Everful

Wholesale heart shaped boxes

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Heart Shaped Boxes

Find the perfect pieces: party gift bags, party favors, gift wrapping supplies and more

All products in heart shaped boxes

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Happy Birthday Graduation Sealing Stickers Round Gold Foil Embossed Envelope Labels For Gift Wrap Scrapbooking DIY
Happy Birthday Graduation Sealing Stickers Round Gold Foil Embossed Envelope Labels For Gift Wrap Scrapbooking DIY
like
Find Similar
Detailed dimensions of 10.5x14.5cm Happy Birthday stickers with gold foil party elements - T7716-Birthday Theme Colorful Cartoon
Gold heart-shaped wax seal stickers for envelope sealing and DIY crafts gift wrapping decor - T7734-Gold Heart Embossed Wax Seal Style
Detail of 12 black and gold graduation stickers with various celebratory designs - T7717-Graduation Season Black Gold Style
Self-adhesive graduation party labels in black and gold with diploma and cap motifs. - T7735-Graduation Season Black White Gold Cartoon Style
+1
Happy Birthday Graduation Sealing Stickers Round Gold Foil Embossed Envelope Labels For Gift Wrap Scrapbooking DIY
-5%
$0.06-0.16
Mix MOQ : 3
 · 
104 sold recently
Christmas Cake Toppers Glitter Paper Merry Christmas Feliz Navidad Lettering Star Tree Dessert Decor Party Accessory
Christmas Cake Toppers Glitter Paper Merry Christmas Feliz Navidad Lettering Star Tree Dessert Decor Party Accessory
like
Find Similar
Golden glitter Feliz Navidad cake topper with silhouette Christmas tree for festive party decor - Gold Feliz Navidad (Christmas Tree Style) / With Glue Dots
Sparkly red Merry Christmas cake topper on festive white cake with green trees - Red Merry Christmas (Gift Box & Tree Style) / With Glue Dots
Sparkling gold glitter Feliz Navidad cake topper with stars and Christmas tree design - Gold Feliz Navidad (Five-Pointed Star Style) / With Glue Dots
Sparkling red Merry Christmas cake topper insert for holiday party cake decoration - Red Merry Christmas (Five-Pointed Star Style) / With Glue Dots
+4
Christmas Cake Toppers Glitter Paper Merry Christmas Feliz Navidad Lettering Star Tree Dessert Decor Party Accessory
-5%
$0.34-0.41
No MOQ
Christmas Wine Glass Charms Zinc Alloy Drink Markers For Holiday Party Decoration Gold Finish Festive Ornaments
Christmas Wine Glass Charms Zinc Alloy Drink Markers For Holiday Party Decoration Gold Finish Festive Ornaments
like
Find Similar
Close-up of golden Christmas wine glass charms with star, snowflake and tree pendants - Set A (Snowflake/Heart/Star/Reindeer/Clover/Tree)
Set of 6 gold metal Christmas wine glass charms with snowflake and reindeer motifs - Set B (Snowflake/Reindeer/Stocking/Star/Snowman/Tree)
Christmas Wine Glass Charms Zinc Alloy Drink Markers For Holiday Party Decoration Gold Finish Festive Ornaments
$1.59
Mix MOQ : 36
 · 
15 views
Christmas Cake Toppers Santa Claus Reindeer Christmas Tree Decorations Soft Glue PVC Party Dessert Ornaments
Christmas Cake Toppers Santa Claus Reindeer Christmas Tree Decorations Soft Glue PVC Party Dessert Ornaments
like
Find Similar
Soft PVC Santa Claus cake topper decoration with Merry Christmas text for holiday desserts - Soft Glue Santa Claus Sign
Detailed view of a 5.3cm Santa Claus cake topper holding a gingerbread man figurine - 5# Soft Glue Santa with Gingerbread
6.3cm Santa Claus soft glue cake topper with stars background for Christmas decor - 7# Soft Glue Santa with Flask
Detailed view of a 5.3cm cartoon Santa Claus cake topper with a mini Christmas tree - 6# Soft Glue Santa Hugging Tree
+13
Christmas Cake Toppers Santa Claus Reindeer Christmas Tree Decorations Soft Glue PVC Party Dessert Ornaments
$0.05-0.46
Mix MOQ : 50
Double Sided Satin Ribbon Glossy Polyester Tape For Gift Wrapping Flower Cake DIY Crafts Decoration Multi Colors
