plant, cartoon badge for bags and clothes - Black Cat in Potted Plant (xz7439)
Cute black cat enamel pin hiding in green potted plants and pink flowers - Black Cat in Flower Cluster (xz7442)
+10
Cartoon Black Cat Enamel Brooch Pin Potted Plant Floral Kitty Badge Cute Painted Alloy Brooch For Bags Clothing Jewelry Gift
-9%
$0.45-0.60
No MOQ
Free Shipping
Cute Cartoon Corgi Alloy Enamel Brooch Pin Funny Dog Shape Jewelry Decoration For Backpack Clothing Jacket Unisex Gift Accessory
Cute Cartoon Corgi Alloy Enamel Brooch Pin Funny Dog Shape Jewelry Decoration For Backpack Clothing Jacket Unisex Gift Accessory
like
Find Similar
Cute enamel corgi butt badge with I Love You heart design for dog lovers jewelry - Heart Corgi Butt Style (QHXZ1442)
Cute orange Corgi enamel pin with slogan Life is short so are my legs - Short Legs Slogan Style (QHXZ1443)
Cute Corgi enamel pin featuring dog backs with You're My Honey Bun slogan text - Double Corgi Back Style (QHXZ1444)
Cute enamel Corgi pin with text I'M NOT SHORT I'M FUN-SIZE on white background - Fun-Size Quote Style (QHXZ1445)
+1
Cute Cartoon Corgi Alloy Enamel Brooch Pin Funny Dog Shape Jewelry Decoration For Backpack Clothing Jacket Unisex Gift Accessory
-9%
$0.50
No MOQ
Free Shipping
Creative Cartoon Goose Duck Enamel Pin Funny Meme Animal Alloy Brooch Cute Silly Goose Badge Lapel Pin Jewelry Gift For Bag Clothing
Creative Cartoon Goose Duck Enamel Pin Funny Meme Animal Alloy Brooch Cute Silly Goose Badge Lapel Pin Jewelry Gift For Bag Clothing
like
Find Similar
Cute white goose alloy brooch with a yellow flower hat in a creative cartoon style - Goose with Yellow Flower (QHXZ580)
Cute enamel duck badge with Hello My Name Is Silly text and pink name tag - Hello Name Tag Goose (QHXZ642)
Detail of an enamel pin featuring a cartoon goose with 'certified silly goose' text - Certified Silly Goose (QHXZ643)
Cartoon white goose metal brooch with Silly Goose On Board text and yellow frame - Goose On Board Round Style (QHXZ644)
+11
NewCreative Cartoon Goose Duck Enamel Pin Funny Meme Animal Alloy Brooch Cute Silly Goose Badge Lapel Pin Jewelry Gift For Bag Clothing
-10%
$0.47-0.55
No MOQ
Cartoon Cute Corgi Dog Enamel Pin Set Alloy Animal Brooch Badge For Backpack Clothing Funny Letter Decoration Gift
Cartoon Cute Corgi Dog Enamel Pin Set Alloy Animal Brooch Badge For Backpack Clothing Funny Letter Decoration Gift
like
Find Similar
Cartoon corgi dog enamel pin with butterfly wings and golden metal plating finish - Corgi with Butterfly Wings (QHXZ106)
Cute cartoon corgi dog sitting in a flower pot enamel pin with daisy floral details - Corgi in Flower Pot (QHXZ689)
Cartoon Corgi hot dog enamel pin with red flames on a clean white background - Hot Dog Corgi (QHXZ868)
Cute enamel corgi butt badge with I Love You heart design for dog lovers jewelry - Corgi Butt Heart (QHXZ1442)
+4
Cartoon Cute Corgi Dog Enamel Pin Set Alloy Animal Brooch Badge For Backpack Clothing Funny Letter Decoration Gift
-10%
$0.45-0.52
No MOQ
Free Shipping
Cartoon Alloy Enamel Brooch Pin For Women Men Clothing Decor Sunflower Peace Love Frog Shape Metal Badge Accessory Gift
Cartoon Alloy Enamel Brooch Pin For Women Men Clothing Decor Sunflower Peace Love Frog Shape Metal Badge Accessory Gift
like
Find Similar
Creative cartoon green frog enamel pin making peace sign and holding a red flower - Frog Holding Flower Style (QHXZ1372)
Creative frog metal badge with American flag pattern and peace sign gesture - US Flag Pattern Frog Silhouette Style (QHXZ1373)
Cartoon Alloy Enamel Brooch Pin For Women Men Clothing Decor Sunflower Peace Love Frog Shape Metal Badge Accessory Gift
-9%
$0.47
No MOQ
Free Shipping
Creative Human Organ Enamel Pin Alloy Kidney Liver Floral Badge Medical Doctor Nurse Gift Fashion Jewelry Accessories
Creative Human Organ Enamel Pin Alloy Kidney Liver Floral Badge Medical Doctor Nurse Gift Fashion Jewelry Accessories
like
Find Similar
Creative anatomy kidney enamel pin featuring pink hands holding a liver medical badge - Caring For Kidneys Style (XZ8435)
Creative cartoon liver enamel pin badge with a cute smiling face for bags and clothing - Cartoon Liver Shape (XZ8436)
Creative enamel pin featuring garlic and pink floral design with polished silver trim - Garlic Flower Shape (XZ8437)
Creative Human Organ Enamel Pin Alloy Kidney Liver Floral Badge Medical Doctor Nurse Gift Fashion Jewelry Accessories
-9%
$0.50
No MOQ
 · 
30 sold recently
Cute Black Cat Enamel Pin For Women Alloy Animal Brooches Lapel Badge For Backpack Clothing Jacket Cartoon Jewelry Decoration
Cute Black Cat Enamel Pin For Women Alloy Animal Brooches Lapel Badge For Backpack Clothing Jacket Cartoon Jewelry Decoration
like
Find Similar
Macro shot of black cat enamel pin with pink flowers and green leaves on metal - Cat In Pink Flowers (XZ8404)
Cute black cat enamel pin with green cactus pattern and glossy alloy finish - Cat with Cactus(XZ8406)
Cartoon black cat enamel pin sitting on wood base with pink flowers and green leaves - Cat on Bench(XZ8407)
Cute black cat enamel pin with a goldfish bowl and green plants metal badge accessory - Cat with Fish Tank(XZ8408)
Cute Black Cat Enamel Pin For Women Alloy Animal Brooches Lapel Badge For Backpack Clothing Jacket Cartoon Jewelry Decoration
