Everful

Wholesale headscarves

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Headscarves

Find the perfect pieces: satin scarves, fashion scarves, polyester scarves and more

All products in headscarves

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Elegant Floral Print Satin Square Scarf For Women Lightweight Silk Like Fashion Headscarf Neck Scarf For Travel Party Daily Accessory
Elegant Floral Print Satin Square Scarf For Women Lightweight Silk Like Fashion Headscarf Neck Scarf For Travel Party Daily Accessory
like
Find Similar
Elegant square floral silk scarf featuring abstract oil painting patterns and red borders - Red Floral Bouquet
Elegant floral print silk square scarf with vibrant orange border on display hanger - Orange Floral Bouquet
Floral print silk square scarf with blue border draped on a rack with fashion accessories - Blue Floral Bouquet
Close-up of a floral silk scarf with tropical bird prints and a bold red border edge - Black Floral Bird
+2
Elegant Floral Print Satin Square Scarf For Women Lightweight Silk Like Fashion Headscarf Neck Scarf For Travel Party Daily Accessory
$1.07
Mix MOQ : 10
Cotton Floral Print Square Scarf For Women With Tassels Vintage Pastoral Butterfly Horse Pattern Beach Headscarf Fashion Neck Scarf
Cotton Floral Print Square Scarf For Women With Tassels Vintage Pastoral Butterfly Horse Pattern Beach Headscarf Fashion Neck Scarf
like
Find Similar
Close-up of floral cotton scarf with colorful flower prints and light purple tassel edges - Purple Flower
Detailed texture of cotton floral headscarf with dark brown decorative tassels - Red Flower
Detailed macro view of green cotton floral scarf with deer print and corner tassels - Green Pony
Close-up of pink square scarf with equestrian floral print and red corner tassels - Pink Horse
+2
Cotton Floral Print Square Scarf For Women With Tassels Vintage Pastoral Butterfly Horse Pattern Beach Headscarf Fashion Neck Scarf
$2.59
No MOQ
Floral Print Square Scarf Women Tassel Decor Cotton Blend Lightweight Neckerchief Elegant Fashion Daily Scarf Headscarf
Floral Print Square Scarf Women Tassel Decor Cotton Blend Lightweight Neckerchief Elegant Fashion Daily Scarf Headscarf
like
Find Similar
Detailed view of floral cotton linen scarf with bright orange tassel accents - Peach Pink
Detail view of the floral scarf corner featuring pink tassels and a decorative border - Rose Red
Detail of floral cotton linen scarf featuring blue flowers and green corner tassels - Green
Lightweight floral cotton linen scarf with green tassels displayed on a white table - Purple
+2
Floral Print Square Scarf Women Tassel Decor Cotton Blend Lightweight Neckerchief Elegant Fashion Daily Scarf Headscarf
$2.59
No MOQ
Fashion Houndstooth Pattern Square Scarf For Women Satin Polyester Neckerchief Professional Lightweight Decorative Silk Like Hair Wrap Headscarf
Fashion Houndstooth Pattern Square Scarf For Women Satin Polyester Neckerchief Professional Lightweight Decorative Silk Like Hair Wrap Headscarf
like
Find Similar
Golden houndstooth faux silk square scarf with white border and grey rolled edges - 70*70cm / Yellow
Orange and beige houndstooth silk-like square scarf with taupe borders flat lay view - 70*70cm / Pink
Fashion Houndstooth Pattern Square Scarf For Women Satin Polyester Neckerchief Professional Lightweight Decorative Silk Like Hair Wrap Headscarf
$2.10
Mix MOQ : 2
Women Elegant Satin Square Scarf Bohemian Feather Print Large Sun Protection Shawl Versatile Headscarf Fashion Accessory
Women Elegant Satin Square Scarf Bohemian Feather Print Large Sun Protection Shawl Versatile Headscarf Fashion Accessory
like
Find Similar
Detailed close-up of a 90cm silk square scarf with colorful feathers and unicorn pattern - Red
Silk-like square scarf with vibrant feather patterns draped on a wooden frame - Orange Feather (C637) / Orange
Bohemian silk scarf with colorful feather patterns and artistic unicorn illustration - Pink
Vibrant feather pattern square scarf for women in bohemian style and colorful silk fabric - Multicolor Feather Print (C637) / Rose Red
+1
Women Elegant Satin Square Scarf Bohemian Feather Print Large Sun Protection Shawl Versatile Headscarf Fashion Accessory
$1.87
No MOQ
Japanese Style Floral Cotton Linen Triangle Headscarf Vintage Rural Pastoral Embroidery Lace Trim Hair Scarf For Women
Japanese Style Floral Cotton Linen Triangle Headscarf Vintage Rural Pastoral Embroidery Lace Trim Hair Scarf For Women
like
Find Similar
Macro detail of brown pleated cotton-linen scarf with black floral embroidery and lace trim - 100*30cm / Coffee
Macro detail of light green cotton linen triangle scarf with floral embroidery and wavy edges - 100*30cm / Green
Close-up of cream cotton linen bandana with delicate black floral embroidery and wavy edges - 100*30cm / Off White
Detailed embroidery of white floral patterns and wavy edges on black cotton linen fabric - 100*30cm / Black
+1
Japanese Style Floral Cotton Linen Triangle Headscarf Vintage Rural Pastoral Embroidery Lace Trim Hair Scarf For Women
$3.46
No MOQ
Free Shipping
Women Vintage Leaf Print Cotton Square Scarf With Lace Trim Decorative Neck Scarf Fashion Headscarf Hair Band Accessory
Women Vintage Leaf Print Cotton Square Scarf With Lace Trim Decorative Neck Scarf Fashion Headscarf Hair Band Accessory
like
Find Similar
Detail of ginger yellow scarf featuring white leaf patterns and delicate lace border - Bandana / Yellow
Close-up of blue linen scarf featuring white leaf patterns and delicate grey lace edges - Bandana / Blue
Detail of burgundy cotton linen scarf with white leaf print and lace crochet edge - Bandana / Red
Detailed view of dark green linen scarf with leaf patterns and lace embroidery edges - Bandana / Green
+1
Women Vintage Leaf Print Cotton Square Scarf With Lace Trim Decorative Neck Scarf Fashion Headscarf Hair Band Accessory
$2.74
No MOQ
Vintage Paisley Floral Square Scarf Women Lightweight Cotton Neckerchief Headscarf Commuting Retro Fashion Accessory
Vintage Paisley Floral Square Scarf Women Lightweight Cotton Neckerchief Headscarf Commuting Retro Fashion Accessory
