Everful

Wholesale headscarves

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Headscarves

Find the perfect pieces: satin scarves, fashion scarves, polyester scarves and more

All products in headscarves

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Abstract Oil Painting Print Square Scarf Elegant Imitation Satin Satin Headscarf Versatile Neck Wrap For Women
Abstract Oil Painting Print Square Scarf Elegant Imitation Satin Satin Headscarf Versatile Neck Wrap For Women
like
Find Similar
Artistic ballet print silk scarf in soft purple with delicate rolled edges hanging display - 66-70cm / Violet (FG184-1)
Ink painting silk scarf with blue abstract pattern and champagne gold hem on wooden rack - 66-70cm / Khaki (FG184-2)
Detailed view of ink-painted dancer print on silk-like scarf with hand-rolled lavender edges - 66-70cm / Pink Edge (FG184-3)
Artistic ink print square silk scarf with sakura signature on high-quality satin fabric - 66-70cm / White Edge (FG184-4)
Abstract Oil Painting Print Square Scarf Elegant Imitation Satin Satin Headscarf Versatile Neck Wrap For Women
-4%
$1.37
Mix MOQ : 2
Women Floral Print Square Scarf Satin Polyester Satin Like Contrast Border Versatile Elegant Headscarf Neck Wrap
Women Floral Print Square Scarf Satin Polyester Satin Like Contrast Border Versatile Elegant Headscarf Neck Wrap
like
Find Similar
Detail of floral silk scarf with red border hanging elegantly in a stylish interior set - Red (FG179-1) / 66-70cm
Elegant floral silk scarf in black and white tied to a black top for a chic look - Black (FG179-2) / 66-70cm
Elegant floral silk scarf with orange satin border displayed on a metal rack - Warm Orange (FG179-3) / 66-70cm
Floral print silk satin scarf with orange borders draped over dark clothing - Deep Blue Orange (FG179-4) / 66-70cm
Women Floral Print Square Scarf Satin Polyester Satin Like Contrast Border Versatile Elegant Headscarf Neck Wrap
$1.44
Mix MOQ : 2
Elegant Square Satin Scarf Printed Satin Like Headscarf Neck Handkerchief Versatile Fashion Accessories For Women Chic
Elegant Square Satin Scarf Printed Satin Like Headscarf Neck Handkerchief Versatile Fashion Accessories For Women Chic
like
Find Similar
Close-up of elegant silk scarf with orange and gold patterns draped over a metal rod - Tan
Elegant white silk scarf with green palm leaf print and emerald green stitched edges - Green
Close-up of geometric pattern silk square scarf with orange borders and smooth texture - Black
Elegant silk-like scarf featuring Art Deco blue feather patterns draped on a metal bar - Blue
Elegant Square Satin Scarf Printed Satin Like Headscarf Neck Handkerchief Versatile Fashion Accessories For Women Chic
$1.44
Mix MOQ : 2
Artistic Lotus Dragonfly Print Square Scarf Imitation Satin Satin Neck Headscarf Chic Shawl Elegant Accessory For Women
Artistic Lotus Dragonfly Print Square Scarf Imitation Satin Satin Neck Headscarf Chic Shawl Elegant Accessory For Women
like
Find Similar
Detail of silk scarf with lotus and dragonfly prints next to a stylish handbag - Purple (FG188-1)
Elegant silk scarf featuring realistic dragonfly and floral prints in vibrant colors - Orange Red (FG188-2)
Detailed close-up showing the artistic lotus and dragonfly print on a silky square scarf - Beige (FG188-3)
Detail of silk-like scarf with dragonfly floral print draped on a hanger and clothing - Blue (FG188-4)
Artistic Lotus Dragonfly Print Square Scarf Imitation Satin Satin Neck Headscarf Chic Shawl Elegant Accessory For Women
$1.44
Mix MOQ : 2
Vintage Oil Painting Square Scarf Abstract Floral Print Satin Polyester Hair Bandana Versatile Neck Headscarf Women
Vintage Oil Painting Square Scarf Abstract Floral Print Satin Polyester Hair Bandana Versatile Neck Headscarf Women
like
Find Similar
Close-up of abstract colorful silk scarf with artistic brushstrokes on a wooden hanger - Khaki (FG249-1) / 68CM
Detail of vintage floral satin square scarf with elegant yellow and brown abstract patterns - Coffee Black (FG249-2) / 68CM
Vintage oil painting style silk scarf with vibrant floral patterns on a wooden hanger - Pink (FG249-3) / 68CM
Close-up of vintage floral silk scarf with warm orange tones and silky luster texture - Orange (FG249-4) / 68CM
NewVintage Oil Painting Square Scarf Abstract Floral Print Satin Polyester Hair Bandana Versatile Neck Headscarf Women
$1.44
Mix MOQ : 2
Houndstooth Print Square Scarf Faux Satin Baroque Scroll Pattern Versatile Headscarf Neck Wrap For Women Elegant Accessories
Houndstooth Print Square Scarf Faux Satin Baroque Scroll Pattern Versatile Headscarf Neck Wrap For Women Elegant Accessories
like
Find Similar
Houndstooth silk-feel square scarf with baroque gold patterns and glossy satin finish - Navy Blue
Houndstooth silk-feel square scarf with pink baroque patterns displayed on a hanger - Pink
Detail of silk-like square scarf featuring houndstooth pattern and baroque gold accents - Beige
Elegant houndstooth silk scarf with yellow baroque print draped on a wooden hanger - Warm Orange
Houndstooth Print Square Scarf Faux Satin Baroque Scroll Pattern Versatile Headscarf Neck Wrap For Women Elegant Accessories
-4%
$1.37
Mix MOQ : 2
Square Scarf Imitation Satin Polyester Digital Print Ocean Tropical Pattern Retro Versatile Headscarf Neck Shawl For Women
Square Scarf Imitation Satin Polyester Digital Print Ocean Tropical Pattern Retro Versatile Headscarf Neck Shawl For Women
like
Find Similar
Elegant silk-like square scarf featuring green floral lobster prints for women accessories - One Size / Green
Elegant floral print satin silk scarf in white and blue, shown styled on a black dress - One Size / Light Blue
Detailed shot of yellow and white tropical print silk scarf with palm tree and sardine motif - One Size / Orange
Elegant floral silk scarf with lobster print hanging on a wooden hanger with pearl handbag - One Size / Pink
Square Scarf Imitation Satin Polyester Digital Print Ocean Tropical Pattern Retro Versatile Headscarf Neck Shawl For Women
$1.44
Mix MOQ : 2
Women Square Scarf Imitation Satin Bandana Animal Print Patchwork Leopard Zebra Pattern Versatile Headscarf Neck Shawl Chic