-9%
$0.68
No MOQ
Free Shipping
Vintage Alloy Butterfly Enamel Brooch Pin Floral Pattern Animal Badge For Clothing Decor Jewelry Gift For Women
Vintage Alloy Butterfly Enamel Brooch Pin Floral Pattern Animal Badge For Clothing Decor Jewelry Gift For Women
like
Find Similar
Exquisite butterfly enamel brooch with golden metal edges and floral wing patterns - Pink Flower Green Leaf Butterfly Style (XZ6953)
Exquisite butterfly enamel pin featuring a black and red wing pattern with golden outlines - Red Flower Star Butterfly Style (XZ6954)
Vintage Alloy Butterfly Enamel Brooch Pin Floral Pattern Animal Badge For Clothing Decor Jewelry Gift For Women
-8%
$0.63
No MOQ
Halloween Ghost Enamel Pin Cartoon Alloy Brooch Pumpkin Scythe Knife Design Badge For Backpack Clothes Accessories Jewelry
Halloween Ghost Enamel Pin Cartoon Alloy Brooch Pumpkin Scythe Knife Design Badge For Backpack Clothes Accessories Jewelry
like
Find Similar
Detail of cute white ghost enamel pin with orange wizard hat and scythe for Halloween - Ghost with Wizard Hat and Scythe (XZ6791)
Cartoon white ghost enamel pin with orange horns holding a knife for Halloween accessory - Ghost with Devil Horns and Knife (XZ6792)
Close-up of cute ghost enamel pin holding a pumpkin basket and orange flower bouquet - Ghost with Flowers and Pumpkin Basket (XZ6793)
Detail of cute white ghost enamel pin with orange Boo lettering for Halloween - BOO Text Ghost (XZ6794)
+1
Halloween Ghost Enamel Pin Cartoon Alloy Brooch Pumpkin Scythe Knife Design Badge For Backpack Clothes Accessories Jewelry
-7%
$0.58
No MOQ
Free Shipping
Gothic Raven Rose Enamel Pin Gothic Alloy Solitude Crow Brooch Moon Stars Feather Badge For Clothing Bag Accessories Women Men
Gothic Raven Rose Enamel Pin Gothic Alloy Solitude Crow Brooch Moon Stars Feather Badge For Clothing Bag Accessories Women Men
like
Find Similar
Gothic black crow and red rose enamel brooch pin with golden feathers and moon stars - Raven Feather Moon Star Style (XZ3033)
Enamel crow pin with golden frame and orange crescent moon on a white background - Raven in Frame Moon Style (XZ3034)
Gothic black crow enamel pin with red roses and mountain design on a white background - Raven Red Flower Mountain Style (XZ3035)
Gothic style flying crow enamel pin with golden crescent moon and white clouds detail - Raven Moon Cloud Style (XZ3036)
Gothic Raven Rose Enamel Pin Gothic Alloy Solitude Crow Brooch Moon Stars Feather Badge For Clothing Bag Accessories Women Men
-8%
$0.63
No MOQ
Free Shipping
Cartoon Science Laboratory Flask Enamel Pin Creative Alloy Chemical Beaker Brooch Love Heart Starry Sky Badge For Backpack Clothing
Cartoon Science Laboratory Flask Enamel Pin Creative Alloy Chemical Beaker Brooch Love Heart Starry Sky Badge For Backpack Clothing
like
Find Similar
Pink enamel laboratory flask pin with planet and star details in golden finish - Purple Starry Sky Flask (XZ4702)
Creative chemistry flask enamel pin with pink liquid and red hearts in gold finish - Pink Heart Erlenmeyer Flask (XZ4703)
Cartoon laboratory flask enamel brooch pin with colorful rainbow design and gold finish - Rainbow Wave Flask (XZ4704)
Cartoon enamel pin featuring a pink laboratory flask with a bow and golden finish - Pink Bow Scale Flask (XZ4705)
+1
Cartoon Science Laboratory Flask Enamel Pin Creative Alloy Chemical Beaker Brooch Love Heart Starry Sky Badge For Backpack Clothing
-10%
$0.52
No MOQ
Free Shipping
Creative Alloy Skeleton Ribcage Skull Rose Enamel Brooch Pin Gothic Punk Badge For Clothes Backpack Women Men Jewelry Accessory
Creative Alloy Skeleton Ribcage Skull Rose Enamel Brooch Pin Gothic Punk Badge For Clothes Backpack Women Men Jewelry Accessory
like
Find Similar
Creative Halloween enamel skeleton ribcage brooch with colorful flowers on a white background - Flower Ribcage (XZ1767)
Creative Alloy Skeleton Ribcage Skull Rose Enamel Brooch Pin Gothic Punk Badge For Clothes Backpack Women Men Jewelry Accessory
-9%
$0.50
No MOQ
Free Shipping
Funny Cartoon Yellow Duck Cat Enamel Pin Alloy Steampunk Animal Brooch For Backpack Clothing Decor Unisex Jewelry Gift
Funny Cartoon Yellow Duck Cat Enamel Pin Alloy Steampunk Animal Brooch For Backpack Clothing Decor Unisex Jewelry Gift
like
Find Similar
Cartoon enamel badge featuring a white silly goose on board with yellow outer ring - Silly Goose Round Brooch (qhxz644)
Halloween Frankenstein yellow duck enamel brooch with green skin and black hair - Halloween Frankenstein Duck (qhxz3258)
Enamel pin of a buff yellow vampire duck with a black cloak and red bow for Halloween - Halloween Vampire Duck (QHXZ3260)
Red devil duck enamel pin with black horns and arrow tail made of high-quality alloy - Red Devil Duck (QHXZ3261)
+10
Funny Cartoon Yellow Duck Cat Enamel Pin Alloy Steampunk Animal Brooch For Backpack Clothing Decor Unisex Jewelry Gift
-9%
$0.39-0.47
No MOQ
 · 
15 sold recently
Fashion Alloy Rhinestone Strawberry Brooch For Women Colorful Enamel Fruit Pin Elegant Banquet Dress Accessory Sweet Jewelry Gift
Fashion Alloy Rhinestone Strawberry Brooch For Women Colorful Enamel Fruit Pin Elegant Banquet Dress Accessory Sweet Jewelry Gift
like
Find Similar