like
Find Similar
Detail of coffee paisley silk scarf with daisy pattern on minimalist white background - Paisley Style
Detail of burgundy square scarf with bear prints and stripe edges on a magazine - Fruit Orchard Red
Detail of silk-like square scarf with sunflower prints and blue striped edges - Fruit Orchard Green
Vintage navy blue and sage green floral silk square scarf with striped patterns - Wildflower
+1
Vintage Paisley Floral Square Scarf Women Lightweight Cotton Neckerchief Headscarf Commuting Retro Fashion Accessory
$2.45
No MOQ
Women Vintage Satin Satin Like Large Square Scarf Leopard Floral Rose Print Elegant Shawl Wrap Retro Headscarf
Women Vintage Satin Satin Like Large Square Scarf Leopard Floral Rose Print Elegant Shawl Wrap Retro Headscarf
like
Find Similar
Detail of satin square scarf with red rose pattern and leopard print border - Yellow / 90*90cm
Leopard print and red rose pattern on royal blue square silk scarf for women - Blue / 90*90cm
Detail of silk-like satin scarf with green center, pink flowers, and leopard print border - Green / 90*90cm
Detailed view of square satin scarf featuring floral rose center and leopard print border - Navy Blue / 90*90cm
+2
Women Vintage Satin Satin Like Large Square Scarf Leopard Floral Rose Print Elegant Shawl Wrap Retro Headscarf
-5%
$1.70
No MOQ
Elegant Simulation Satin Satin Square Scarf Women Retro Chain Print Hijab Headscarf Luxury Paisley Pattern Fashion Shawl Wrap
Elegant Simulation Satin Satin Square Scarf Women Retro Chain Print Hijab Headscarf Luxury Paisley Pattern Fashion Shawl Wrap
like
Find Similar
Light blue satin scarf with floral and chain prints worn as a stylish headscarf - 90*90cm / Light Blue Satin Floral (Model)
Satin silk scarf with horse chain print in pink and purple, elegant square 90x90cm wrap - 90*90cm / Magenta Equestrian Chain
Elegant 90x90cm satin silk scarf with vintage buckle print and floral pattern - 90*90cm / Orange Border Vintage Belt Buckle
Classic paisley print satin square scarf featuring nautical chain and tassel patterns - 90*90cm / Sky Blue Navy Paisley
Elegant Simulation Satin Satin Square Scarf Women Retro Chain Print Hijab Headscarf Luxury Paisley Pattern Fashion Shawl Wrap
$1.59
Mix MOQ : 2
Elegant Floral Print Satin Scarf Large Square Headscarf Satiny Hair Wrap Shawl For Women Retro Baroque Fashion Accessory
Elegant Floral Print Satin Scarf Large Square Headscarf Satiny Hair Wrap Shawl For Women Retro Baroque Fashion Accessory
like
Find Similar
Elegant 90cm satin silk scarf with vintage floral prints in orange and cream white - Yellow
Elegant 90cm satin square scarf featuring vintage lotus floral print and purple borders - Purple
Blue floral satin silk scarf draped on black stand with baroque pattern 90cm - Blue
Detailed close-up of 90cm floral satin scarf with intricate vintage royal patterns - Orange Red
Elegant Floral Print Satin Scarf Large Square Headscarf Satiny Hair Wrap Shawl For Women Retro Baroque Fashion Accessory
$1.15
Mix MOQ : 2
Large Square Scarf Satin Imitation Satin Vintage Floral Animal Print Headscarf Hijab For Women Lightweight Soft Smooth
Large Square Scarf Satin Imitation Satin Vintage Floral Animal Print Headscarf Hijab For Women Lightweight Soft Smooth
like
Find Similar
Detail of satin scarf featuring vibrant jungle zebra print and smooth silk texture - One Size / Blue (Zebra Jungle Print)
Detailed view of satin silk scarf featuring vibrant zebra and jungle botanical patterns - One Size / Navy Blue (Zebra Jungle Print)
Satin silk square scarf featuring vintage equestrian harness print and horse chain motifs - One Size / Red & Black Horsebit Chain Style (#3)
Black and gold satin square scarf with chain sun pattern worn as a chic headscarf - One Size / Black & Gold Chain Sun Flower Style (#4)
Large Square Scarf Satin Imitation Satin Vintage Floral Animal Print Headscarf Hijab For Women Lightweight Soft Smooth
$1.44
Mix MOQ : 2
Floral Print Square Scarf Elegant Satin Twill Satin Like Shawl Sun Protection Headscarf Fashion Neck Wrap For Women
Floral Print Square Scarf Elegant Satin Twill Satin Like Shawl Sun Protection Headscarf Fashion Neck Wrap For Women
like
Find Similar
Floral silk-like square scarf with yellow and blue contrast border on beige sweater - Blue and White Print
Purple silk-like square scarf with white daisy floral prints hanging on a hanger - Blue Purple Floral
Elegant 90x90cm floral silk satin square scarf with orange and brown print on a hanger - Yellow and White Floral
Elegant 90x90cm black silk satin square scarf featuring monochrome floral and geometric patterns - Black and White Pattern
Floral Print Square Scarf Elegant Satin Twill Satin Like Shawl Sun Protection Headscarf Fashion Neck Wrap For Women
$2.54
Mix MOQ : 2
Large Satin Square Scarf Imitation Satin Chain Equestrian Print Headscarf Bandana For Women Retro Elegant Neck Wrap
Large Satin Square Scarf Imitation Satin Chain Equestrian Print Headscarf Bandana For Women Retro Elegant Neck Wrap
like
Find Similar
Classic 90cm square satin scarf featuring red and blue chain print with golden horse motif - Navy Red
90cm satin scarf with equestrian chain print and golden horsebit patterns for women - Khaki
90cm square satin scarf featuring black and gold equestrian horse head chain print - Black Khaki
Detail of equestrian satin scarf with yellow horse head print and chain patterns - Black Yellow
Large Satin Square Scarf Imitation Satin Chain Equestrian Print Headscarf Bandana For Women Retro Elegant Neck Wrap
$1.79
No MOQ
Oriental Art Print Square Scarf Satin Polyester Satiny Hair Wrap Ethnic Style Headscarf
Oriental Art Print Square Scarf Satin Polyester Satiny Hair Wrap Ethnic Style Headscarf
like
Find Similar
Dunhuang art satin silk square scarf 90cm featuring vibrant orange and green ethnic prints - 90*90cm / Bright Orange
Dunhuang Flying Apsaras silk scarf with red and gold traditional Chinese mural patterns - 90*90cm / Bright Red
Dunhuang Flying Apsaras 90cm satin silk square scarf with colorful oriental art prints - 90*90cm / Navy Blue