Women Square Scarf Imitation Satin Bandana Animal Print Patchwork Leopard Zebra Pattern Versatile Headscarf Neck Shawl Chic
like
Find Similar
Detail of silk square scarf featuring leopard and zebra print patterns with satin finish - Dark Brown Animal Print Patchwork (FG224-1) / Dark Brown
Royal blue and white patterned silk-like square scarf on a wooden hanger with pearl handbag - Navy Blue Tie-Dye Texture (FG224-2) / Navy Blue
Detail of silk-like scarf featuring mixed animal prints of leopard, tiger and zebra patterns - Black and White Animal Print Patchwork (FG224-3) / Black
Artistic red and white patterned silk square scarf draped on a black dress with pearls - Red and White Feather Gradient Texture (FG224-4) / Red
Women Square Scarf Imitation Satin Bandana Animal Print Patchwork Leopard Zebra Pattern Versatile Headscarf Neck Shawl Chic
$1.44
Mix MOQ : 2
Elegant Square Scarf Imitation Satin French Retro Chain Belt Tassel Print Headscarf Neck Wrap For Women Fashion Accessory
Elegant Square Scarf Imitation Satin French Retro Chain Belt Tassel Print Headscarf Neck Wrap For Women Fashion Accessory
like
Find Similar
Detail view of retro luxury silk scarf with chain print draped over a handbag - 66-70CM / FG199-1 Rice Yellow
Luxurious navy and white vintage silk-feel square scarf with gold chain and crest print - 66-70CM / FG199-2 Navy Blue
Elegant silk scarf with luxury chain print and vintage patterns in soft pink and purple - 66-70CM / FG199-3 Light Pink Purple
French style silk square scarf with vintage chain print and elegant satin luster finish - 66-70CM / FG199-4 Coffee
Elegant Square Scarf Imitation Satin French Retro Chain Belt Tassel Print Headscarf Neck Wrap For Women Fashion Accessory
-4%
$1.37
Mix MOQ : 2
Elegant Floral Print Square Scarf Satin Satin Feel Bandana Headscarf Neck Wrap For Women Fashion Commuter Accessories
Elegant Floral Print Square Scarf Satin Satin Feel Bandana Headscarf Neck Wrap For Women Fashion Commuter Accessories
like
Find Similar
Elegant floral print square silk scarf in pearl white and orange with vine patterns - Orange
Floral print silk square scarf hanging on a wooden hanger with modern flower pattern - White
Detail of floral printed silk square scarf hanging with elegant drape and satin texture - Brown
Floral print silk-like satin square scarf in elegant pink and white floral pattern - Pink
Elegant Floral Print Square Scarf Satin Satin Feel Bandana Headscarf Neck Wrap For Women Fashion Commuter Accessories
-4%
$1.37
Mix MOQ : 2
Women Square Scarf Imitation Satin Satin Elegant Floral Lemon Fruit Print Mediterranean Style Lightweight Neck Headscarf Shawl
Women Square Scarf Imitation Satin Satin Elegant Floral Lemon Fruit Print Mediterranean Style Lightweight Neck Headscarf Shawl
like
Find Similar
Detail of silk square scarf featuring blue citrus prints and baroque golden patterns - 66-70cm / Blue (FG212-1)
Detailed view of floral silk scarf tied as a bow on wooden hanger with knitwear - 66-70cm / Pink (FG212-2)
Detail of square silk scarf with vibrant Mediterranean lemon and blue tile prints - 66-70cm / Green (FG212-3)
Elegant floral silk square scarf with citrus prints on a hanger for women's fashion - 66-70cm / Yellow (FG212-4)
NewWomen Square Scarf Imitation Satin Satin Elegant Floral Lemon Fruit Print Mediterranean Style Lightweight Neck Headscarf Shawl
-4%
$1.37
Mix MOQ : 2
Women Vintage Floral Print Square Satin Scarf Imitation Satin Headscarf Versatile Neck Scarf Soft Elegant Shawl
Women Vintage Floral Print Square Satin Scarf Imitation Satin Headscarf Versatile Neck Scarf Soft Elegant Shawl
like
Find Similar
Close-up of elegant floral silk scarf with vibrant blue and yellow abstract flower patterns - 66-70cm / Blue
Vintage floral silk scarf with pink and blue patterns displayed on a wooden hanger - 66-70cm / Pink
Vintage floral silk satin square scarf with paisley pattern draped on a metal stand - 66-70cm / Olive Green
Elegant floral silk square scarf in mint green and white with realistic lily print - 66-70cm / Mint Green
Women Vintage Floral Print Square Satin Scarf Imitation Satin Headscarf Versatile Neck Scarf Soft Elegant Shawl
-4%
$1.37
Mix MOQ : 2
Vintage Geometric Floral Print Square Scarf Elegant Faux Satin Satin Neck Wrap Headscarf Chic Fashion Accessories For Women
Vintage Geometric Floral Print Square Scarf Elegant Faux Satin Satin Neck Wrap Headscarf Chic Fashion Accessories For Women
like
Find Similar
Elegant vintage silk-feel square scarf with geometric floral print and satin border - Black Gray (FG173-1)
Detail of vintage black and white silk scarf with clover patterns on a metal hanger - Gray White (FG173-2)
Detail of vintage orange floral silk scarf tied on a navy top with elegant wooden hanger - Warm Orange (FG173-3)
Vintage floral silk square scarf in dark brown with elegant geometric pattern hanging - Dark Brown (FG173-4)
Vintage Geometric Floral Print Square Scarf Elegant Faux Satin Satin Neck Wrap Headscarf Chic Fashion Accessories For Women
-4%
$1.37
Mix MOQ : 2
Floral Print Square Scarf Satin Like Satin Neck Kerchief Elegant Lightweight Fashion Headscarf For Women Chic Versatile
Floral Print Square Scarf Satin Like Satin Neck Kerchief Elegant Lightweight Fashion Headscarf For Women Chic Versatile
like
Find Similar
Floral print silk scarf with pink flower pattern and vibrant fuchsia borders - 68x68cm / Pink
Floral print silk scarf with orange flower pattern and red border on navy dress - 68x68cm / Orange
Close-up of floral silk-feel scarf with elegant botanical prints and high-gloss finish - 68x68cm / Black
Elegant white square silk scarf with blue floral print and contrasting blue border - 68x68cm / Blue
Floral Print Square Scarf Satin Like Satin Neck Kerchief Elegant Lightweight Fashion Headscarf For Women Chic Versatile
-4%
$1.37
Mix MOQ : 2
Floral Print Square Scarf Vintage Satin Feeling Polyester Satin Elegant Bandana Headscarf For Women Fashion Accessory
Floral Print Square Scarf Vintage Satin Feeling Polyester Satin Elegant Bandana Headscarf For Women Fashion Accessory
like
Find Similar
Vintage sage green floral faux silk scarf with elegant drape on wooden hanger - Mint Green