Fashionable strawberry and flower enamel brooch with red berry and white petals - Strawberry with White Flower (C476-A)
Sparkling double strawberry brooch with red enamel and gold metal detailing, size 4.5x3.5cm - Vertical Textured Strawberry (C402-A)
Vintage double strawberry brooch with purple rhinestones and green butterfly accents - Strawberry Flower with Butterfly (B133-A)
Red rhinestone double strawberry brooch pin with green enamel leaves, 4.1cm size - Pave Red Rhinestone (B112-A)
+6
Fashion Alloy Rhinestone Strawberry Brooch For Women Colorful Enamel Fruit Pin Elegant Banquet Dress Accessory Sweet Jewelry Gift
-9%
$0.92-1.68
Mix MOQ : 3
 · 
18 views
Free Shipping
Enamel Lavender Lily Of The Valley Butterfly Brooch For Women Zinc Alloy Botanical Floral Pin Fashion Jewelry Clothing Accessory
Enamel Lavender Lily Of The Valley Butterfly Brooch For Women Zinc Alloy Botanical Floral Pin Fashion Jewelry Clothing Accessory
like
Find Similar
Lavender and butterfly enamel brooch in purple and green with shimmering blue wings - Purple Lavender with Blue White Butterfly (C288-A)
Enamel lavender bellflower brooch with yellow butterfly and green leaves on alloy - Pink Purple Flower with Yellow Purple Butterfly (C288-B)
Enamel Lavender Lily Of The Valley Butterfly Brooch For Women Zinc Alloy Botanical Floral Pin Fashion Jewelry Clothing Accessory
-8%
$1.68
Mix MOQ : 3
Free Shipping
Vintage Zinc Alloy Phoenix Brooch With Artificial Pearl Rhinestone Elegant Gold Plated Bird Breastpin For Women Jewelry
Vintage Zinc Alloy Phoenix Brooch With Artificial Pearl Rhinestone Elegant Gold Plated Bird Breastpin For Women Jewelry
like
Find Similar
Elegant gold phoenix brooch with large pearl and sparkling crystals for women - Golden Phoenix Pearl Blue Flower Style (C108-A)
Vintage Zinc Alloy Phoenix Brooch With Artificial Pearl Rhinestone Elegant Gold Plated Bird Breastpin For Women Jewelry
-13%
$1.37
Mix MOQ : 3
Free Shipping
Elegant Alloy Lotus Leaf Brooch With Artificial Pearl Rhinestone Enamel Vintage Chinese Style Floral Pin Jewelry For Women
Elegant Alloy Lotus Leaf Brooch With Artificial Pearl Rhinestone Enamel Vintage Chinese Style Floral Pin Jewelry For Women
like
Find Similar
Elegant Chinese lotus brooch with green enamel, freshwater pearl and gold plating - Classical Lotus Flower Leaf Style (C306-A)
Elegant Alloy Lotus Leaf Brooch With Artificial Pearl Rhinestone Enamel Vintage Chinese Style Floral Pin Jewelry For Women
-13%
$1.00
Mix MOQ : 3
Medical Theme Alloy Enamel Brooch Pin Heart Stethoscope ECG Cartoon Nurse Doctor Rhinestone Badge For Women Professional Jewelry
Medical Theme Alloy Enamel Brooch Pin Heart Stethoscope ECG Cartoon Nurse Doctor Rhinestone Badge For Women Professional Jewelry
like
Find Similar
Medical themed enamel brooch with blue clipboard, white stethoscope, and red heart icon - Clip Board Stethoscope Heart Style (AL636-A)
Red enamel heart stethoscope brooch with gold base and sparkling zircon accent - Heartbeat Stethoscope Red Enamel Style (D079-A)
Gold stethoscope heart brooch with red and black enamel and sparkling white crystal - Stethoscope Heart Lines Style (C539-A)
Creative stethoscope heart brooch with red enamel and golden finish for medical staff - Cute Emoji Heart Style (C543-A)
+2
Medical Theme Alloy Enamel Brooch Pin Heart Stethoscope ECG Cartoon Nurse Doctor Rhinestone Badge For Women Professional Jewelry
-14%
$0.57-0.88
Mix MOQ : 3
Free Shipping
Cartoon Blue Whale Enamel Pin Cute Animal Puns Brooch Badge For Backpack Clothing Accessory Zinc Alloy Painted Jewelry Gift
Cartoon Blue Whale Enamel Pin Cute Animal Puns Brooch Badge For Backpack Clothing Accessory Zinc Alloy Painted Jewelry Gift
like
Find Similar
Cute cartoon blue whale enamel pin with red heart and I Whaley Like You slogan - Heart Whale Style (QHXZ5330)
Cute blue whale enamel pin featuring a sunglasses design and punny motivational text - Sunglasses Whale Style (QHXZ5331)
Cute sky blue enamel whale pin with pink bouquet and You are Whale-come pun text - Spouting Whale With Flowers Style (QHXZ5332)
Cartoon Blue Whale Enamel Pin Cute Animal Puns Brooch Badge For Backpack Clothing Accessory Zinc Alloy Painted Jewelry Gift
-9%
$0.39
No MOQ
Free Shipping
Book Lover Enamel Pin Set Cartoon Reading Cat Hedgehog Brooch Zinc Alloy Literary Badges For Clothes Backpacks Gift
Book Lover Enamel Pin Set Cartoon Reading Cat Hedgehog Brooch Zinc Alloy Literary Badges For Clothes Backpacks Gift
like
Find Similar
Macro shot of an enamel pin featuring floral motifs and motivational quotes for readers - White Flower Quote (QHXZ351)
Detail of enamel pin with 'A BOOK A DAY KEEPS REALITY AWAY' text and open book design - Black Open Book Slogan (QHXZ1150)
Detail of enamel pin with Books are cheaper Than therapy text and floral accents - Black Books Cheaper Than Therapy (QHXZ1153)
Detailed view of hedgehog enamel pin reading books with Just One More Page text - Yellow Hedgehog Reading (XZ1580)
+8
Book Lover Enamel Pin Set Cartoon Reading Cat Hedgehog Brooch Zinc Alloy Literary Badges For Clothes Backpacks Gift
-9%
$0.45-0.63
No MOQ
 · 
38 sold recently
Free Shipping
Funny Cartoon Stick Figure Enamel Brooch Badge Funny Expression Heart Sunglasses Zinc Alloy Pin For Backpack Clothing Accessories