90cm Dunhuang art silk scarf with colorful Buddhist mural prints and satin finish - 90*90cm / Khaki
Oriental Art Print Square Scarf Satin Polyester Satiny Hair Wrap Ethnic Style Headscarf
$1.50
No MOQ
Retro Paisley Print Satin Square Scarf Women Vintage Floral Satin Like Headscarf Hair Bandana Neck Wrap
Retro Paisley Print Satin Square Scarf Women Vintage Floral Satin Like Headscarf Hair Bandana Neck Wrap
like
Find Similar
Retro paisley satin square scarf in beige and yellow with silky sheen for elegant styling - Off-white
Red 70cm satin paisley silk scarf with vintage floral patterns on a desk - Burgundy
Satin silk paisley square headscarf in dark grey with yellow and brown floral patterns - Black
Golden paisley satin square scarf 70cm with vintage floral patterns on marble surface - Camel
NewRetro Paisley Print Satin Square Scarf Women Vintage Floral Satin Like Headscarf Hair Bandana Neck Wrap
$1.38
No MOQ
Women Paisley Print Square Scarf Satin-like Satin Bandana Retro Headscarf Neck Scarf Hair Accessory
Women Paisley Print Square Scarf Satin-like Satin Bandana Retro Headscarf Neck Scarf Hair Accessory
like
Find Similar
70cm wine red Paisley square silk scarf with floral prints on a white table display - 70cmx70cm / Burgundy
70cm square silk scarf with classic black and white paisley print on round table - 70cmx70cm / Black
Champagne paisley satin silk square scarf 70cm displayed on a white table with a mirror - 70cmx70cm / Milk Tea
70cm orange paisley print satin square scarf with elegant silk texture and patterns - 70cmx70cm / Orange
Women Paisley Print Square Scarf Satin-like Satin Bandana Retro Headscarf Neck Scarf Hair Accessory
$1.38
No MOQ
Elegant Floral Print Square Scarf Satin Satin Feeling Headscarf Vintage French Style Hair Wrap For Women
Elegant Floral Print Square Scarf Satin Satin Feeling Headscarf Vintage French Style Hair Wrap For Women
like
Find Similar
Vintage green silk-feel square scarf with floral print worn as a French style headscarf - 90x90cm / Olive Green
French vintage floral silk headscarf in vibrant orange and black silk finish - 90x90cm / Gold
Floral satin silk scarf with vintage green and orange border tied on long dark hair - 90x90cm / Emerald
Vintage silk scarf with orange and black floral patterns styled as a French headwrap - 90x90cm / Orange Red
Elegant Floral Print Square Scarf Satin Satin Feeling Headscarf Vintage French Style Hair Wrap For Women
$1.44
No MOQ
Vintage Chain Print Square Scarf Faux Satin Neckerchief For Women Retro Equestrian Style Headscarf Satin Hair Bandana
Vintage Chain Print Square Scarf Faux Satin Neckerchief For Women Retro Equestrian Style Headscarf Satin Hair Bandana
like
Find Similar
Classic chain print satin square scarf in navy and red, versatile silk-like accessory - Navy Blue Chain
70cm vintage chain print square scarf in bright orange and ivory silk-like texture - Orange Chain
Square silk scarf featuring artistic oil painting tree print and navy blue border - Jenny J. Tree
Elegant 70cm silk scarf with green border and vintage golden chain print patterns - Jewelry Chain
Vintage Chain Print Square Scarf Faux Satin Neckerchief For Women Retro Equestrian Style Headscarf Satin Hair Bandana
$1.38
No MOQ
Square Scarf Satiny Satin Twill Camellia Floral Print Large Headscarf Retro Fashion For Women Elegant Office Casual
Square Scarf Satiny Satin Twill Camellia Floral Print Large Headscarf Retro Fashion For Women Elegant Office Casual
like
Find Similar
Navy and orange floral twill satin square scarf styled with a white dress and brown handbag - Camellia - Blue
Elegant 90cm twill satin square scarf featuring vintage red floral camellia patterns - Camellia-Milk Tea Color
Elegant silk twill square scarf with floral print on hanger for spring and autumn style - Camellia-Camel
Elegant 90cm satin square scarf with vintage camellia floral prints and navy borders - Camellia-Navy Blue
Square Scarf Satiny Satin Twill Camellia Floral Print Large Headscarf Retro Fashion For Women Elegant Office Casual
$2.07
No MOQ
Floral Print Square Scarf Twill Satin Elegant Retro Headscarf Shawl Neckerchief For Women
Floral Print Square Scarf Twill Satin Elegant Retro Headscarf Shawl Neckerchief For Women
like
Find Similar
Elegant 90cm emerald green floral twill scarf styled with a white dress and leather bag - 90x90cm (Twill Anti-slip Headwrap) / Rose Flower - Green
Elegant 90cm navy and ivory twill square scarf with abstract rose floral patterns - 90x90cm (Twill Anti-slip Headwrap) / Rose-Navy Blue
Elegant 90cm black and white square silk scarf with rose floral and checkered patterns - 90x90cm (Twill Anti-slip Headwrap) / Rose-Black
Elegant 90cm square silk scarf with brown and white abstract rose floral patterns - 90x90cm (Twill Anti-slip Headwrap) / Rose-Khaki
Floral Print Square Scarf Twill Satin Elegant Retro Headscarf Shawl Neckerchief For Women
$2.07
No MOQ
Satin Polyester Square Scarf Cherry Paisley Print Headscarf Neck Wrap Fashion Accessory For Women Lightweight
Satin Polyester Square Scarf Cherry Paisley Print Headscarf Neck Wrap Fashion Accessory For Women Lightweight
like
Find Similar
Pink satin square scarf with purple paisley and cherry print displayed on a minimal stand - 90*90cm / Light Purple
Pink satin square scarf featuring cherry and paisley prints hanging on a black metal frame - 90*90cm / Pink
Elegant 90cm satin square scarf with blue paisley print and red cherry pattern on white base - 90*90cm / Light Blue
Elegant 90cm satin square scarf with cherry and paisley print on a creamy white base - 90*90cm / Snow Bud
Satin Polyester Square Scarf Cherry Paisley Print Headscarf Neck Wrap Fashion Accessory For Women Lightweight
$1.25
Mix MOQ : 2
Elegant Square Scarf Zebra Animal Print Imitation Satin Satin Handkerchief Retro Headscarf For Women Color Block
Elegant Square Scarf Zebra Animal Print Imitation Satin Satin Handkerchief Retro Headscarf For Women Color Block
like
Find Similar
Elegant 70x70cm silk scarf with green zebra and tropical print for women's fashion - Standard Large Square Scarf / Dark Green Zebra Jungle Style (FJ732-1)