Double Sided Satin Ribbon Glossy Polyester Tape For Gift Wrapping Flower Cake DIY Crafts Decoration Multi Colors
like
Find Similar
Natural light brown twisted paper twine roll for rustic gift wrapping and DIY crafts - Paper / Kraft Paper Rope
1.5cm golden double-sided satin ribbon roll for gift wrapping and flower decoration - Webbing / Gold Glitter
Grass green and white twisted decorative paper twine rope for gift wrapping - Paper / Green and White Paper Rope
1.5cm width silver glitter grosgrain ribbon for gift boxes and flower packaging - Webbing / Silver Glitter
+30
Double Sided Satin Ribbon Glossy Polyester Tape For Gift Wrapping Flower Cake DIY Crafts Decoration Multi Colors
$0.27-3.63
No MOQ
 · 
81 sold recently
Free Shipping
Vintage Cassette Tape Embroidered Patches Colorful Music Theme Iron On Sew On Decorative Appliques For DIY Clothing
Vintage Cassette Tape Embroidered Patches Colorful Music Theme Iron On Sew On Decorative Appliques For DIY Clothing
like
Find Similar
Retro cassette embroidery patch with mountain scene on blue denim background - FINE BRAVE Mountain Cassette (E3L-B-1-8 Heat Melt)
Retro cassette embroidery patch with Rock Heart text for clothes, 4.5cm x 7cm size - ROCK-HEART Rocking Heart (E3L-B-1-10 Heat Melt)
Retro blue cassette tape embroidery patch with Good Lucky rainbow text for DIY clothing - GOOD LUCKY Style (E3L-B-2-7 Heat Melt)
Pink retro cassette hip hop embroidery patch, DIY iron-on badge for denim 7x4.5cm - HIP HOP Style (E3L-B-2-8 Heat Melt)
+4
Vintage Cassette Tape Embroidered Patches Colorful Music Theme Iron On Sew On Decorative Appliques For DIY Clothing
$0.25-2.86
No MOQ
 · 
87 sold recently
Top 10% Best Sellers
in Arts, Crafts & Sewing
Free Shipping
Chenille Letter Patches Rose Red Towel Embroidery Gold Glitter Border Alphabet Iron On For DIY Clothing Jackets Bags
Chenille Letter Patches Rose Red Towel Embroidery Gold Glitter Border Alphabet Iron On For DIY Clothing Jackets Bags
like
Find Similar
Pink chenille embroidery A-Z letter patches with gold sequins and 5.5cm height - 5.5cm Self-adhesive 26pcs Letter Set
Pink chenille heart patch with gold glitter border, measuring 5.5cm for clothing DIY - Heart
Pink chenille towel embroidered A-Z letter patches with gold glitter borders set - 8cm 26pcs Letter Set
Pink chenille embroidery letter patches A-Z with golden glitter borders for clothing - 5.5cm 27pcs Set (Incl. Heart)
+1
Chenille Letter Patches Rose Red Towel Embroidery Gold Glitter Border Alphabet Iron On For DIY Clothing Jackets Bags
$0.29-7.49
No MOQ
 · 
34 views
Free Shipping
Ceramic Teapot Chinese Style Lifting Metal Handle Tied Rope Pink Orchid Flower Pattern Tea Pot Home Office Decor With Jade Pendant
Ceramic Teapot Chinese Style Lifting Metal Handle Tied Rope Pink Orchid Flower Pattern Tea Pot Home Office Decor With Jade Pendant
like
Find Similar
Pink orchid ceramic teapot with rope handle and jade flower pendant 132ml - Simple Packaging / Beige Pink Orchid Series
Beige ceramic orchid teapot with woven rope handle and matching gift box, 132ml - Gift Box / Beige Pink Orchid Series
Ceramic Teapot Chinese Style Lifting Metal Handle Tied Rope Pink Orchid Flower Pattern Tea Pot Home Office Decor With Jade Pendant
-5%
$11.22-12.87
No MOQ
 · 
51 views
Funny Cat With Knife Embroidered Patch Tactical Badge Hook And Loop Backing Cartoon Animal Skeleton Ghost Applique Gear
Funny Cat With Knife Embroidered Patch Tactical Badge Hook And Loop Backing Cartoon Animal Skeleton Ghost Applique Gear
like
Find Similar
Funny black cat embroidery patch holding a knife with velcro backing for outdoor gear 7cm - Black Cat with Knife (V01286-1)
Detailed view of cat with knife embroidery patch showing 7cm by 6cm dimensions - Tricolor Cat with Knife (V01286-2)