Funny Cartoon Stick Figure Enamel Brooch Badge Funny Expression Heart Sunglasses Zinc Alloy Pin For Backpack Clothing Accessories
like
Find Similar
Detailed view of enamel pin featuring a crying cartoon figure wiping tears with a yellow cloth - Crying Expression (QHXZ4910)
Flork cartoon enamel pin featuring a pink flower headpiece and heart hand gesture - Heart Gesture with Flower (QHXZ4911)
Detail of white enamel ghost badge with three red hearts and durable metal pin back - Triple Hearts Style (QHXZ4912)
Cartoon Flork enamel pin featuring a minimalist stick figure with black sunglasses - Sunglasses Cool Style (QHXZ4913)
+1
Funny Cartoon Stick Figure Enamel Brooch Badge Funny Expression Heart Sunglasses Zinc Alloy Pin For Backpack Clothing Accessories
-8%
$0.42
No MOQ
Round Cartoon Character Enamel Pin Badge For Backpack Clothing Accessory Zinc Alloy Lacquer Brooch Jewelry Gift For Friends
Round Cartoon Character Enamel Pin Badge For Backpack Clothing Accessory Zinc Alloy Lacquer Brooch Jewelry Gift For Friends
like
Find Similar
Cartoon enamel pin featuring a green character with pink flowers on a striped background - Green Flower Character (QHXZ4819)
Round enamel pin featuring a cartoon figure with a gray bucket hat on a striped background - Brown Bucket Head Character (QHXZ4820)
Sprunki rhythm box enamel pin featuring a silhouette of a gentleman with hat and glasses - Black Top Hat Silhouette (QHXZ4821)
Round orange cartoon character enamel brooch with headphones and metal finish - Orange Headphone Character (QHXZ4822)
Round Cartoon Character Enamel Pin Badge For Backpack Clothing Accessory Zinc Alloy Lacquer Brooch Jewelry Gift For Friends
-8%
$0.45
No MOQ
Funny Cartoon Praying Mantis Enamel Pin Zinc Alloy Brooch Crown Slogan Badge For Women Backpack Denim Jacket Jewelry Gift
Funny Cartoon Praying Mantis Enamel Pin Zinc Alloy Brooch Crown Slogan Badge For Women Backpack Denim Jacket Jewelry Gift
like
Find Similar
Green praying mantis enamel pin badge with yellow crown and humorous slogans - Mantis Man Eater Slogan Style (QHXZ4790)
Detail of green praying mantis enamel pin featuring Eat The Patriarchy text and gold crown - Eat The Patriarchy Slogan Style (QHXZ4791)
Cartoon mantis enamel pin with yellow crown and flowers on a black background - Man Eater Flower Style (QHXZ4792)
Funny Cartoon Praying Mantis Enamel Pin Zinc Alloy Brooch Crown Slogan Badge For Women Backpack Denim Jacket Jewelry Gift
-9%
$0.47
No MOQ
Gothic Skull Enamel Pin Set Halloween Punk Zinc Alloy Skeleton Brooch For Lapel Backpack Jacket Gift Unisex Jewelry
Gothic Skull Enamel Pin Set Halloween Punk Zinc Alloy Skeleton Brooch For Lapel Backpack Jacket Gift Unisex Jewelry
like
Find Similar
Cartoon skeleton D20 dice enamel pin badge for tabletop gaming and gothic accessory style - Skull Dice Style (QHXZ053)
Skull and flame enamel pin with Fueled by Iced Coffee and Chaos text design - Coffee Chaos Skull Style (QHXZ1253)
Skeleton skull enamel brooch featuring a purple sadness meter scale in punk style - Sadness Meter Skull Style (QHXZ3971)
Cartoon gothic skull enamel pin with classic black and white finish on white background - Cartoon Gloomy Skull Style (XZ291)
+7
Gothic Skull Enamel Pin Set Halloween Punk Zinc Alloy Skeleton Brooch For Lapel Backpack Jacket Gift Unisex Jewelry
-9%
$0.39-1.31
No MOQ
 · 
42 sold recently
Free Shipping
Cute Panda Enamel Pins Cartoon Animal Zinc Alloy Brooch Pins For Backpack Clothing Decoration Chinese Style Panda Badges Jewelry Accessories Gift
Cute Panda Enamel Pins Cartoon Animal Zinc Alloy Brooch Pins For Backpack Clothing Decoration Chinese Style Panda Badges Jewelry Accessories Gift
like
Find Similar
Cute panda on pink flower enamel pin with gold plating and cartoon animal design - Panda On Flower Style (QHXZ4073)
Cute enamel panda pin with orange flower detail and golden metallic edge finish - Panda On Orange Style (QHXZ4074)
Cartoon panda enamel pin wearing a green lotus leaf with golden metallic edge detail - Panda With Lotus Leaf Style (QHXZ4075)
Cute enamel panda pin holding a red flower with golden edges for backpacks - Panda With Rose Style (QHXZ4076)
+2
Cute Panda Enamel Pins Cartoon Animal Zinc Alloy Brooch Pins For Backpack Clothing Decoration Chinese Style Panda Badges Jewelry Accessories Gift
-8%
$0.42
No MOQ
Inspirational Enamel Pin Floral Ribbon Candle Letter Brooch Zinc Alloy Lapel Pins With Positive Quotes Daily Decoration Accessory
Inspirational Enamel Pin Floral Ribbon Candle Letter Brooch Zinc Alloy Lapel Pins With Positive Quotes Daily Decoration Accessory
like
Find Similar
Round enamel pin with pink floral wreath and 'you are safe' motivational text - Circular Floral Style (QHXZ3841)
Pink enamel flower pin featuring motivational 'I can and I will' quote with gold trim - Heart Flower Cluster Style (QHXZ3842)
Enamel pin featuring pink flowers and delicate and strong inspirational quote gold trim - Rose Floral Style (QHXZ3843)
Inspirational enamel pin with candle design and you are meant to shine text in mint green - Aromatic Candle Style (QHXZ3844)
+1
Inspirational Enamel Pin Floral Ribbon Candle Letter Brooch Zinc Alloy Lapel Pins With Positive Quotes Daily Decoration Accessory
-8%
$0.42
Mix MOQ : 2
 · 
11 sold recently
Free Shipping