Silk scarf with zebra pattern and orange blocks in a gift tray with fashion accessories - Standard Large Square Scarf / Vibrant Orange Zebra Plant Style (FJ732-2)
70x70cm satin silk square scarf featuring elegant zebra and jungle horse illustration - Standard Large Square Scarf / Navy Blue Zebra Forest Style (FJ732-3)
Detail of silk scarf with zebra print and botanical patterns on a display tray - Standard Large Square Scarf / Mocha Zebra Foliage Style (FJ732-4)
Elegant Square Scarf Zebra Animal Print Imitation Satin Satin Handkerchief Retro Headscarf For Women Color Block
-4%
$1.37
Mix MOQ : 2
Vintage Floral Square Scarf Faux Satin Satin Neck Headscarf Elegant Print Summer Accessory For Women
Vintage Floral Square Scarf Faux Satin Satin Neck Headscarf Elegant Print Summer Accessory For Women
like
Find Similar
Vintage floral silk square scarf with yellow and grey patterns on a luxury handbag - 70*70cm / Yellow
Detailed view of square silk scarf with vintage floral ink pattern on black tray - 70*70cm / White
Close-up of vintage floral print silk scarf in orange and navy with intricate patterns - 70*70cm / Orange
Detail of floral pattern scarf showing the smooth silky texture and navy botanical print - 70*70cm / Blue
Vintage Floral Square Scarf Faux Satin Satin Neck Headscarf Elegant Print Summer Accessory For Women
-4%
$1.37
Mix MOQ : 2
Elegant Square Scarf Faux Satin Geometric Chain Print Retro Herringbone Pattern Headscarf Versatile Shawl Wrap For Women
Elegant Square Scarf Faux Satin Geometric Chain Print Retro Herringbone Pattern Headscarf Versatile Shawl Wrap For Women
like
Find Similar
Elegant silk-like scarf with blue geometric chain patterns displayed on a hanger - Herringbone Chain Texture / Lake Blue (FU7-1)
Elegant red and beige square silk scarf with geometric H patterns on a wooden hanger - Herringbone Chain Texture / Red (FU7-2)
Elegant silk-like square scarf with geometric chain print and green border on a white dress - Herringbone Chain Texture / Green (FU7-3)
Elegant white silk scarf with black chain pattern draped on a white dress and hanger - Herringbone Chain Texture / Black (FU7-4)
Elegant Square Scarf Faux Satin Geometric Chain Print Retro Herringbone Pattern Headscarf Versatile Shawl Wrap For Women
-4%
$2.68
Mix MOQ : 2
Women Square Scarf Satin Like Polyester Vintage Floral Print Camellia Shawl Headscarf Elegant Fashion Lightweight
Women Square Scarf Satin Like Polyester Vintage Floral Print Camellia Shawl Headscarf Elegant Fashion Lightweight
like
Find Similar
Close-up of sage green silk-feel scarf with white floral print and geometric border - Army Green
Detail view of retro rust-red square silk scarf with elegant floral prints and fine draping - Red
Detail of silk-like square scarf with white camellia print and soft glossy drape finish - Gray
Detail of silk satin square scarf featuring vintage black and white camellia floral prints - Black
Women Square Scarf Satin Like Polyester Vintage Floral Print Camellia Shawl Headscarf Elegant Fashion Lightweight
$1.99
Mix MOQ : 2
Retro Paisley Print Square Scarf Elegant Satin Like Polyester Neckerchief Vintage Bohemian Headscarf For Women
Retro Paisley Print Square Scarf Elegant Satin Like Polyester Neckerchief Vintage Bohemian Headscarf For Women
like
Find Similar
Detail of vintage paisley pattern on silky scarf styled on a blue tank top and wooden hanger - 68*68cm / Dark Brown
Detail of elegant black and white herringbone silk scarf tied on a navy knit vest - 68*68cm / Black
Detail shot of elegant paisley pattern silk-feel scarf draped on a wooden hanger - 68*68cm / Beige
Detail of elegant paisley patterned scarf draped on a wooden hanger over black clothing - 68*68cm / Red
NewRetro Paisley Print Square Scarf Elegant Satin Like Polyester Neckerchief Vintage Bohemian Headscarf For Women
$1.70
Mix MOQ : 2
Retro Floral Print Square Scarf Elegant Satin Like Polyester Shawl For Women Large Headscarf Neck Wrap
Retro Floral Print Square Scarf Elegant Satin Like Polyester Shawl For Women Large Headscarf Neck Wrap
like
Find Similar
Detailed drape of a faux silk floral scarf with wine red blocks and iris patterns - Wine Red (FN268-1)
Close-up of olive green square silk scarf featuring white floral iris print patterns - Army Green (FN268-2)
Detail of silk-like satin square scarf with yellow floral print and draped texture - Yellow (FN268-3)
Elegant silk-feel square scarf with vintage iris floral print in black and white - Black (FN268-4)
Retro Floral Print Square Scarf Elegant Satin Like Polyester Shawl For Women Large Headscarf Neck Wrap
-5%
$1.89
Mix MOQ : 2
Equestrian Print Square Scarf Women Elegant Imitation Satin Retro Court Style Headscarf Neck Wrap Satin Fashion Accessory
Equestrian Print Square Scarf Women Elegant Imitation Satin Retro Court Style Headscarf Neck Wrap Satin Fashion Accessory
like
Find Similar
Detailed pattern of a European palace style silk scarf with horse and medal prints - White (FG293-1)
Navy style silk scarf with crown and anchor prints draped over a black knit top - Warm Orange (FG293-2)
Close-up of nautical silk scarf with anchor and crown patterns draped on a rack - Pink (FG293-3)
European vintage royal print silk scarf with chain and crown motifs in blue and orange - Royal Blue Edge (FG293-4)
Equestrian Print Square Scarf Women Elegant Imitation Satin Retro Court Style Headscarf Neck Wrap Satin Fashion Accessory
-4%
$1.37
Mix MOQ : 2
Square Scarf Polyester Satin Floral Leaf Print Elegant Neck Wrap Hair Band Fashion Headscarf For Women Accessories
Square Scarf Polyester Satin Floral Leaf Print Elegant Neck Wrap Hair Band Fashion Headscarf For Women Accessories
like
Find Similar
Elegant floral silk square scarf in red and white hanging on a wooden hanger - 66-70cm / Red
Elegant silk scarf with green leaf print displayed on metal rack for premium fashion look - 66-70cm / Green
Elegant silk-like square scarf with grey leaf pattern and dark blue border on a hanger - 66-70cm / Black
Detail of soft pink and yellow floral silk scarf draped elegantly with a pearl handbag - 66-70cm / Yellow