Vintage floral silk square scarf in navy blue with elegant yellow flower prints - Navy Blue
Detail of vintage floral silk scarf with satin finish and delicate rolled edges - Nude Apricot
Elegant bright orange silk square scarf with red floral prints on a wooden hanger - Orange
Floral Print Square Scarf Vintage Satin Feeling Polyester Satin Elegant Bandana Headscarf For Women Fashion Accessory
$1.44
Mix MOQ : 2
Leopard Print Square Scarf Satin Polyester Satin Like Neck Headscarf Elegant Greek Key Border Fashion Accessory Women
Leopard Print Square Scarf Satin Polyester Satin Like Neck Headscarf Elegant Greek Key Border Fashion Accessory Women
like
Find Similar
Leopard print silk scarf in red and white with geometric borders hung on a stand - Red (FG150-1) / 66-70cm
Elegant leopard print silk scarf with Greek key border displayed on a wooden hanger - Orange (FG150-2) / 66-70cm
Elegant leopard print silk scarf in champagne gold with Greek key pattern borders - Khaki (FG150-3) / 66-70cm
Detail of leopard print silk scarf with geometric border hanging on a metal rack - Coffee (FG150-4) / 66-70cm
Leopard Print Square Scarf Satin Polyester Satin Like Neck Headscarf Elegant Greek Key Border Fashion Accessory Women
-4%
$1.37
Mix MOQ : 2
Women Square Scarf Simulated Satin Satin Chain Geometric Print Rose Floral Pattern Soft Glossy Headscarf Neck Scarf
Women Square Scarf Simulated Satin Satin Chain Geometric Print Rose Floral Pattern Soft Glossy Headscarf Neck Scarf
like
Find Similar
Pink silk-like scarf with abstract chain print and rose patterns on a display stand - Pink
Elegant geometric chain print silk scarf in champagne beige hanging on a wooden hanger - Brown Red
Detail of elegant beige silk square scarf with floral print and clean white edges - Light Khaki
Elegant lavender silk scarf with purple chain patterns hanging on a beige hanger - Purple
Women Square Scarf Simulated Satin Satin Chain Geometric Print Rose Floral Pattern Soft Glossy Headscarf Neck Scarf
$1.44
Mix MOQ : 2
Elegant Floral Print Square Scarf Faux Satin Satin Shawl For Women Lightweight Versatile Neck Headscarf
Elegant Floral Print Square Scarf Faux Satin Satin Shawl For Women Lightweight Versatile Neck Headscarf
like
Find Similar
Detailed view of pink and blue silk scarf tied with elegant floral patterns on a mannequin - Pink
Close-up of lightweight floral silk scarf with blue border hanging on a metal stand - Blue
Elegant orange silk scarf with floral and coral patterns on a black dress and wooden hanger - Orange
Detailed view of floral silk scarf hanging on metal rod with vibrant orange hem - Orange Border (White Base)
Elegant Floral Print Square Scarf Faux Satin Satin Shawl For Women Lightweight Versatile Neck Headscarf
$1.44
Mix MOQ : 2
Elegant Butterfly Print Square Scarf Imitation Satin Satin Versatile Shawl Headscarf Fashion Accessory For Women
Elegant Butterfly Print Square Scarf Imitation Satin Satin Versatile Shawl Headscarf Fashion Accessory For Women
like
Find Similar
Elegant navy blue silk-feel scarf featuring white butterfly prints and simple borders - 66-70cm / Blue
Elegant white silk-like scarf with black butterfly print hanging on a classic hanger - 66-70cm / White
Detail of silk-like navy scarf with white butterfly prints hanging on a metal rack - 66-70cm / Black
Elegant orange silk-like scarf with black butterfly print on a wooden hanger - 66-70cm / Orange
Elegant Butterfly Print Square Scarf Imitation Satin Satin Versatile Shawl Headscarf Fashion Accessory For Women
-4%
$1.37
Mix MOQ : 2
Women Large Floral Print Faux Satin Square Scarf Elegant Satin Bandana Headscarf Neck Shawl Versatile Smooth Fashion Accessory
Women Large Floral Print Faux Satin Square Scarf Elegant Satin Bandana Headscarf Neck Shawl Versatile Smooth Fashion Accessory
like
Find Similar
Detail of floral silk scarf with orange and green patterns on a blue knit top - Orange Green (FG107-1)
Close-up of a vibrant floral satin scarf with elegant red-orange print and silk texture - Orange Red (FG107-2)
Satin floral silk scarf with vibrant yellow and green patterns on a wooden hanger - Yellow Green (FG107-3)
Detailed view of floral silk scarf with vibrant pink borders and elegant flower patterns - Pink (FG107-4)
Women Large Floral Print Faux Satin Square Scarf Elegant Satin Bandana Headscarf Neck Shawl Versatile Smooth Fashion Accessory
-4%
$1.37
Mix MOQ : 2
Floral Print Square Scarf Imitation Satin Satin Headscarf Versatile Elegant Fashion Bandana For Women Chic Accessory
Floral Print Square Scarf Imitation Satin Satin Headscarf Versatile Elegant Fashion Bandana For Women Chic Accessory
like
Find Similar
Pink printed silk scarf with floral and feather patterns hanging elegantly on a stand - FG93-1 Pink
Floral printed satin silk scarf with light green and orange flowers on wooden hanger - FG93-2 Green
Elegant floral print silk scarf in light blue with pink peonies draped on a wooden hanger - FG93-3 Blue
Detail of elegant floral print silk square scarf with light pink gradient and soft drape - FG93-4 Light Pink
NewFloral Print Square Scarf Imitation Satin Satin Headscarf Versatile Elegant Fashion Bandana For Women Chic Accessory
$1.44
Mix MOQ : 2
Satin-Like Satin Neckerchief Paisley Print Square Scarf For Women Elegant Vintage Hair Bandana Headscarf Versatile Accessory
Satin-Like Satin Neckerchief Paisley Print Square Scarf For Women Elegant Vintage Hair Bandana Headscarf Versatile Accessory
like
Find Similar
Elegant paisley faux silk square scarf in green and beige draped on a white hanger - 70cm / Green (FG98-1)
Classic red paisley silk square scarf with striped border hanging on display - 70cm / Red (FG98-2)
Classic paisley pattern square silk scarf in royal blue and orange on a white top - 70cm / Royal Blue (FG98-3)
Detail of paisley pattern silk scarf with blue and lilac tones draped on a leather bag - 70cm / Light Blue (FG98-4)
Satin-Like Satin Neckerchief Paisley Print Square Scarf For Women Elegant Vintage Hair Bandana Headscarf Versatile Accessory
-4%
$1.37
Mix MOQ : 2
Knitted Striped Triangle Scarf Women Winter Warm Decorative Headscarf Small Neckerchief Korean Fashionable Neck Warmer