Motivational Positive Quotes Envelope Enamel Pin Healing Self Love Letter Metal Brooch Badge Clothing Decoration Gift
Motivational Positive Quotes Envelope Enamel Pin Healing Self Love Letter Metal Brooch Badge Clothing Decoration Gift
like
Find Similar
Cute envelope enamel brooch with Dear me motivational quote and pink heart seal - White Envelope-Whatever Life Throws At You Quote (QHXZ3601)
Creative enamel pin featuring an envelope design with it is okay to put yourself first card - Yellow Envelope-It's Okay To Put Yourself First Quote (QHXZ3602)
White enamel brooch with stacked envelopes and pink hearts with Love Letters text - Stacked Envelopes-Love Letters I Never Sent Theme (QHXZ3603)
Nude enamel envelope pin with a motivational message and red floral heart detail - Nude Envelope-Inspirational Quote with Heart Flower (QHXZ3604)
+9
Motivational Positive Quotes Envelope Enamel Pin Healing Self Love Letter Metal Brooch Badge Clothing Decoration Gift
-8%
$0.45
No MOQ
 · 
29 sold recently
Cute Cartoon Frog Enamel Pin Zinc Alloy Animal Brooch For Clothing Backpack Decoration Funny Green Frog Lapel Pin Jewelry Gift
Cute Cartoon Frog Enamel Pin Zinc Alloy Animal Brooch For Clothing Backpack Decoration Funny Green Frog Lapel Pin Jewelry Gift
like
Find Similar
Cute frog enamel pin holding a daisy bouquet, green animal brooch for clothing decoration - Frog with Flower Style (QHXZ582)
Cute green frog in a clay flower pot enamel lapel pin for clothing decoration - Potted Frog Style (QHXZ692)
Cute light green cartoon enamel bat pin with black metal edges and glossy finish - Bat Frog Style (QHXZ1491)
Cute green cartoon frog sitting on a dark green lotus leaf enamel pin badge - Lotus Leaf Frog Style (QHXZ1492)
+4
Cute Cartoon Frog Enamel Pin Zinc Alloy Animal Brooch For Clothing Backpack Decoration Funny Green Frog Lapel Pin Jewelry Gift
-10%
$0.42-0.60
No MOQ
TV Show Themed Round Enamel Pin Set Zinc Alloy Brooches For Clothing Backpack Cartoon Illustration Lapel Badge Accessories
TV Show Themed Round Enamel Pin Set Zinc Alloy Brooches For Clothing Backpack Cartoon Illustration Lapel Badge Accessories
like
Find Similar
Enamel pin badge featuring a pink crashed car inspired by 'The End of the F***ing World' - Pink Damaged Car Style (QHXZ2573)
Cartoon enamel pin badge featuring flowers and The End of the Fucking World text - Hand Holding Flowers Style (QHXZ2550)
Round enamel pin featuring James from The End of the F***ing World in red shirt - Character in Red Floral Shirt Back Style (QHXZ2574)
TV Show Themed Round Enamel Pin Set Zinc Alloy Brooches For Clothing Backpack Cartoon Illustration Lapel Badge Accessories
-10%
$0.52
No MOQ
Free Shipping
Tarot Card Enamel Brooch Pin Music Fan Gift Karma Is A Cat The Problem Zinc Alloy Badge For Clothing Bag Decor Fashion Jewelry
Tarot Card Enamel Brooch Pin Music Fan Gift Karma Is A Cat The Problem Zinc Alloy Badge For Clothing Bag Decor Fashion Jewelry
like
Find Similar
Pink tarot card enamel pin with flower pattern and It's Me text decoration - Pink Flower Lyrics (QHXZ2149)
Tarot The Lover card enamel pin with blonde character and heart eyes in mint green - Tarot The Lover (QHXZ2152)
Taylor Swift The Star tarot card enamel pin featuring the blue Eras Tour gown design - Tarot Card Star Portrait (QHXZ2153)
Tarot Card Enamel Brooch Pin Music Fan Gift Karma Is A Cat The Problem Zinc Alloy Badge For Clothing Bag Decor Fashion Jewelry
-9%
$0.55
No MOQ
 · 
17 views
Cute Cartoon Animal Enamel Pin Zinc Alloy Frog Hedgehog Rabbit Goose Brooch Badge For Clothing Bag Accessories Decoration
Cute Cartoon Animal Enamel Pin Zinc Alloy Frog Hedgehog Rabbit Goose Brooch Badge For Clothing Bag Accessories Decoration
like
Find Similar
Cute white goose alloy brooch with a yellow flower hat in a creative cartoon style - Sun Flower Goose (QHXZ580)
Cute hedgehog enamel pin with green lotus leaf hat, creative cartoon animal brooch gift - Lotus Leaf Hedgehog (QHXZ581)
Cute green frog enamel pin holding white daisies cartoon animal badge accessory - Daisy Frog (QHXZ582)
Cartoon white bunny holding a red strawberry enamel pin with colorful details - Strawberry Rabbit (QHXZ583)
Cute Cartoon Animal Enamel Pin Zinc Alloy Frog Hedgehog Rabbit Goose Brooch Badge For Clothing Bag Accessories Decoration
-9%
$0.55
No MOQ
Cute Black Cat Enamel Brooch Cartoon Animal Metal Badge Floral Kitten Enamel Pin Jewelry Accessory For Bag Clothes Cap Gift
Cute Black Cat Enamel Brooch Cartoon Animal Metal Badge Floral Kitten Enamel Pin Jewelry Accessory For Bag Clothes Cap Gift
like
Find Similar
Cartoon black cat enamel pin with large yellow eyes and a small green sprout on its head - Black Cat Head with Sprout (XZ8252)
Cute black soot cat enamel pin with large yellow eyes for bags and clothing accessories - Round Face Big Eye Cat (XZ8253)
Cute black cat enamel pin with big yellow eyes and minimalist polished metal finish - Oval Lying Black Cat (XZ8254)
Cartoon black cat enamel pin with funny big yellow eyes for clothing and bags decoration - Startled Fluffy Cat (XZ8255)
+4
Cute Black Cat Enamel Brooch Cartoon Animal Metal Badge Floral Kitten Enamel Pin Jewelry Accessory For Bag Clothes Cap Gift
-9%
$0.47
Mix MOQ : 2
 · 
11 sold recently