Square Scarf Polyester Satin Floral Leaf Print Elegant Neck Wrap Hair Band Fashion Headscarf For Women Accessories
-4%
$1.37
Mix MOQ : 2
Satin Square Scarf Geometric Stripe Printed Satiny Neck Bandana For Women Elegant Headscarf Fashion Hair Wrap Handbag Accessory
Satin Square Scarf Geometric Stripe Printed Satiny Neck Bandana For Women Elegant Headscarf Fashion Hair Wrap Handbag Accessory
like
Find Similar
Geometric striped silk-like square scarf in purple and yellow hung near a pearl handbag - Lavender
Elegant geometric striped silk scarf for women in pink and blue satin finish - Light Pink
Close-up of geometric striped silk scarf with yellow and grey satin finish texture - Yellow
Modern geometric green and grey striped silk scarf displayed on a wooden hanger - Green
NewSatin Square Scarf Geometric Stripe Printed Satiny Neck Bandana For Women Elegant Headscarf Fashion Hair Wrap Handbag Accessory
-4%
$1.37
Mix MOQ : 2
Vintage Plaid Print Square Scarf Satin Polyester Satin Like Elegant Headscarf Shawl For Women Neck Hair Tie Accessories
Vintage Plaid Print Square Scarf Satin Polyester Satin Like Elegant Headscarf Shawl For Women Neck Hair Tie Accessories
like
Find Similar
Elegant vintage plaid silk scarf in yellow and brown displayed on a wooden hanger - 66-70cm / Yellow Brown
Detail of silk square scarf with vintage orange plaid pattern draped on a metal rack - 66-70cm / Brown
Vintage plaid print faux silk square scarf elegantly hanging on a wooden hanger - 66-70cm / Black Grey
Vintage red plaid silk scarf for women styled on a hanger with a stylish handbag - 66-70cm / Red
Vintage Plaid Print Square Scarf Satin Polyester Satin Like Elegant Headscarf Shawl For Women Neck Hair Tie Accessories
-4%
$1.37
Mix MOQ : 2
Zebra Print Square Scarf Polyester Imitation Satin Geometric Polka Dot Bandana Headscarf Women Elegant Versatile Neck Scarf
Zebra Print Square Scarf Polyester Imitation Satin Geometric Polka Dot Bandana Headscarf Women Elegant Versatile Neck Scarf
like
Find Similar
Close-up of black and white zebra pattern silk scarf styled on a navy blue top - 66-70CM / Black and Gray
Detail of zebra and leopard print silk scarf elegantly draped on a metal hanging rack - 66-70CM / Brown
Pink silk-like scarf with zebra patterns and red tie-dye accents on a clothing hanger - 66-70CM / Pink
Close-up of zebra pattern silk scarf with blue geometric edges hanging on metal stand - 66-70CM / Blue
Zebra Print Square Scarf Polyester Imitation Satin Geometric Polka Dot Bandana Headscarf Women Elegant Versatile Neck Scarf
-4%
$1.37
Mix MOQ : 2
Elegant Geometric Handbag Print Satin Square Scarf For Women Fashion Neckerchief Luxury Professional Office Silk Like Headscarf Accessory
Elegant Geometric Handbag Print Satin Square Scarf For Women Fashion Neckerchief Luxury Professional Office Silk Like Headscarf Accessory
like
Find Similar
Square silk scarf with belt buckle geometric print in yellow, pink and light blue - Orange Border
Navy blue faux silk scarf featuring vintage geometric belt patterns and colorful checks - Blue Edge
Elegant geometric belt pattern silk scarf in brown and beige tones for women - Natural With Black Edge
Elegant Geometric Handbag Print Satin Square Scarf For Women Fashion Neckerchief Luxury Professional Office Silk Like Headscarf Accessory
$1.59
No MOQ
Vintage Equestrian Carriage Chain Print Satin Square Scarf For Women French Elegant Silk Like Neck Scarf Fashion Headscarf Wrap Shawl
Vintage Equestrian Carriage Chain Print Satin Square Scarf For Women French Elegant Silk Like Neck Scarf Fashion Headscarf Wrap Shawl
like
Find Similar
Classic red silk scarf with golden chain and belt buckle patterns in a flat lay view - 90cm*90cm / Red
90cm large square silk scarf with golden chain patterns and elegant horse bit motifs - 90cm*90cm / Yellow
Detailed view of square silk scarf with navy blue equestrian belt and chain pattern - 90cm*90cm / Navy Blue
Coral pink silk square scarf featuring elegant gold chains and equestrian harness patterns - 90cm*90cm / Pink
+1
Vintage Equestrian Carriage Chain Print Satin Square Scarf For Women French Elegant Silk Like Neck Scarf Fashion Headscarf Wrap Shawl
$1.87
No MOQ
Elegant Floral Bird Print Square Scarf Women Polyester Satin Fashion Shawl Headscarf Lightweight Wrap Accessory For Office
Elegant Floral Bird Print Square Scarf Women Polyester Satin Fashion Shawl Headscarf Lightweight Wrap Accessory For Office
like
Find Similar
Elegant 90cm red silk scarf with white floral and bird patterns on a white shirt - 90x90cm / Red
Elegant khaki silk scarf with black botanical print and contrast border detailing - 90x90cm / Khaki
Elegant 90cm black and white floral silk scarf styled on a white chiffon shirt - 90x90cm / Black
Elegant 90cm blue and white floral silk scarf styled with a white shirt on a chair - 90x90cm / Dark Blue
+1
Elegant Floral Bird Print Square Scarf Women Polyester Satin Fashion Shawl Headscarf Lightweight Wrap Accessory For Office
$2.45
No MOQ
Large Square Scarf Women Oil Painting Print Satin Polyester Headscarf Shawl Fashion Neck Scarf Wrap Elegant Accessory
Large Square Scarf Women Oil Painting Print Satin Polyester Headscarf Shawl Fashion Neck Scarf Wrap Elegant Accessory
like
Find Similar
Artistic oil painting silk scarf 90cm large satin square wrap worn as a headscarf - Model Style (Yellow-Green Oil Painting)
Abstract oil painting style 90cm satin square silk scarf with blue border and orange print - Blue
Artistic oil painting silk satin square scarf with bright yellow and golden patterns - Gold
Macro detail of high-quality satin scarf with abstract oil painting print and fine stitching - Pink
Large Square Scarf Women Oil Painting Print Satin Polyester Headscarf Shawl Fashion Neck Scarf Wrap Elegant Accessory
$1.40
Mix MOQ : 2
Women Large Square Scarf Satin Satin Like Floral Rose Print Elegant Headscarf Shawl Fashion Wrap
Women Large Square Scarf Satin Satin Like Floral Rose Print Elegant Headscarf Shawl Fashion Wrap
like
Find Similar
Detail of red rose floral print on satin silk square scarf with glossy smooth texture - Red Black White Rose (1#Recommended)