Knitted Striped Triangle Scarf Women Winter Warm Decorative Headscarf Small Neckerchief Korean Fashionable Neck Warmer
like
Find Similar
Detail of orange and white striped knitted scarf on a white fabric background - Orange Stripes
Detailed close-up of green and cream striped knitted scarf with soft wool texture - Green Stripes
Detailed close-up of a black and white striped knitted scarf on a soft white fabric surface - Black Stripe
Detail of knitted striped scarf showing texture and soft brown beige pattern on fabric - Coffee Striped
Knitted Striped Triangle Scarf Women Winter Warm Decorative Headscarf Small Neckerchief Korean Fashionable Neck Warmer
$4.61
No MOQ
Striped Knitted Scarf With Ties Warm Winter Plush Neck Warmer Headscarf Korean Style Sweet For Women
Striped Knitted Scarf With Ties Warm Winter Plush Neck Warmer Headscarf Korean Style Sweet For Women
like
Find Similar
Detail of two-tone striped mohair knit neck warmer with tie-up straps and fashion label - Lake Blue Grey
Close-up of chunky purple and green striped knit scarf with decorative soft bow tie detail - Purple & Green
Detail of striped knit scarf showing fuzzy wool texture and decorative white label - Brown
Detail of pink and grey striped knit scarf with soft texture and bow tie closure - Pink Gray
NewStriped Knitted Scarf With Ties Warm Winter Plush Neck Warmer Headscarf Korean Style Sweet For Women
$4.32
No MOQ
Floral Lace Bandana Headscarf French Retro Embroidery Mesh Head Wrap Decorative Fake Collar For Women Pastoral Sweet Style
Floral Lace Bandana Headscarf French Retro Embroidery Mesh Head Wrap Decorative Fake Collar For Women Pastoral Sweet Style
like
Find Similar
Macro detail of white floral embroidery on a lace shawl with delicate wavy scalloped edges - Potted Flower (LS0024)
Detailed close-up of white floral lace headscarf with daisy embroidery and delicate ribbons - Water Drop Flower (LS0024)
Detail view of white floral lace headscarf with delicate embroidery and ribbons - Seven Leaf Flower (LS0024)
Close-up of vintage white floral lace headscarf with delicate scalloped edges and ribbons - Dots and Lines (LS0024)
Floral Lace Bandana Headscarf French Retro Embroidery Mesh Head Wrap Decorative Fake Collar For Women Pastoral Sweet Style
$2.59
No MOQ
Free Shipping
Women's Paisley Print Satin Square Scarf Elegant Faux Silk Neck Scarf Headscarf For Daily Travel Versatile Lightweight Shawl
Women's Paisley Print Satin Square Scarf Elegant Faux Silk Neck Scarf Headscarf For Daily Travel Versatile Lightweight Shawl
like
Find Similar
Elegant white square silk scarf featuring a classic black paisley print and satin finish - White
Dark blue silk scarf with white paisley patterns displayed on a white round table - Blue
Luxurious deep red square silk scarf featuring white paisley patterns on a satin fabric - Brick Red
Elegant red square silk scarf with white paisley patterns for versatile styling - Caramel color
Women's Paisley Print Satin Square Scarf Elegant Faux Silk Neck Scarf Headscarf For Daily Travel Versatile Lightweight Shawl
$1.35
No MOQ
Women Sweet Pastoral Cotton Lace Floral Embroidery Triangle Headscarf Scalloped Edge Hollow Out Hairband For Beach Vacation
Women Sweet Pastoral Cotton Lace Floral Embroidery Triangle Headscarf Scalloped Edge Hollow Out Hairband For Beach Vacation
like
Find Similar
Pastoral white lace floral headscarf with delicate embroidery and scalloped edges - Off White
Pink floral lace triangle headscarf for women with elegant embroidery and wavy edges - Pink
Detail shot of black lace headscarf with delicate floral embroidery on white fabric - Black
Detail of light blue lace bandana with white floral embroidery on a textured background - Blue
Women Sweet Pastoral Cotton Lace Floral Embroidery Triangle Headscarf Scalloped Edge Hollow Out Hairband For Beach Vacation
$4.90
No MOQ
Free Shipping
French Retro Lace Triangle Scarf Women Pastoral Floral Butterfly Print Hair Band Cotton Blend Headscarf Decor Bandana
French Retro Lace Triangle Scarf Women Pastoral Floral Butterfly Print Hair Band Cotton Blend Headscarf Decor Bandana
like
Find Similar
Floral mint green lace head scarf with vintage pastoral butterfly patterns and trim - 28*115cm / Green
Detail of black lace trim and jacquard floral pattern on a retro French style bandana - 28*115cm / Black
Detail of pink lace hair scarf with white floral butterfly embroidery and wavy edges - 28*115cm / Pink
Detail of beige lace triangle scarf showing delicate floral embroidery and scalloped edges - 28*115cm / Off White
French Retro Lace Triangle Scarf Women Pastoral Floral Butterfly Print Hair Band Cotton Blend Headscarf Decor Bandana
$3.60
No MOQ
Free Shipping
Women Elegant Floral Square Scarf Fresh Literary Satin Imitation Satin Neck Scarf Retro Rose Cherry Printed Headscarf Versatile Accessory
Women Elegant Floral Square Scarf Fresh Literary Satin Imitation Satin Neck Scarf Retro Rose Cherry Printed Headscarf Versatile Accessory
like
Find Similar
Detail of floral silk scarf featuring red roses and cherry patterns on cream base - Black Border (70FJ501-Black)
Detail view of floral silk scarf featuring red roses, cherries and contrasting red borders - Red Border (70FJ501-Red)
Detailed view of square silk scarf with vintage rose and cherry print on white background - Pink Border (70FJ501-Pink)
Detail of square silk scarf with red rose, cherry, and blue star prints on white fabric - Gray Border (70FJ501-Gray)
Women Elegant Floral Square Scarf Fresh Literary Satin Imitation Satin Neck Scarf Retro Rose Cherry Printed Headscarf Versatile Accessory
-5%
$1.51
No MOQ
Women's Hollow Out Daisy Cotton Scarf Vintage Floral Crochet Triangular Shawl Headscarf Sweet Pastoral Lace Neck Scarf Wrap
Women's Hollow Out Daisy Cotton Scarf Vintage Floral Crochet Triangular Shawl Headscarf Sweet Pastoral Lace Neck Scarf Wrap
like
Find Similar
Detailed view of floral lace crochet daisy shawl with delicate hollow pattern and long ties - Off White
Detailed view of black floral lace crochet pattern on a sheer cotton triangular shawl - Black
Detail of brown cotton lace shawl with daisy crochet pattern and elegant hollow-out design - Khaki