Cute Black Cat Potted Plants Enamel Pin Cartoon Alloy Brooch Badge For Clothing Bags Coats Jackets Accessory Fashion Jewelry
Cute Black Cat Potted Plants Enamel Pin Cartoon Alloy Brooch Badge For Clothing Bags Coats Jackets Accessory Fashion Jewelry
like
Find Similar
Close-up of a cartoon black cat hiding among green hanging plants enamel pin badge - Cat with Hanging Plant Style (XZ7438)
Enamel pin featuring a black cat hiding behind a fiddle-leaf fig in an orange pot - Cat with Fiddle Leaf Fig Style (XZ7439)
Cartoon black cat hiding in green snake plant enamel pin badge accessory - Cat with Snake Plant Style (XZ7440)
Cute black cat enamel pin with green plants and floral garden elements design - Cat Climbing Green Plant Style (XZ7441)
+1
Cute Black Cat Potted Plants Enamel Pin Cartoon Alloy Brooch Badge For Clothing Bags Coats Jackets Accessory Fashion Jewelry
-8%
$0.63
Mix MOQ : 2
Free Shipping
Cute Cartoon Cactus Succulent Potted Plant Enamel Brooch Pin Alloy Baking Lacquer Badge For Women Men Clothes Bag Decoration
Cute Cartoon Cactus Succulent Potted Plant Enamel Brooch Pin Alloy Baking Lacquer Badge For Women Men Clothes Bag Decoration
like
Find Similar
Cute purple succulent cactus enamel brooch with multicolor pot in rose gold finish - Purple Succulent Yellow Pot (xz8138)
Cute green cactus enamel pin in a purple pot with golden metallic edges and details - Tall Green Cactus Purple Pot (xz8139)
Cute succulent enamel pin in purple pot with green leaves and rose gold metal plating - Agave Style Green Plant Purple Pot (xz8140)
Cute cactus succulent enamel pin with red heart flowers and white pot design - Heart Flowered Potted Plant (xz8146)
+5
Cute Cartoon Cactus Succulent Potted Plant Enamel Brooch Pin Alloy Baking Lacquer Badge For Women Men Clothes Bag Decoration
-9%
$0.68
No MOQ
Free Shipping
Kawaii Black Cat Enamel Pin Cute Kitten Animal Brooch Alloy Metal Badge Jewelry Decoration For Bags Clothes Women Gift
Kawaii Black Cat Enamel Pin Cute Kitten Animal Brooch Alloy Metal Badge Jewelry Decoration For Bags Clothes Women Gift
like
Find Similar
Cartoon black cat enamel pin with large yellow eyes and a small green sprout on its head - Black Cat Head with Sprout Style (XZ8252)
Cute black soot cat enamel pin with large yellow eyes for bags and clothing accessories - Sitting Black Cat Style (XZ8253)
Cute black cat enamel pin with big yellow eyes and minimalist polished metal finish - Simple Black Cat Head Style (XZ8254)
Cartoon black cat enamel pin with funny big yellow eyes for clothing and bags decoration - Startled Spiky Black Cat Style (XZ8255)
+4
Kawaii Black Cat Enamel Pin Cute Kitten Animal Brooch Alloy Metal Badge Jewelry Decoration For Bags Clothes Women Gift
-9%
$0.47
No MOQ
 · 
20 sold recently
Cute Cartoon Black Cat Potted Plant Alloy Enamel Brooch Animal Foliage Painted Badge For Clothing Bags Fashion Unisex Jewelry
Cute Cartoon Black Cat Potted Plant Alloy Enamel Brooch Animal Foliage Painted Badge For Clothing Bags Fashion Unisex Jewelry
like
Find Similar
Close-up of a cartoon black cat hiding among green hanging plants enamel pin badge - Cat Hiding in Plants (XZ7438)
Enamel pin featuring a black cat hiding behind a fiddle-leaf fig in an orange pot - Cat Behind Fiddle Leaf Fig (XZ7439)
Cartoon black cat hiding in green snake plant enamel pin badge accessory - Cat in Snake Plant (XZ7440)
Cute black cat enamel pin with green plants and floral garden elements design - Cat with Monstera (XZ7441)
+1
Cute Cartoon Black Cat Potted Plant Alloy Enamel Brooch Animal Foliage Painted Badge For Clothing Bags Fashion Unisex Jewelry
-8%
$0.63
No MOQ
Free Shipping
Cute Cartoon Character Enamel Pin Alloy Brooch Personalized Q-Version Character Decorative Badge Accessories For Clothes Bags
Cute Cartoon Character Enamel Pin Alloy Brooch Personalized Q-Version Character Decorative Badge Accessories For Clothes Bags
like
Find Similar
Cute golden metal angel boy enamel pin with white wings and small crown accessory - Angel Style (XZ6120)
Cartoon enamel pin featuring a boy with purple butterfly wings and a red rose detail - Purple Butterfly Wing Style (XZ6121)
Cute enamel brooch featuring a winking cartoon boy with pink petals and gold trim - Pink Flower Decor Style (XZ6122)
Enamel pin of a boy in blue sportswear with white headphones and black hair - Sport Headphone Boy Style (XZ6124)
NewCute Cartoon Character Enamel Pin Alloy Brooch Personalized Q-Version Character Decorative Badge Accessories For Clothes Bags
-9%
$0.39
No MOQ
Halloween Ghost Pumpkin Alloy Enamel Brooch Pin Funny Boo Cartoon Badge Commemorative Medal For Costume Accessory Jewelry
Halloween Ghost Pumpkin Alloy Enamel Brooch Pin Funny Boo Cartoon Badge Commemorative Medal For Costume Accessory Jewelry
like
Find Similar
Cute Halloween enamel pin featuring a smiling orange pumpkin and white ghost design - Pumpkin Ghost Style (XZ6795)
Detail of cute white ghost enamel pin with orange Boo lettering for Halloween - Boo Ghost Style (XZ6794)
Close-up of cute ghost enamel pin holding a pumpkin basket and orange flower bouquet - Flower Pumpkin Ghost Style (XZ6793)
Cartoon white ghost enamel pin with orange horns holding a knife for Halloween accessory - Demon Knife Ghost Style (XZ6792)
+1
Halloween Ghost Pumpkin Alloy Enamel Brooch Pin Funny Boo Cartoon Badge Commemorative Medal For Costume Accessory Jewelry