90cm rose print satin silk square scarf with blue and pink floral pattern for women - Navy Blue Pink Rose (2#Navy)
90cm square satin silk scarf featuring vibrant red rose floral print on green background - Green Red Rose (3#Green)
90cm satin square silk scarf with large rose floral print and orange borders - Coffee Orange Rose (4#Coffee)
Women Large Square Scarf Satin Satin Like Floral Rose Print Elegant Headscarf Shawl Fashion Wrap
$1.44
Mix MOQ : 2
Square Scarf Faux Satin Geometric Print Neckerchief For Women Neck Bag Decor Elegant Lightweight Headscarf
Square Scarf Faux Satin Geometric Print Neckerchief For Women Neck Bag Decor Elegant Lightweight Headscarf
like
Find Similar
Elegant 70cm black and white geometric silk scarf for women with a classic bordered design - Black and White Geometric (1# Recommended Color)
70cm geometric silk scarf in grey-green and pink with retro pattern in elegant gift setting - Grey Green Pink Geometric (2# Grey)
70cm geometric checkerboard silk square scarf with orange and yellow border design - Orange Yellow Red Geometric (3# Red)
Detail view of 70cm silk scarf with geometric square prints and smooth pink border - Pink and Grey Geometric (4# Light Pink)
Square Scarf Faux Satin Geometric Print Neckerchief For Women Neck Bag Decor Elegant Lightweight Headscarf
$1.41
Mix MOQ : 2
Leopard Zebra Floral Paisley Print Square Scarf Polyester Satin Smooth Fashion Headscarf For Women
Leopard Zebra Floral Paisley Print Square Scarf Polyester Satin Smooth Fashion Headscarf For Women
like
Find Similar
Macro shot of 70cm leopard print silk scarf showing satin texture and geometric borders - Gold Leopard Print
Detail of zebra print satin scarf with caramel border shown in multiple stylings - Striped Leopard/Zebra Print
Detail of green floral silk scarf with leopard print border on a white sweater - Green Leopard Splicing
Detail of red floral and leopard print silk scarf on beige sweater with gift box - Red Leopard Floral
Leopard Zebra Floral Paisley Print Square Scarf Polyester Satin Smooth Fashion Headscarf For Women
$1.31
Mix MOQ : 2
Triangle Scarf Vintage Geometric Mandala Print Satin-Like Polyester Bandana Headscarf Shawl French Style For Women
Triangle Scarf Vintage Geometric Mandala Print Satin-Like Polyester Bandana Headscarf Shawl French Style For Women
like
Find Similar
French vintage silk scarf with blue and orange geometric patterns hanging on denim - Blue (SJ-31)
Detail of vintage French triangle scarf draped over a wooden branch on a white backdrop - Green (SJ-31)
Detail of vintage striped silk scarf with geometric floral patterns on a wooden branch - Red (SJ-31)
Detail of vintage geometric silk scarf hanging on a wooden branch with soft lighting - Black (SJ-31)
Triangle Scarf Vintage Geometric Mandala Print Satin-Like Polyester Bandana Headscarf Shawl French Style For Women
$1.96
No MOQ
Elegant Polka Dot Print Square Scarf Polyester Satin Satin Neckerchief For Women Fashion Headscarf Bag Handle Wrap Chic
Elegant Polka Dot Print Square Scarf Polyester Satin Satin Neckerchief For Women Fashion Headscarf Bag Handle Wrap Chic
like
Find Similar
Elegant black and white polka dot square silk scarf with geometric diamond border pattern - 65*65cm / Black
Detail of navy blue silk-like square scarf with white polka dots on soft faux fur - 65*65cm / Navy Blue
Detailed view of magenta polka dot silk scarf draped on soft textured background - 65*65cm / Rose Pink
Champagne silk square scarf with gradient polka dot pattern and elegant geometric borders - 65*65cm / Apricot
Elegant Polka Dot Print Square Scarf Polyester Satin Satin Neckerchief For Women Fashion Headscarf Bag Handle Wrap Chic
$1.24
Mix MOQ : 2
Elegant Square Scarf Satin-Like Satin Polyester Geometric Floral Pattern Headscarf For Women Neck Scarf Hair Wrap
Elegant Square Scarf Satin-Like Satin Polyester Geometric Floral Pattern Headscarf For Women Neck Scarf Hair Wrap
like
Find Similar
Elegant silk square scarf with black and white geometric patterns on a soft white rug - Black
Detailed view of square silk scarf with yellow geometric patterns and pink border on plush rug - Yellow
Detailed view of green and yellow silk square scarf with geometric circular patterns - Yellow-Green
Elegant red and pink silk square scarf with geometric rings on soft white plush background - Rose
Elegant Square Scarf Satin-Like Satin Polyester Geometric Floral Pattern Headscarf For Women Neck Scarf Hair Wrap
$1.24
Mix MOQ : 2
Elegant Square Scarf Imitation Satin Paisley Floral Print Retro Headscarf Neck Scarf For Women Office Lady Accessory
Elegant Square Scarf Imitation Satin Paisley Floral Print Retro Headscarf Neck Scarf For Women Office Lady Accessory
like
Find Similar
Vintage paisley silk-feel square scarf with floral pattern on leather background - White
Detail of vintage paisley pattern on a large silk-like square scarf for women - Coffee
Detailed texture of black paisley silk scarf with vibrant floral and mandala patterns - Black
Detailed close-up of emerald green paisley silk scarf draped on a leather surface - Green
Elegant Square Scarf Imitation Satin Paisley Floral Print Retro Headscarf Neck Scarf For Women Office Lady Accessory
$1.24
Mix MOQ : 2
Vintage Abstract Floral Print Satin Square Scarf Retro French Style Smooth Satin Like Headscarf Shawl For Women Neck Wrap
Vintage Abstract Floral Print Satin Square Scarf Retro French Style Smooth Satin Like Headscarf Shawl For Women Neck Wrap
like
Find Similar
Silk-like square scarf featuring bold red rose print on black and white background - 90*90cm / Black (XW-168-Black)
Detail of silk-like floral scarf draped on leather sofa with fashionable accessories - 90*90cm / Yellow (XW-168-Yellow)
Close-up of vintage floral silk scarf featuring elegant rose patterns and smooth texture - 90*90cm / Navy Blue (XW-168-Navy)
Close-up of floral silk scarf with green and pink abstract rose prints on leather sofa - 90*90cm / Green (XW-168-Green)
Vintage Abstract Floral Print Satin Square Scarf Retro French Style Smooth Satin Like Headscarf Shawl For Women Neck Wrap