Tactical black cat embroidery patch with knife and yellow eyes on white background - Sleepwalking Black Cat (V01391-1)
Close-up of cute cat holding knife embroidered patch with sharp black and white textures - Sleepwalking Black & White Cat (V01391-2)
+6
Funny Cat With Knife Embroidered Patch Tactical Badge Hook And Loop Backing Cartoon Animal Skeleton Ghost Applique Gear
$1.15-1.44
No MOQ
Free Shipping
Round Wooden Coaster Set With Storage Holder Black Walnut And Beech Wood Heat Resistant Natural Grain Table Mat For Drink
Round Wooden Coaster Set With Storage Holder Black Walnut And Beech Wood Heat Resistant Natural Grain Table Mat For Drink
like
Find Similar
6-piece set of round black walnut wood coasters with a minimalist square storage base - Black Walnut Varnish Boxed Set of 6
Japanese style black walnut wooden coaster set with round mats and a square holder - Beech Wood Varnish Boxed Set of 6
Round walnut wood coaster with waterproof surface and deep natural wood grain - Black Walnut Varnish Single Coaster
Japanese round black walnut wood coaster with waterproof water droplets surface - Beech Wood Varnish Single Coaster
+2
Round Wooden Coaster Set With Storage Holder Black Walnut And Beech Wood Heat Resistant Natural Grain Table Mat For Drink
$1.44-15.85
No MOQ
 · 
114 views
Manual Pepper Mill Wood Grinder Ceramic Core Adjustable Coarseness Spice Seasoning Shaker Kitchen Accessory
Manual Pepper Mill Wood Grinder Ceramic Core Adjustable Coarseness Spice Seasoning Shaker Kitchen Accessory
like
Find Similar
Wooden pepper mill with ceramic core and branded packaging box in natural finish - Color Box / 5 Inch / Original Oak
Classic wooden pepper mill with adjustable knob and packaging on white background - Color Box / 8 Inch / Original Oak
Dark brown oak wood manual pepper mill with metal knob and white creative packaging box - Color Box / 8 Inch / Antique Silver
Manual dark oak wood pepper mill with premium matching gift box packaging - Color Box / 5 Inch / Antique Silver
+4
Manual Pepper Mill Wood Grinder Ceramic Core Adjustable Coarseness Spice Seasoning Shaker Kitchen Accessory
-4%
$2.68-3.81
No MOQ
 · 
12 views
Chenille Letter Patches Royal Blue Gold Glitter Border Iron On Embroidery Patch For Clothes Bag Hat DIY Decoration
Chenille Letter Patches Royal Blue Gold Glitter Border Iron On Embroidery Patch For Clothes Bag Hat DIY Decoration
like
Find Similar
Daisy embroidery patch double-sided adhesive sheets CROWN #513L size 10x20cm - One Sheet Strong Adhesive 20*10CM
Detailed view of royal blue chenille letter A patch with gold glitter edge and dimensions - Letter A
Detailed size view of royal blue chenille letter R patch with gold glitter borders - Letter R
Detail of red chenille heart patch with gold sequins border measuring 5cm x 5cm - Heart
+25
Chenille Letter Patches Royal Blue Gold Glitter Border Iron On Embroidery Patch For Clothes Bag Hat DIY Decoration
$0.32-9.74
No MOQ
 · 
70 sold recently
Free Shipping
Embroidery Patches Polyester Iron On Sew On Clothing Decoration Cartoon Leaf Cherry Skull Patterns DIY Applique Apparels
Embroidery Patches Polyester Iron On Sew On Clothing Decoration Cartoon Leaf Cherry Skull Patterns DIY Applique Apparels
like
Find Similar
Golden ginkgo leaf embroidered patch 4.5x3.9cm for clothing decoration on denim - Golden Ginkgo Leaf / 4.5cmx3.9cm
Coconut tree embroidery patch with green leaves and brown trunk, size 7.1x5.3cm - Coconut Tree / 7.1cmx5.3cm
Embroidered green Christmas tree iron-on patch measuring 5.7cm by 4.8cm for clothing - Dark Green Pine Tree / 5.7cmx4.8cm
Green shamrock clover embroidered patch for clothing DIY, size 5.1cm by 5cm icon - Emerald Green Clover / 5.1cmx5cm
+3
Embroidery Patches Polyester Iron On Sew On Clothing Decoration Cartoon Leaf Cherry Skull Patterns DIY Applique Apparels
$0.10-0.25
No MOQ
 · 
22 views
Free Shipping