-9%
$0.60
No MOQ
Free Shipping
Gothic Snake Enamel Pin Brooch Alloy Floral Sword Snake Badge Dark Style Punk Jewelry For Clothing Backpack Hat Accessory
Gothic Snake Enamel Pin Brooch Alloy Floral Sword Snake Badge Dark Style Punk Jewelry For Clothing Backpack Hat Accessory
like
Find Similar
Detailed enamel twin snake brooch with celestial moon and floral patterns in gold finish - Double Black and White Snake with Orange Flower Style (XZ5960)
Gothic Snake Enamel Pin Brooch Alloy Floral Sword Snake Badge Dark Style Punk Jewelry For Clothing Backpack Hat Accessory
-9%
$0.50
No MOQ
Free Shipping
Zinc Alloy Enamel Anatomy Brooch Pin Medical Heart Brain Lung Kidney Uterus Design Lapel Badge For Doctor Nurse Student Clothing Jewelry
Zinc Alloy Enamel Anatomy Brooch Pin Medical Heart Brain Lung Kidney Uterus Design Lapel Badge For Doctor Nurse Student Clothing Jewelry
like
Find Similar
Enamel lung brooch with daisy flowers and 'just breathe' text on white background - Lung Daisy Style (QHXZ1197)
Lungs anatomy enamel brooch with We Be-lung Together text in pink and red tones - Lung We Be-Lung Together Style (QHXZ1198)
Lung anatomy enamel pin with heartbeat wave and Breathe text for medical apparel - Lung Breathe Heart Style (QHXZ1199)
Pink lung organ enamel pin with The Lung Whisperer text for medical accessories - The Lung Whisperer Style (QHXZ1200)
+13
Zinc Alloy Enamel Anatomy Brooch Pin Medical Heart Brain Lung Kidney Uterus Design Lapel Badge For Doctor Nurse Student Clothing Jewelry
-10%
$0.37-0.60
No MOQ
Free Shipping
Funny Fat Cat Enamel Pin Zinc Alloy Animal Brooch For Backpack Clothing Badge Cute Floral Garland Kitten Lapel Pin Jewelry
Funny Fat Cat Enamel Pin Zinc Alloy Animal Brooch For Backpack Clothing Badge Cute Floral Garland Kitten Lapel Pin Jewelry
like
Find Similar
Funny enamel cat pin with grumpy face and colorful flower wreath for bags and clothes - Flower Garland Cat Style (QHXZ5495)
Cute cartoon white cat enamel brooch with white curly hair and elegant black outfit - Formal Dress Cat Style (QHXZ5496)
Funny Fat Cat Enamel Pin Zinc Alloy Animal Brooch For Backpack Clothing Badge Cute Floral Garland Kitten Lapel Pin Jewelry
-8%
$0.45
No MOQ
Cute Cartoon Animal Enamel Brooch Set Frog Rabbit Cat Chick Enamel Pin Alloy Painted Lapel Pin Badges For Clothes Women Kids Jewelry Gift
Cute Cartoon Animal Enamel Brooch Set Frog Rabbit Cat Chick Enamel Pin Alloy Painted Lapel Pin Badges For Clothes Women Kids Jewelry Gift
like
Find Similar
Cute green cartoon frog enamel pin with white daisy flower detail on white background - Daisy Frog Style (QHXZ5442)
Macro detail of yellow duck enamel pin wearing a purple flower hat on white background - Flower Hat Chick Style (QHXZ5443)
Detailed view of a cute Siamese cat enamel pin with a green leaf hat accessory - Green Leaf Cat Style (QHXZ5445)
Detail of a cute bunny enamel pin wearing a pink flower petal hat and green stem - Pink Flower Rabbit Style (QHXZ5444)
Cute Cartoon Animal Enamel Brooch Set Frog Rabbit Cat Chick Enamel Pin Alloy Painted Lapel Pin Badges For Clothes Women Kids Jewelry Gift
-8%
$0.42
No MOQ
Free Shipping
Vintage Alloy Rhinestone Men Brooch Pin Gothic Animal Snake Tiger Medusa Skull Shield Badge Suit Lapel Pin Fashion Jewelry
Vintage Alloy Rhinestone Men Brooch Pin Gothic Animal Snake Tiger Medusa Skull Shield Badge Suit Lapel Pin Fashion Jewelry
like
Find Similar
Macro detail of golden vintage fleur-de-lis brooch with antique embossed finish - Iris Flower Gold (1562)
Macro detail of a vintage silver fleur-de-lis brooch on a wooden stand - Iris Flower Silver (1562)
Retro skeleton hand brooch in vintage gold finish with red and white crystal rhinestones - Skull Hand Gold (1682)
Gothic skull hand brooch in antique silver finish with black and navy blue rhinestones - Skull Hand Silver (1682)
+51
Vintage Alloy Rhinestone Men Brooch Pin Gothic Animal Snake Tiger Medusa Skull Shield Badge Suit Lapel Pin Fashion Jewelry
-9%
$1.05-1.44
No MOQ
Elegant Metal Chain Belt With Artificial Pearl For Women Fashion Waist Chain Floral Three Row Beads Dress Accessories
Elegant Metal Chain Belt With Artificial Pearl For Women Fashion Waist Chain Floral Three Row Beads Dress Accessories
like
Find Similar
Detail of elegant gold-tone chain waist belt with three rows of white pearls on white fabric - Single Row Pearl Style
Detail of a three-row pearl waist chain with golden metal links and adjustable lobster clasp - S-Shape Pearl Style
Close-up of golden floral waist chain with three rows of elegant white pearls - Flower Pearl
Three-strand white pearl waist chain for women with elegant golden flower metal buckle - Triple Row Pearl Style
Elegant Metal Chain Belt With Artificial Pearl For Women Fashion Waist Chain Floral Three Row Beads Dress Accessories
-4%
$1.92
No MOQ
Women Elastic Metal Chain Belt For Dresses Luxury Rhinestone Artificial Pearl Buckle Gold Silver Waist Accessories
Women Elastic Metal Chain Belt For Dresses Luxury Rhinestone Artificial Pearl Buckle Gold Silver Waist Accessories
like
Find Similar
Elegant gold metal spring waist chain for women with sparkling crystal leaf clasp - Gold (Leaf Shape 19414)