$1.87
Mix MOQ : 2
Elegant Floral Print Square Scarf For Women Vintage Satin Smooth Large Headscarf Fashion Neck Scarf Wrap Shawl Accessory
Elegant Floral Print Square Scarf For Women Vintage Satin Smooth Large Headscarf Fashion Neck Scarf Wrap Shawl Accessory
like
Find Similar
Elegant emerald green and white silk scarf with damask rose floral pattern on hanger - 90*90cm / Green Rose
Elegant navy blue and white square scarf with houndstooth and floral satin patterns - 90*90cm / Deep Blue Rose
Elegant 90cm square silk scarf featuring brown and cream rose floral print on a hanger - 90*90cm / Deep Brown Rose
Elegant black and white 90x90 silk scarf featuring floral and geometric patterns - 90*90cm / Black Rose
Elegant Floral Print Square Scarf For Women Vintage Satin Smooth Large Headscarf Fashion Neck Scarf Wrap Shawl Accessory
$2.59
No MOQ
Vintage Lace Embroidery Triangle Scarf Hollow Floral Headscarf Elegant Decorative Bandana For Women Hair Accessory
Vintage Lace Embroidery Triangle Scarf Hollow Floral Headscarf Elegant Decorative Bandana For Women Hair Accessory
like
Find Similar
Elegant black lace floral embroidery headscarf for women with vintage scalloped edges - Black
Elegant white floral lace embroidered triangle scarf and headpiece for women - White
Elegant cream lace triangle head scarf with intricate floral embroidery for women - Beige
Detail of brown lace triangle scarf with floral embroidery tied on hair back view - Coffee
Vintage Lace Embroidery Triangle Scarf Hollow Floral Headscarf Elegant Decorative Bandana For Women Hair Accessory
-4%
$3.29
No MOQ
Free Shipping
Women Scarf Satin Polyester Lightweight Floral Daisy Print Sun Protection Shawl Travel Headscarf Elegant Thin Soft Wrap
Women Scarf Satin Polyester Lightweight Floral Daisy Print Sun Protection Shawl Travel Headscarf Elegant Thin Soft Wrap
like
Find Similar
Elegant lightweight white scarf with purple floral print and frayed edges for women - Purple (SL2509-009)
Lightweight white satin scarf with red floral daisy prints and fringed edges for women - Red (SL2509-009)
Detail of floral daisy print lightweight satin scarf with soft fringe edges and tassels - Green (SL2509-009)
Elegant floral print satin scarf for women with fringe details on a minimalist background - Khaki (SL2509-009)
Women Scarf Satin Polyester Lightweight Floral Daisy Print Sun Protection Shawl Travel Headscarf Elegant Thin Soft Wrap
$3.75
No MOQ
Paisley Print Satin Square Scarf Satin Feeling Bohemian Soft Large Wrap Headscarf Hijab For Women Fashion
Paisley Print Satin Square Scarf Satin Feeling Bohemian Soft Large Wrap Headscarf Hijab For Women Fashion
like
Find Similar
Bohemian paisley print satin silk scarf 90x90cm in vibrant yellow and navy blue colors - Yellow
Bohemian paisley silk satin square scarf with rich bronze and blue vintage print - Khaki
Detail of bohemian paisley print on soft satin fabric with elegant black and white pattern - Black
Navy and orange Paisley satin silk scarf displayed on a minimalist metal hanger - Navy Blue
Paisley Print Satin Square Scarf Satin Feeling Bohemian Soft Large Wrap Headscarf Hijab For Women Fashion
$1.25
No MOQ
Floral Print Square Scarf Satin Polyester Satiny Retro Lightweight Elegant Neck Scarf Headscarf For Women
Floral Print Square Scarf Satin Polyester Satiny Retro Lightweight Elegant Neck Scarf Headscarf For Women
like
Find Similar
Elegant 90x90cm yellow floral satin headscarf with brown border on minimalist frame - Yellow / 90x90cm
Detailed view of floral satin square scarf draped on a rack showing silky texture - Refresh Blue / 90x90cm
Floral print satin silk square scarf in black white and red with geometric flower pattern - Rose Red / 90x90cm
Floral satin silk scarf 90x90cm with daisy pattern and red border on black frame - Black Red / 90x90cm
Floral Print Square Scarf Satin Polyester Satiny Retro Lightweight Elegant Neck Scarf Headscarf For Women
$1.15
No MOQ
Vintage Horse Carriage Print Square Scarf Satin Polyester Satin Polka Dot Paisley Fashion Headscarf For Women
Vintage Horse Carriage Print Square Scarf Satin Polyester Satin Polka Dot Paisley Fashion Headscarf For Women
like
Find Similar
Detail of silk-satin square scarf featuring black and gold horse carriage patterns - Black and Gold Chariot Style
Navy blue satin square scarf with vintage carriage print and red border on metal stand - Royal Blue Red Style
Coral and blue satin square scarf with vintage horse carriage print on display frame - Grey Pink Style
90cm square satin silk scarf featuring vintage horse carriage and paisley patterns - Orange Style
Vintage Horse Carriage Print Square Scarf Satin Polyester Satin Polka Dot Paisley Fashion Headscarf For Women
$1.44
No MOQ
Retro Square Scarf Satin Polyester Polka Dot Chain Print Satin Like Headscarf Elegant Neck Scarf For Women Office Lady
Retro Square Scarf Satin Polyester Polka Dot Chain Print Satin Like Headscarf Elegant Neck Scarf For Women Office Lady
like
Find Similar
60cm black satin square scarf with white polka dots and gold chain print design - Black
Detailed view of 60cm satin square scarf with polka dots and golden chain patterns - White
60cm silk satin scarf featuring navy blue polka dots and golden chain print patterns - Navy Blue
Champagne gold satin square scarf featuring elegant polka dots and chain pattern design - Gold
Retro Square Scarf Satin Polyester Polka Dot Chain Print Satin Like Headscarf Elegant Neck Scarf For Women Office Lady
-5%
$1.04
No MOQ
Large Square Scarf Polyester Satin Letter Floral Print Hijab Headscarf Bandana Retro Elegant Wrap Accessories For Women
Large Square Scarf Polyester Satin Letter Floral Print Hijab Headscarf Bandana Retro Elegant Wrap Accessories For Women
like
Find Similar
Brown and gold silk square scarf with floral geometric prints and deep brown border - Khaki
Elegant 90x90cm twill silk scarf with geometric letter prints and black striped border - Black
Green and white floral print silk scarf with letter logo and black border detail - Dark Green