Women's Hollow Out Daisy Cotton Scarf Vintage Floral Crochet Triangular Shawl Headscarf Sweet Pastoral Lace Neck Scarf Wrap
$5.76
No MOQ
Free Shipping
Leopard Print Satin Durag Pirate Hat For Men Women Unisex Hip Hop Style Polyester Headwrap Headscarf Outdoor Sun Protection Cap
Leopard Print Satin Durag Pirate Hat For Men Women Unisex Hip Hop Style Polyester Headwrap Headscarf Outdoor Sun Protection Cap
like
Find Similar
Detail of leopard print durag bandana with long straps for fitness and fashion - Gold Leopard Print
Leopard print durag with long tails and silky finish shown from a 45-degree side angle - Beige Leopard
Outdoor leopard print pirate headband cap with adjustable straps for sun protection - Dark Leopard
Leopard Print Satin Durag Pirate Hat For Men Women Unisex Hip Hop Style Polyester Headwrap Headscarf Outdoor Sun Protection Cap
-4%
$0.96
No MOQ
Elegant Floral Print Square Scarf For Women Polyester Satin Simulation Satin Neck Scarf Headscarf Aesthetic Accessory
Elegant Floral Print Square Scarf For Women Polyester Satin Simulation Satin Neck Scarf Headscarf Aesthetic Accessory
like
Find Similar
Detail of red and white floral silk scarf with elegant stripes and smooth texture - Red
Elegant green floral square silk scarf tied on a hanger with aesthetic plant leaf pattern - Green
Elegant ivory silk square scarf with purple floral print and striped border detail - Pink
Blue and white silk-like square scarf with floral and checkered print on a black top - Navy Blue
Elegant Floral Print Square Scarf For Women Polyester Satin Simulation Satin Neck Scarf Headscarf Aesthetic Accessory
-4%
$1.37
Mix MOQ : 2
Women Embroidered Lace Triangle Scarf Elegant Hollow Out Mesh Floral Headscarf Vintage French Style Neck Scarf Hair Band For Travel Party
Women Embroidered Lace Triangle Scarf Elegant Hollow Out Mesh Floral Headscarf Vintage French Style Neck Scarf Hair Band For Travel Party
like
Find Similar
Elegant black lace triangle scarf with floral embroidery and scalloped edges - Black Embroidered Lace / 25*100cm
Elegant white lace triangle scarf with delicate floral embroidery and scalloped edges - White Embroidered Lace / 25*100cm
Pink lace triangle scarf for women featuring delicate floral embroidery and sheer fabric - Pink Embroidered Lace / 25*100cm
Elegant dark green lace triangle scarf with 3D floral embroidery and wavy edges - Green Embroidered Lace / 25*100cm
Women Embroidered Lace Triangle Scarf Elegant Hollow Out Mesh Floral Headscarf Vintage French Style Neck Scarf Hair Band For Travel Party
$2.59
No MOQ
Free Shipping
Sweet Floral Embroidered Lace Triangle Headscarf For Women Hollow Out Scalloped Edge Retro Breathable Elegant Scarf Wrap
Sweet Floral Embroidered Lace Triangle Headscarf For Women Hollow Out Scalloped Edge Retro Breathable Elegant Scarf Wrap
like
Find Similar
Detail of embroidered floral lace triangle scarf on a rustic minimalist background - Gray
Elegant black lace floral embroidery triangle scarf displayed on a white textured background - Black
Elegant pink lace triangle headscarf with white floral embroidery for women - Pink
Elegant white lace bandana with floral embroidery and scalloped edges on lifestyle backdrop - Off White
Sweet Floral Embroidered Lace Triangle Headscarf For Women Hollow Out Scalloped Edge Retro Breathable Elegant Scarf Wrap
$5.19
No MOQ
Free Shipping
Women's French Elegant Satin Square Scarf Vintage Houndstooth Camellia Floral Print Bandana Neck Scarf Fashion Headscarf
Women's French Elegant Satin Square Scarf Vintage Houndstooth Camellia Floral Print Bandana Neck Scarf Fashion Headscarf
like
Find Similar
Elegant houndstooth printed silk scarf in brown and beige with a pearl buckle detail - Printed with Pearl Scarf Buckle / White
Elegant houndstooth silk square scarf with camellia print and pearl buckle detail - Camellia Houndstooth with Pearl Buckle / Black
Elegant houndstooth and floral print silk scarf with pearl metal buckle in deep green - Green Multi-color with Pearl Rhinestone Buckle / Green
Elegant houndstooth silk scarf in black, beige, and brown with geometric patterns - Coffee Patchwork Pattern / Brown
Women's French Elegant Satin Square Scarf Vintage Houndstooth Camellia Floral Print Bandana Neck Scarf Fashion Headscarf
$1.99
No MOQ
Elegant Satin Square Scarf For Women Vintage Floral Chain Print Fashion Silk Like Headscarf Hair Accessory Bandana
Elegant Satin Square Scarf For Women Vintage Floral Chain Print Fashion Silk Like Headscarf Hair Accessory Bandana
like
Find Similar
Elegant orange and white satin silk scarf with vintage chain print in a black gift box - 70cmx70cm / Orange
Elegant blue and white silk scarf with carriage patterns on a black handbag - 70cmx70cm / Blue
Elegant silk-satin scarf with golden equestrian motifs tied on a black handbag - 70cmx70cm / Yellow
Pink and purple floral print silk scarf displayed on a black textured tray - 70cmx70cm / Pink
NewElegant Satin Square Scarf For Women Vintage Floral Chain Print Fashion Silk Like Headscarf Hair Accessory Bandana
$1.30
No MOQ
Retro Floral Print Square Scarf Elegant Imitation Satin Shawl Vintage All Match Headscarf For Women Office Fashion Accessory
Retro Floral Print Square Scarf Elegant Imitation Satin Shawl Vintage All Match Headscarf For Women Office Fashion Accessory
like
Find Similar
Detail of elegant green silk scarf featuring delicate white floral prints and twill texture - Green
Detail of purple faux silk scarf with vintage floral print draped over a metal rod - Gray
Detail of silk-like scarf with white floral print and elegant drapes near a bag - Brown
Detail of silk-like floral scarf draped over metal stand with soft black and white print - Black
Retro Floral Print Square Scarf Elegant Imitation Satin Shawl Vintage All Match Headscarf For Women Office Fashion Accessory
-5%
$1.89
Mix MOQ : 2
Printed Square Scarf Faux Satin Floral Pattern Headscarf Elegant Shawl For Women Neck Hair Band Lightweight Artistic
Printed Square Scarf Faux Satin Floral Pattern Headscarf Elegant Shawl For Women Neck Hair Band Lightweight Artistic
like
Find Similar
Floral print silk square scarf with pink cherry blossoms hanging on a metal rack - Pink / 70x70cm