Silver metallic spring waist belt for women featuring a leaf buckle with sparkly rhinestones - Silver (Leaf Shape 19414)
Women's gold elastic metal waist belt featuring a buckle with three rows of rhinestones - Gold (3-Row Rhinestone 19413)
Elegant silver spring waist chain for women with sparkling rhinestone embellishments - Silver (3-Row Rhinestone 19413)
+6
Women Elastic Metal Chain Belt For Dresses Luxury Rhinestone Artificial Pearl Buckle Gold Silver Waist Accessories
$2.01
Mix MOQ : 2
Elegant Artificial Pearl Waist Chain For Women Alloy Rhinestone Inlaid Dress Belt Vintage Korean Style Decorative Waistband
Elegant Artificial Pearl Waist Chain For Women Alloy Rhinestone Inlaid Dress Belt Vintage Korean Style Decorative Waistband
like
Find Similar
Elegant double-row pearl waist belt featuring a luxury rhinestone buckle on black fabric - Oval Buckle Style (8140)
Elegant pearl waist chain with sparkling rhinestone buckle for dresses and outfits - Large Bead Buckle Style (8132)
Elegant double-strand pearl waist chain with sparkling rhinestone bow clasp accessory - Bowknot Style (8130)
Elegant double-row pearl waist chain with a gold-tone rhinestone oval buckle - Oval Floral Style (8128)
+7
Elegant Artificial Pearl Waist Chain For Women Alloy Rhinestone Inlaid Dress Belt Vintage Korean Style Decorative Waistband
-5%
$1.23
No MOQ
Women's Fashion Elastic Corset Belt Wide Waist Band Large Gold Silver Metal Chain Buckle Snap Closure Decorative Belt For Dresses
Women's Fashion Elastic Corset Belt Wide Waist Band Large Gold Silver Metal Chain Buckle Snap Closure Decorative Belt For Dresses
like
Find Similar
Women's wide elastic corset belt with stylish oversized gold chain buckle detail - Gold Buckle Black
Women's fashion white elastic belt featuring a chunky polished gold chain buckle - Gold Buckle White
Women's dark blue elastic waist belt featuring oversized gold metal chain link buckle design - Gold Buckle Navy Blue
Women's wide elastic waist belt featuring a chunky silver metal chain buckle design - Black with Silver Flower Buckle
+2
Women's Fashion Elastic Corset Belt Wide Waist Band Large Gold Silver Metal Chain Buckle Snap Closure Decorative Belt For Dresses
-4%
$2.68
No MOQ
Women Fashion Rhinestone Buckle Elastic Corset Belt Crocodile Pattern Faux Leather Wide Belt For Dress Decoration
Women Fashion Rhinestone Buckle Elastic Corset Belt Crocodile Pattern Faux Leather Wide Belt For Dress Decoration
like
Find Similar
Black wide elastic waist belt with faux crocodile leather and rhinestone crown buckle - Crown Style (EL223-5) / 75cm
Elastic black waist belt with silver heart-shaped diamond buckle and crocodile texture - Heart Style (EL223-6) / 75cm
Elastic black wide belt for women featuring a sparkling silver fox head buckle with rhinestones - Fox Style (EL223-7) / 75cm
Elastic black wide belt for women featuring a sparkling silver flower rhinestone buckle - Silver Flower Style (EL223-1) / 75cm
+17
Women Fashion Rhinestone Buckle Elastic Corset Belt Crocodile Pattern Faux Leather Wide Belt For Dress Decoration
-4%
$2.22
No MOQ
Elegant Artificial Pearl Waist Chain Belt Rhinestone Bowknot Buckle Elastic Dress Decorative Accessories For Women
Elegant Artificial Pearl Waist Chain Belt Rhinestone Bowknot Buckle Elastic Dress Decorative Accessories For Women
like
Find Similar
Elegant triple-layer pearl waist belt with infinity crystal buckle in silver finish - Silver Infinity Symbol Buckle (HYY19169)
Detail of elegant pearl waist belt with floral rhinestone buckle for dresses - Silver Flower Shape Buckle (HYY19168)
Detail view of double-row pearl waist chain with a rose gold rhinestone bow buckle - Gold Rhinestone Bowknot Buckle (HYY19155)
Three-row pearl waist belt featuring a floral rhinestone buckle for dresses - Gold Oval Large Gem Floral Buckle (HYY19154金扣)
+1
Elegant Artificial Pearl Waist Chain Belt Rhinestone Bowknot Buckle Elastic Dress Decorative Accessories For Women
-4%
$1.75
Mix MOQ : 2
Women's Elastic Thin Belt Korean Minimalist Fashion Canvas Cinch Waistband Alloy Round Buckle Decorative Dress Belt For Commuter
Women's Elastic Thin Belt Korean Minimalist Fashion Canvas Cinch Waistband Alloy Round Buckle Decorative Dress Belt For Commuter
like
Find Similar
Brown elastic waist belt for women with elegant golden triple-ring buckle and faux leather finish - Triple Ring Interlocking Style (19197) / 75cm / Camel (19197)
Elastic beige waist belt for dresses with golden interlocking triple ring buckle - Triple Ring Interlocking Style (19197) / 75cm / Beige (19197)
Women's slim black elastic waist belt featuring a gold triple-ring interlocking buckle - Triple Ring Interlocking Style (19197) / 75cm / Black (19197)
Elastic skinny waist belt in dark brown with a polished golden arrow metal buckle - Arrow Geometric Buckle Style (19356) / 65cm / Black (19356)
+9
NewWomen's Elastic Thin Belt Korean Minimalist Fashion Canvas Cinch Waistband Alloy Round Buckle Decorative Dress Belt For Commuter
-5%
$1.04-1.59
Mix MOQ : 2
Go to

More in accessories

Explore more in flower clips

clawartificialsharkhairpinsenamelgoldsmallponytaildiysquare
stylealloyshark cliphandmadetasseldesignalloy enamelstargirls hair accessoriesresin hair

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access