Glass Seasoning Jar Sealed Moisture Proof Spice Container With Handle And Spoon Kitchen Condiment Storage Wall Rack
Glass Seasoning Jar Sealed Moisture Proof Spice Container With Handle And Spoon Kitchen Condiment Storage Wall Rack
like
Find Similar
Teal green airtight glass spice jar with handle and lemon decor on wooden board - Sealed Seasoning Box-Yellow Green
Light blue glass seasoning jar with a one-handed lid and 13.5x10.5cm dimension - Sealed Seasoning Box-Light Green
Warm white glass spice jar with one-hand press lid and moisture-proof seal design - Sealed Seasoning Box-White Grey
Glass Seasoning Jar Sealed Moisture Proof Spice Container With Handle And Spoon Kitchen Condiment Storage Wall Rack
$4.76
No MOQ
 · 
26 views
Mushroom Silicone Mold Food Grade DIY Aromatherapy Candle Gypsum Ornament Casting Molds Crafting Tools
Mushroom Silicone Mold Food Grade DIY Aromatherapy Candle Gypsum Ornament Casting Molds Crafting Tools
like
Find Similar
3D mushroom silicone mold for DIY candles with purple mushroom candle sample and size specs - Flat-topped Mushroom Gl087-1
Red mushroom candle with white dots next to its silicone mold with size dimensions - Dome-shaped Mushroom Gl087-2
3D mushroom silicone mold for candles and plaster crafts with detailed size specs - Pointed Mushroom Gl087-3
Mushroom Silicone Mold Food Grade DIY Aromatherapy Candle Gypsum Ornament Casting Molds Crafting Tools
$2.31-3.46
No MOQ
 · 
47 views
Pink Christmas Embroidery Patches Cartoon Iron On Polyester Heat Melt Appliques Decorative Badges Clothing Bag Decoration
Pink Christmas Embroidery Patches Cartoon Iron On Polyester Heat Melt Appliques Decorative Badges Clothing Bag Decoration
like
Find Similar
Pink gingerbread man embroidery patch with dimensions showing 8cm height and 6.8cm width - 1# Gingerbread Man
Pink Christmas bow embroidered iron-on patch with dimensions for DIY crafts - 2# Bow
Pink Christmas reindeer embroidery patch with iron-on backing, 7.9cm decorative patch - 3# Reindeer
Pink and white swirl lollipop embroidered patch with red plaid bow for holiday gifts - 4# Lollipop
+21
Pink Christmas Embroidery Patches Cartoon Iron On Polyester Heat Melt Appliques Decorative Badges Clothing Bag Decoration
$0.23-8.92
No MOQ
 · 
32 views
Free Shipping
Silicone Cooking Utensils Wooden Handle Heat Resistant Non Stick Kitchen Tools Storage Bucket Mint Green Modern Home
Silicone Cooking Utensils Wooden Handle Heat Resistant Non Stick Kitchen Tools Storage Bucket Mint Green Modern Home
like
Find Similar
Green 11-piece silicone kitchen utensil set with wooden handles and plastic holder box - Color Box
Water green silicone spatula with ergonomic wooden handle for non-stick cookware - Slotted Spatula
Kitchen food tongs with light green silicone tips and stainless steel frame handle - Food Clip
Light green silicone balloon whisk with natural wooden handle for non-stick cookware - Whisk
+14
Silicone Cooking Utensils Wooden Handle Heat Resistant Non Stick Kitchen Tools Storage Bucket Mint Green Modern Home
$0.46-11.53
No MOQ
 · 
31 views
Stainless Steel Fruit Vegetable Peeler With Pointed Tip Serrated Blade Kitchen Tool Multi Purpose For Home
Stainless Steel Fruit Vegetable Peeler With Pointed Tip Serrated Blade Kitchen Tool Multi Purpose For Home
like
Find Similar
Stainless steel vegetable peeler measuring 16.5cm length with 20g lightweight design - Toothbrush Shaped Peeler
Stainless Steel Fruit Vegetable Peeler With Pointed Tip Serrated Blade Kitchen Tool Multi Purpose For Home
$0.14
Mix MOQ : 2
Rose Frangipani Flower Silicone Mold Multiple Cavities DIY Cake Decorating Fondant Chocolate Resin Craft Heat Resistant
Rose Frangipani Flower Silicone Mold Multiple Cavities DIY Cake Decorating Fondant Chocolate Resin Craft Heat Resistant
like
Find Similar