Light blue floral silk square scarf with white prints hanging on a white hanger - Blue / 70x70cm
Floral faux silk scarf with cream base and green border draped on a wooden hanger - Green / 70x70cm
Detail of silk-like scarf featuring pink floral patterns and delicate rolled edges - Orange / 70x70cm
Printed Square Scarf Faux Satin Floral Pattern Headscarf Elegant Shawl For Women Neck Hair Band Lightweight Artistic
$1.44
Mix MOQ : 2
Vintage Satin Square Scarf For Women Paisley Polka Dot Printed Headscarf Elegant Large Silk Like Decorative Shawl Wrap Accessory
Vintage Satin Square Scarf For Women Paisley Polka Dot Printed Headscarf Elegant Large Silk Like Decorative Shawl Wrap Accessory
like
Find Similar
French vintage style dark blue paisley and polka dot square scarf for sun protection - Paisley Polka Dot Style (1) / Large / Navy Blue
Classic orange paisley and polka dot square bandana for women stylish summer headscarf - Paisley Polka Dot Style (2) / Large / Orange
Classic orange paisley and polka dot square bandana for women, 90cm vintage style scarf - Paisley Cashew Style (3) / Large / Orange Red
French retro paisley and polka dot peach pink silk-like square scarf and headband - Paisley Polka Dot Style (4) / Large / Light Pink
Vintage Satin Square Scarf For Women Paisley Polka Dot Printed Headscarf Elegant Large Silk Like Decorative Shawl Wrap Accessory
$1.87
No MOQ
Artistic Print Satin Square Scarf For Women Luxury Branch Palm Leaf Large Wrap Elegant Silk Like Fashion Shawl Headscarf
Artistic Print Satin Square Scarf For Women Luxury Branch Palm Leaf Large Wrap Elegant Silk Like Fashion Shawl Headscarf
like
Find Similar
Artistic 130cm silk-like scarf with palm leaves and vibrant animal prints in red and blue - Red
Silk-like square scarf 130cm with elegant pine leaf and branch floral print flat lay - Green
130cm square silk scarf featuring colorful palm leaf patterns and navy blue borders - Navy Blue
Silk-like scarf with colorful palm leaf pattern and burgundy border on white background - Burgundy
Artistic Print Satin Square Scarf For Women Luxury Branch Palm Leaf Large Wrap Elegant Silk Like Fashion Shawl Headscarf
-9%
$5.19
No MOQ
Mori Style Floral Cotton Square Scarf For Women Small Fresh Headscarf Hair Band Decorative Neck Scarf Fashion Accessory
Mori Style Floral Cotton Square Scarf For Women Small Fresh Headscarf Hair Band Decorative Neck Scarf Fashion Accessory
like
Find Similar
Detail of floral printed scarf with yellow trim on elegant white textured surface - 58cm x 58cm / Yellow
Blue floral silk square scarf with colorful daisy pattern for hair and neck styling - 58cm x 58cm / Sky Blue
Detailed close-up of a knotted floral silk scarf with small red and orange flowers - 58cm x 58cm / Orange
Detailed macro view of lightweight floral print scarf with soft chiffon panel edges - 58cm x 58cm / Blue
Mori Style Floral Cotton Square Scarf For Women Small Fresh Headscarf Hair Band Decorative Neck Scarf Fashion Accessory
$2.31
No MOQ
Vintage Paisley Floral Printed Cotton Square Scarf For Women Literary Satin Silk Like Headscarf Neck Handbag Wrap Scarf
Vintage Paisley Floral Printed Cotton Square Scarf For Women Literary Satin Silk Like Headscarf Neck Handbag Wrap Scarf
like
Find Similar
Vintage paisley pattern cotton linen small square silk scarf for hair and neck styling - 58x58cm / Purple
Detail of vintage paisley silk scarf with purple daisy pattern on a white plush background - 58x58cm / Blue
Detail of vintage paisley silk scarf knotted on white textured faux fur background - 58x58cm / Coffee
Close-up of vintage paisley cotton linen silk scarf tied in a knot on white surface - 58x58cm / Black
Vintage Paisley Floral Printed Cotton Square Scarf For Women Literary Satin Silk Like Headscarf Neck Handbag Wrap Scarf
$1.73
No MOQ
Vintage Plaid Triangle Scarf For Women Cotton Blend Neckerchief With Tassel Retro Check Bandana Headscarf Neck Wrap Decor
Vintage Plaid Triangle Scarf For Women Cotton Blend Neckerchief With Tassel Retro Check Bandana Headscarf Neck Wrap Decor
like
Find Similar
Retro plaid cotton linen triangle scarf with tassels on a lifestyle background - Beige
Retro plaid cotton linen triangle scarf with dark brown tassels and soft texture - Khaki
Vintage plaid cotton linen triangle scarf with tassels and embroidered polka dots - Gray
Detailed view of vintage plaid scarf featuring cotton-linen texture and tassel edges - Coffee
Vintage Plaid Triangle Scarf For Women Cotton Blend Neckerchief With Tassel Retro Check Bandana Headscarf Neck Wrap Decor
$4.03
No MOQ
Free Shipping
Elegant Butterfly Print Satin Square Scarf For Women Sweet Fashion Headscarf Hair Band Sun Protection Scarf Bag Decor
Elegant Butterfly Print Satin Square Scarf For Women Sweet Fashion Headscarf Hair Band Sun Protection Scarf Bag Decor
like
Find Similar
Gradient purple and yellow silk scarf with butterfly print tied in a bow - Purple Gradient Butterfly (70FJ467) / Purple
Blue butterfly pattern square silk scarf in gray gradient with elegant decorative props - Silver Gray Butterfly (70FJ467) / Silver
Detail of pink and yellow gradient silk scarf with butterfly print tied in a bow - Pink Yellow Gradient Butterfly (70FJ467) / Pink
Detail of silk scarf with blue butterfly print and elegant aesthetic lifestyle props - Blue White Print Butterfly (70FJ467) / Blue
Elegant Butterfly Print Satin Square Scarf For Women Sweet Fashion Headscarf Hair Band Sun Protection Scarf Bag Decor
-5%
$1.51
No MOQ
Elegant Rose Print Twill Satin Square Scarf For Women Artistic Floral Large Headscarf Shawl Wrap Fashion Decorative Neck Scarf
Elegant Rose Print Twill Satin Square Scarf For Women Artistic Floral Large Headscarf Shawl Wrap Fashion Decorative Neck Scarf
like
Find Similar
Elegant green and beige twill silk scarf with large rose floral prints for women - Emerald Green
Elegant silk scarf with red roses pattern draped over a white shirt for women - Bright Red
Elegant twill silk large square scarf with artistic rose floral print and yellow borders - Bright Yellow
Elegant navy and beige floral twill silk scarf draped on a chair for a stylish accessory look - Sapphire Blue