Detail of silk square scarf with orange floral pattern and letter prints on smooth fabric - Dark Brown
NewLarge Square Scarf Polyester Satin Letter Floral Print Hijab Headscarf Bandana Retro Elegant Wrap Accessories For Women
$2.25
No MOQ
Floral Print Satin Square Scarf Large Faux Satin Headscarf Soft Hijab For Women Leisure Fashion
Floral Print Satin Square Scarf Large Faux Satin Headscarf Soft Hijab For Women Leisure Fashion
like
Find Similar
Luxurious 90cm floral satin silk scarf for women featuring black and gold border accents - 90*90cm / Black Gold
Green and white floral satin square scarf with orchid print and black border edges - 90*90cm / Green
Blue floral silk scarf square wrap with large white flowers elegantly draped on a black stand - 90*90cm / Lake Blue
Elegant 90cm purple silk-like square scarf with white floral print on a minimalist display - 90*90cm / Purple
Floral Print Satin Square Scarf Large Faux Satin Headscarf Soft Hijab For Women Leisure Fashion
$1.44
No MOQ
Vintage Paisley Print Square Scarf Satin Satin-Like Patchwork Bandana Headscarf Neck Wrap Fashionable Accessory For Women
Vintage Paisley Print Square Scarf Satin Satin-Like Patchwork Bandana Headscarf Neck Wrap Fashionable Accessory For Women
like
Find Similar
Vintage paisley print silk scarf in red and gold displayed on a minimalist metal stand - 90*90cm / Spliced Paisley Navy
90cm vintage paisley pattern satin silk scarf in gold and gray on a minimalist stand - 90*90cm / Spliced Paisley-Yellow
90cm vintage paisley print silk satin square scarf with orange and pink geometric borders - 90*90cm / Spliced Paisley-Orange
Retro paisley print square silk scarf for women in sky blue and orange 90cm large wrap - 90*90cm / Spliced Paisley-Pink Blue
Vintage Paisley Print Square Scarf Satin Satin-Like Patchwork Bandana Headscarf Neck Wrap Fashionable Accessory For Women
$1.44
Mix MOQ : 5
Baroque Floral Print Square Scarf Satin Polyester Satin Like Retro Headscarf Large Elegant Hair Scarf Wrap For Women
Baroque Floral Print Square Scarf Satin Polyester Satin Like Retro Headscarf Large Elegant Hair Scarf Wrap For Women
like
Find Similar
90cm black and gold vintage baroque silk satin square hair scarf with floral patterns - Black and Gold (best color)
Orange baroque satin silk head scarf with vintage gold scroll patterns and 90cm square shape - Orange
Sky blue and gold baroque pattern 90cm satin silk square hair scarf for women - Light Blue
Detailed top view of 90cm square satin scarf featuring golden Baroque pattern on white background - Green
NewBaroque Floral Print Square Scarf Satin Polyester Satin Like Retro Headscarf Large Elegant Hair Scarf Wrap For Women
$1.59
No MOQ
Women Square Scarf Retro Paisley Floral Print Satin Satin Like Headscarf Fashion Neck Wrap Accessory
Women Square Scarf Retro Paisley Floral Print Satin Satin Like Headscarf Fashion Neck Wrap Accessory
like
Find Similar
Classic 90cm paisley and plaid silk scarf with elegant drape on a minimalist black frame - Navy Blue
Retro paisley print 90cm silk scarf with vibrant colors and elegant satin sheen finish - Orange
90cm vintage paisley floral silk scarf for women in deep red and navy blue finish - Rose Red
Royal blue and orange paisley print silk scarf in a premium 90cm square design - Blue
Women Square Scarf Retro Paisley Floral Print Satin Satin Like Headscarf Fashion Neck Wrap Accessory
$1.44
Mix MOQ : 5
Elegant Floral Print Square Scarf Satin Polyester Neckerchief Retro Horsebit Chain Decorative Headscarf For Women
Elegant Floral Print Square Scarf Satin Polyester Neckerchief Retro Horsebit Chain Decorative Headscarf For Women
like
Find Similar
Pink and purple floral silk scarf tied elegantly on a white handbag handle with gold accents - 70*70cm / Pink
Elegant floral silk scarf with red borders and golden horsebit patterns in bow display - 70*70cm / Beige Red Edge
Elegant light blue silk square scarf with floral pattern and golden horseshoe design - 70*70cm / Light Blue Grey Border
Elegant beige silk-feel scarf with floral patterns and gold accents on white shirt - 70*70cm / Coffee Edge
Elegant Floral Print Square Scarf Satin Polyester Neckerchief Retro Horsebit Chain Decorative Headscarf For Women
$0.72
Mix MOQ : 2
Square Paisley Scarf Women Retro Faux Satin Headscarf Elegant Fashion Neck Wrap For Daily Wear Lightweight Polyester Satin Kerchief
Square Paisley Scarf Women Retro Faux Satin Headscarf Elegant Fashion Neck Wrap For Daily Wear Lightweight Polyester Satin Kerchief
like
Find Similar
Morandi style black and white paisley silk scarf tied on a white silk camisole top - Beige-Black
Champagne paisley silk scarf with navy border and vintage dot pattern on white dress - Yellow Khaki
Macro detail of silk-like paisley pattern scarf with elegant black and white borders - Black and Beige Edge
Elegant Morandi paisley silk scarf in sage green on a vintage golden tray with pearls - Fresh Green
Square Paisley Scarf Women Retro Faux Satin Headscarf Elegant Fashion Neck Wrap For Daily Wear Lightweight Polyester Satin Kerchief
-4%
$1.37
Mix MOQ : 2
Large Square Scarf Magnolia Flower Print Satin Satin Feeling Two Tone Fashion Headscarf Neck Wrap For Women
Large Square Scarf Magnolia Flower Print Satin Satin Feeling Two Tone Fashion Headscarf Neck Wrap For Women
like
Find Similar
Silk-like 90cm square scarf featuring magnolia floral print in silver-grey and deep red - Jujube Red and Gray
Satin silk scarf featuring yellow and magenta gradient with magnolia floral print - Skin Red and Beige
Two-tone silk scarf with purple and cyan print featuring elegant white magnolia patterns - Purple Blue
Detail of two-tone satin scarf featuring white magnolia print and glossy silk texture - Camel and Green
Large Square Scarf Magnolia Flower Print Satin Satin Feeling Two Tone Fashion Headscarf Neck Wrap For Women
$1.38
Mix MOQ : 2
Go to

More in accessories

Explore more in headscarves

squarecolorstylehollowhandmadekerchiefdailytasselsdecoration accessoriescover
polyesterbandlonggirlsheadpartywarmsteelartificial pearls rhinestonesadjustable

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access