White silicone mold featuring three mini rose shapes for fondant, soap and resin DIY - Style 1 Rose Round / Gray
Pink 3-cavity rose silicone mold for chocolate and fondant cake decorating 4.7cm - Style 1 Rose Round / Pink
3-cavity plumeria flower silicone mold for DIY cake decor and resin craft making - Style 2 Frangipani Heart / Gray
Pink heart-shaped silicone mold with three different sizes of frangipani flower patterns - Style 2 Frangipani Heart / Pink
Rose Frangipani Flower Silicone Mold Multiple Cavities DIY Cake Decorating Fondant Chocolate Resin Craft Heat Resistant
-5%
$0.33-0.44
No MOQ
Oval Placemats PVC Woven Vinyl Heat Resistant Non-Slip Dining Table Mat Nordic Solid Color Washable Bamboo Texture
Oval Placemats PVC Woven Vinyl Heat Resistant Non-Slip Dining Table Mat Nordic Solid Color Washable Bamboo Texture
like
Find Similar
Dark grey oval bamboo weave PVC placemat measuring 45x32.5cm with heat insulation - Oval 45*32cm (approx. 70g) / Dark Gray Vertical Pattern
Blue oval PVC placemat with bamboo texture 45x32.5cm size details and woven finish - Oval 45*32cm (approx. 70g) / Blue Bamboo Texture
Oval burgundy PVC table mat with bamboo texture, heat resistant, size 45x32.5cm - Oval 45*32cm (approx. 70g) / Wine Red Bamboo Texture
Silver-grey oval PVC placemat with bamboo weave texture, dimensions 45x32.5cm - Oval 45*32cm (approx. 70g) / Silver Grey Bamboo Texture
+5
Oval Placemats PVC Woven Vinyl Heat Resistant Non-Slip Dining Table Mat Nordic Solid Color Washable Bamboo Texture
$0.96
No MOQ
Western Cowboy Embroidery Patches Iron On Sew On Decorative Fabric Applique For Clothing Jackets Backpacks Cactus Cow Skull
Western Cowboy Embroidery Patches Iron On Sew On Decorative Fabric Applique For Clothing Jackets Backpacks Cactus Cow Skull
like
Find Similar
Detailed view of western cowboy bull rider embroidery patch with size 7cm x 6cm dimensions - Cowboy Riding Bull
Detail of red cactus shield embroidered patch with dimensions 6cm by 6.5cm on white base - Red Shield Badge
Detailed dimensions of heart-shaped cow print embroidery patch for cowboy boots - Heart Cow Print
Detail view of cowboy on horse embroidery patch with precise 6cm size and 1.6g weight metrics - Cowboy Riding Horse
+18
Western Cowboy Embroidery Patches Iron On Sew On Decorative Fabric Applique For Clothing Jackets Backpacks Cactus Cow Skull
$0.23-7.78
No MOQ
 · 
825 sold recently
Top 3% Best Sellers
in Arts, Crafts & Sewing
Free Shipping
Cake Stencils PET Plastic Hollow Decorative Molds For Baking Dessert DIY Floral Geometric Patterns Border Printing
Cake Stencils PET Plastic Hollow Decorative Molds For Baking Dessert DIY Floral Geometric Patterns Border Printing
like
Find Similar
Detailed view of 39x15cm leaf pattern stencil for cake decoration and baking edge design - Leaf Texture / White
Detailed pattern template for cake decoration showing 39cm by 15cm dimensions - Abstract Geometric / White
Cake decorating stencil with wave dot pattern showing 39cm by 15cm dimensions - Dot Wave / White
Detailed 39x15cm rectangular cake stencil featuring delicate leaf patterns for decoration - Fine Leaves / White
+10
Cake Stencils PET Plastic Hollow Decorative Molds For Baking Dessert DIY Floral Geometric Patterns Border Printing
$0.72
No MOQ
 · 
14 views
Embroidered Patches Cupcake Shape Self Adhesive Polyester Fabric Decal For Clothes Bags Hats Cute DIY Decoration
Embroidered Patches Cupcake Shape Self Adhesive Polyester Fabric Decal For Clothes Bags Hats Cute DIY Decoration
like
Find Similar
Cartoon cupcake embroidered patch for DIY apparel, 6.5x5.6cm self-adhesive sticker - Blue Purple Cream Cherry
Embroidered pink cupcake patch with red cherry on denim and notebook background - Yellow Red Cherry
Cupcake embroidery patch with strawberry detail, 6.6cm height, for DIY accessories - Coffee Strawberry