Elegant Rose Print Twill Satin Square Scarf For Women Artistic Floral Large Headscarf Shawl Wrap Fashion Decorative Neck Scarf
-4%
$2.33
No MOQ
French Style Satin Square Scarf Satin Like Lemon Fruit Striped Print Headscarf For Women Neck Scarf Handbag Accessory Bandana
French Style Satin Square Scarf Satin Like Lemon Fruit Striped Print Headscarf For Women Neck Scarf Handbag Accessory Bandana
like
Find Similar
Detail of French silk scarf with yellow lemon print and purple vertical stripes pattern - Purple / 65*65
Detail of silk satin scarf featuring yellow lemon prints and blue vertical stripes - Blue / 65*65
Detail of French style silk scarf with fresh lemon print and red striped border - Red / 65*65
Detailed view of lightweight French silk scarf with lemon print and pink stripes - Pink / 65*65
French Style Satin Square Scarf Satin Like Lemon Fruit Striped Print Headscarf For Women Neck Scarf Handbag Accessory Bandana
-5%
$1.51
No MOQ
Vintage Paisley Print Square Scarf For Women Cotton Blend Bohemian Bandana Headscarf For Music Festival Daily Accessories
Vintage Paisley Print Square Scarf For Women Cotton Blend Bohemian Bandana Headscarf For Music Festival Daily Accessories
like
Find Similar
Vintage paisley print bandana in purple and green, styled as an elegant headscarf - Green
Detailed view of paisley silk scarf knotted elegantly on a wooden tray with a leather strap - Black
Close-up of vintage paisley print silk scarf showing smooth texture and detailed patterns - Coffee
Detail of red paisley cotton bandana showing high-quality texture and printing - Red
NewVintage Paisley Print Square Scarf For Women Cotton Blend Bohemian Bandana Headscarf For Music Festival Daily Accessories
$1.73
No MOQ
Vintage Geometric Print Cotton Blend Square Scarf For Women Retro Pattern Headband Neck Scarf Fashion Accessory Headscarf
Vintage Geometric Print Cotton Blend Square Scarf For Women Retro Pattern Headband Neck Scarf Fashion Accessory Headscarf
like
Find Similar
Detailed view of a retro geometric pattern cotton scarf with chic black and white motifs - 58x58cm / Black
Green and cream silk square scarf with geometric wave patterns on white velvet - 58x58cm / Green
Detail of red and white geometric cotton scarf tied as a bow on a beige rug - 58x58cm / Red
Close-up of bohemian brown geometric print cotton scarf tied in a stylish circular knot - 58x58cm / Coffee
+1
Vintage Geometric Print Cotton Blend Square Scarf For Women Retro Pattern Headband Neck Scarf Fashion Accessory Headscarf
$1.73
No MOQ
Vintage Geometric Totem Print Square Scarf For Women Lightweight Chic Headscarf Neck Kerchief Fashion Soft Cotton Wrap
Vintage Geometric Totem Print Square Scarf For Women Lightweight Chic Headscarf Neck Kerchief Fashion Soft Cotton Wrap
like
Find Similar
Gray geometric print neck scarf with oval patterns and premium rolled hem finish - 58x58cm / Green
Detailed view of square silk scarf with vintage geometric patterns and rolled edge - 58x58cm / Black
Macro shot of brown retro square scarf with blue oval patterns on soft white plush - 58x58cm / Coffee
Detail of navy blue geometric pattern silk scarf styled as an elegant necktie accessory - 58x58cm / Navy Blue
+1
Vintage Geometric Totem Print Square Scarf For Women Lightweight Chic Headscarf Neck Kerchief Fashion Soft Cotton Wrap
$1.73
No MOQ
Square Scarf Polyester Satin Satin Paisley Ethnic Print Headscarf Shawl Vintage Bohemian Style For Women Fashion Decor
Square Scarf Polyester Satin Satin Paisley Ethnic Print Headscarf Shawl Vintage Bohemian Style For Women Fashion Decor
like
Find Similar
Close-up of vintage paisley pattern square scarf with elegant silk-like texture and drape - Gray
Elegant 70cm red silk scarf with vintage leaf patterns and bold geometric prints - Red
Square Scarf Polyester Satin Satin Paisley Ethnic Print Headscarf Shawl Vintage Bohemian Style For Women Fashion Decor
-4%
$1.37
Mix MOQ : 2
Elegant Satin Polyester Square Scarf With Paisley Phoenix Print Large Satiny Feeling Hijab Headscarf For Women
Elegant Satin Polyester Square Scarf With Paisley Phoenix Print Large Satiny Feeling Hijab Headscarf For Women
like
Find Similar
Elegant black silk scarf with orange paisley patterns draped on a black frame - Best-selling (Black Print)
Elegant navy blue satin scarf with red paisley and bird prints on a black metal frame - Navy Blue
Golden phoenix paisley silk scarf in orange and blue displayed on a sleek black metal rack - Orange
Elegant Satin Polyester Square Scarf With Paisley Phoenix Print Large Satiny Feeling Hijab Headscarf For Women
$1.59
No MOQ
Vintage Floral Embroidery Lace Square Scarf For Women Rose Paisley Pattern Mesh Bandana Decorative Headscarf Hair Accessory
Vintage Floral Embroidery Lace Square Scarf For Women Rose Paisley Pattern Mesh Bandana Decorative Headscarf Hair Accessory
like
Find Similar
Detail of beige square scarf featuring brown paisley embroidery and intricate lace edges - Rust Brown
Elegant 80x80cm black lace square scarf with bronze paisley floral embroidery on a mannequin - Paisley Embroidery Style / Black
Detailed embroidery of paisley patterns and lace edges on a white square scarf - Paisley Embroidery Style / Beige
Detail of light pink floral lace headscarf with copper scalloped edges and paisley embroidery - Paisley Embroidery Style / Light Skin Red
+1
NewVintage Floral Embroidery Lace Square Scarf For Women Rose Paisley Pattern Mesh Bandana Decorative Headscarf Hair Accessory
-4%
$3.72
Mix MOQ : 2
Free Shipping
Women's Vintage Cotton Scarf With Lace Trim Thin Breathable Solid Color Shawl Sunshade Headscarf For Summer Casual Accessory
Women's Vintage Cotton Scarf With Lace Trim Thin Breathable Solid Color Shawl Sunshade Headscarf For Summer Casual Accessory
like
Find Similar
Pale yellow linen scarf with white lace trim and minimalist brand tag on a lifestyle background - Cheese Yellow
Detail view of pink cotton linen scarf with white crochet lace border and brand tag - Ballet Powder
Macro shot of light blue cotton linen scarf fabric with delicate white lace edge detailing - Glacier Blue
Detail of grey-purple cotton linen scarf with elegant white lace borders and brand label - Taro Purple
+2
Women's Vintage Cotton Scarf With Lace Trim Thin Breathable Solid Color Shawl Sunshade Headscarf For Summer Casual Accessory
$5.48
No MOQ
Vintage Satin Square Scarf For Women Printed Floral Animal Pattern Large Headscarf Hair Band Neck Scarf Hijab Shawl Accessorie
Vintage Satin Square Scarf For Women Printed Floral Animal Pattern Large Headscarf Hair Band Neck Scarf Hijab Shawl Accessorie
like
Find Similar
90cm large satin square scarf with colorful baroque pattern draped on a handbag - 90 x 90cm / Baroque Multicolor
Retro silk square scarf with colorful bird print draped on white leather handbag - 90 x 90cm / Red
90cm silk satin scarf with tiger and floral print draped over a stylish handbag - 90 x 90cm / Blue Tiger Print
Detailed pattern of a 90cm square silk scarf with floral prints draped over a beige handbag - 90 x 90cm / Dusty Pink
+2
Vintage Satin Square Scarf For Women Printed Floral Animal Pattern Large Headscarf Hair Band Neck Scarf Hijab Shawl Accessorie
$1.38
Mix MOQ : 2
Vintage Paisley Print Satin Square Scarf For Women Ethnic Style Patchwork Headscarf Elegant Silk Feeling Shawl Wrap Neck Scarf
Vintage Paisley Print Satin Square Scarf For Women Ethnic Style Patchwork Headscarf Elegant Silk Feeling Shawl Wrap Neck Scarf
like
Find Similar
Detail of satin square scarf featuring vibrant paisley patterns and yellow gold borders - Pink and Blue Patchwork
Vintage orange and black paisley satin square scarf displayed flat on a white background - Orange and Grey Patchwork
Detail of vintage paisley pattern on large 90cm satin silk square scarf with blue and red hues - Red Blue and Black Patchwork
90cm vintage paisley satin silk square scarf featuring colorful four-leaf clover pattern - Royal Blue and Red Patchwork
Vintage Paisley Print Satin Square Scarf For Women Ethnic Style Patchwork Headscarf Elegant Silk Feeling Shawl Wrap Neck Scarf
$1.59
No MOQ
Vintage Floral Print Square Scarf Elegant Geometric Satin Twill Headscarf Large Shawl Wrap For Women
Vintage Floral Print Square Scarf Elegant Geometric Satin Twill Headscarf Large Shawl Wrap For Women
like
Find Similar
Detail view of monochrome floral silk scarf with geometric star patterns on a display stand - White / 90cmx90cm
Detail of floral and geometric print scarf with contrast hem hanging on a wooden hanger - Black / 90cmx90cm
Floral and geometric pattern 90cm square scarf with premium satin finish and silk texture - Orange / 90cmx90cm
Close-up of elegant floral and geometric patterns on a soft 90cm silk-like square scarf - Khaki / 90cmx90cm
Vintage Floral Print Square Scarf Elegant Geometric Satin Twill Headscarf Large Shawl Wrap For Women
-5%
$1.89
Mix MOQ : 2
Zebra Print Satin Satin Square Scarf Fashion Versatile Bandana Headscarf Elegant Neck Wrap Hair Accessory For Women
Zebra Print Satin Satin Square Scarf Fashion Versatile Bandana Headscarf Elegant Neck Wrap Hair Accessory For Women
like
Find Similar
Classic black and white zebra print silk square scarf with a smooth lustrous finish - 66-70cm / Black
Detail of elegant black and white zebra print silk scarf hanging on a gold hanger - 66-70cm / White
Classic brown and white zebra print silk scarf tied on a white sleeveless top - 66-70cm / Brown
Elegant beige and brown zebra print silk square scarf styled over a black dress - 66-70cm / Khaki
Zebra Print Satin Satin Square Scarf Fashion Versatile Bandana Headscarf Elegant Neck Wrap Hair Accessory For Women
-4%
$1.37
Mix MOQ : 2
Elegant Floral Print Satin Square Scarf For Women Lightweight Silk Like Bandana Headscarf Neck Scarf Fashion Wrap Accessories
Elegant Floral Print Satin Square Scarf For Women Lightweight Silk Like Bandana Headscarf Neck Scarf Fashion Wrap Accessories
like
Find Similar
Elegant floral print silk-like satin square scarf with a minimalist white and yellow pattern - 70cm / Blue Gray
Detail of floral silk scarf with green edges showing smooth satin texture and drape - 70cm / Green
Detail of silk-like scarf with pink floral prints and elegant hanging drape texture - 70cm / Pink
Detailed texture of floral silk scarf with vibrant orange border hung on a metal rack - 70cm / Orange
NewElegant Floral Print Satin Square Scarf For Women Lightweight Silk Like Bandana Headscarf Neck Scarf Fashion Wrap Accessories
-4%
$1.37
Mix MOQ : 2
Floral Print Square Scarf Imitation Satin Satin Neckerchief Versatile Fashion Headscarf Elegant Women Chic Wrap Accessory
Floral Print Square Scarf Imitation Satin Satin Neckerchief Versatile Fashion Headscarf Elegant Women Chic Wrap Accessory
like
Find Similar
Floral print silk scarf on a wooden hanger with an elegant handbag and golden tray - Bright Yellow
Elegant white silk square scarf with floral prints and pink rolled edges for women - Light Pink
Silk-like floral scarf with blue and pink blossoms elegantly draped on a wooden hanger - Rose Red
Close-up of floral print silk scarf featuring elegant purple flowers and champagne satin edges - Beige Border
Floral Print Square Scarf Imitation Satin Satin Neckerchief Versatile Fashion Headscarf Elegant Women Chic Wrap Accessory
-4%
$1.37
Mix MOQ : 2
Fashion Floral Print Satin Square Scarf Silk-Like Neck Scarf For Women Decorative Headscarf Handbag Wrap Accessories
Fashion Floral Print Satin Square Scarf Silk-Like Neck Scarf For Women Decorative Headscarf Handbag Wrap Accessories
like
Find Similar
Close-up of sky blue border silk-like square scarf with elegant floral and berry patterns - 70x70cm / Blue
Detail view of floral silk scarf featuring botanical prints and stylish black borders - 70x70cm / Black
Detail of elegant ivory silk scarf with lemon and floral print hanging on a bar - 70x70cm / Khaki Purple
Elegant silk-like scarf with pink tropical leaf print and magenta border displayed on a rack - 70x70cm / Rose Red
Fashion Floral Print Satin Square Scarf Silk-Like Neck Scarf For Women Decorative Headscarf Handbag Wrap Accessories
$1.07
Mix MOQ : 10
Go to

More in accessories

Explore more in headscarves

squarecolorstylehollowhandmadekerchiefdailytasselsdecoration accessoriescover
polyesterbandlonggirlsheadpartywarmsteelartificial pearls rhinestonesadjustable

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access