Pink cupcake embroidered self-adhesive patch for DIY bags and hats, 6.8cm size - Pink Blue Rabbit Ears
+6
Embroidered Patches Cupcake Shape Self Adhesive Polyester Fabric Decal For Clothes Bags Hats Cute DIY Decoration
$0.30
No MOQ
 · 
31 views
Pink Western Cowboy Embroidered Patches Iron On Sew On Applique For Clothing Jackets Backpacks Hats Retro Cowgirl Style
Pink Western Cowboy Embroidered Patches Iron On Sew On Applique For Clothing Jackets Backpacks Hats Retro Cowgirl Style
like
Find Similar
Daisy embroidery patch double-sided adhesive sheets CROWN #513L size 10x20cm - Strong Adhesive Backing Sheet
22-piece pink western cowboy embroidery patches with cactus boots and hat designs - Set of 22 Style B
Pink western cowboy embroidery patch set with cactus boots and hats for clothing decor - Set of 23 Style C
Detailed view of pink western cowboy embroidery patches including boots and cactus - Set of 24 Style D
+25
Pink Western Cowboy Embroidered Patches Iron On Sew On Applique For Clothing Jackets Backpacks Hats Retro Cowgirl Style
$0.17-7.01
No MOQ
 · 
212 sold recently
Top 5% Best Sellers
in Arts, Crafts & Sewing
Free Shipping
Stainless Steel Cheese Grater Zester Manual Food Shredder For Chocolate Lemon Garlic Kitchen Tool With Protective Cover
Stainless Steel Cheese Grater Zester Manual Food Shredder For Chocolate Lemon Garlic Kitchen Tool With Protective Cover
like
Find Similar
Multifunctional stainless steel cheese grater with a red handle and cleaning brush - Color Box / Red
Yellow handled 18/8 stainless steel cheese grater set with cover and cleaning brush - Color Box / Yellow
Green 18/8 stainless steel cheese grater with protective cover and cleaning brush set - Color Box / Green
Multifunction 18/8 stainless steel cheese grater with black handle and protective cover set - Color Box / Black
+4
Stainless Steel Cheese Grater Zester Manual Food Shredder For Chocolate Lemon Garlic Kitchen Tool With Protective Cover
$1.87-2.19
Mix MOQ : 2
Fruit Vegetable Cutter Molds Stainless Steel Cookie Cutters With Protective Plastic Handle Multishape DIY Food Decorating Tools
Fruit Vegetable Cutter Molds Stainless Steel Cookie Cutters With Protective Plastic Handle Multishape DIY Food Decorating Tools
like
Find Similar
12-piece stainless steel cookie cutter set with red guards and shapes in clear case - PVC Box / Red
12-piece stainless steel cookie cutter set with pink hand guards in a clear storage box - PVC Box / Pink Purple
12-piece stainless steel vegetable and fruit cutters with green plastic hand guards - PVC Box / Green
12-piece stainless steel cookie cutter set with red guards and assorted shapes - PVC Box / Pink
+1
Fruit Vegetable Cutter Molds Stainless Steel Cookie Cutters With Protective Plastic Handle Multishape DIY Food Decorating Tools
$2.39
Mix MOQ : 2
 · 
11 views
Cute Quilted Cotton Makeup Bag Large Capacity Travel Toiletry Organizer Pouch Portable Zipper Bag Bear Rabbit Print For Women
Cute Quilted Cotton Makeup Bag Large Capacity Travel Toiletry Organizer Pouch Portable Zipper Bag Bear Rabbit Print For Women
like
Find Similar
Detail of pink quilted cosmetic bag with cute bear and donut pattern held by a hand - Quilted Donut Bear
Pink quilted makeup bag with cute bear and heart patterns and floral cotton design - Quilted Blue Ribbon Bear
Detail view of pink quilted rabbit makeup bag with heart patterns held by a person - Quilted Heart Baby Bear
Pink quilted cosmetic bag with cute rabbit pattern and top zipper for travel storage - Quilted Pink Long-eared Bunny
Cute Quilted Cotton Makeup Bag Large Capacity Travel Toiletry Organizer Pouch Portable Zipper Bag Bear Rabbit Print For Women
$2.28
No MOQ
Chinese Wedding Cake Decoration Red Double Happiness Topper Cupcake Liner Silicone Mold Artificial Flower For Celebration
Chinese Wedding Cake Decoration Red Double Happiness Topper Cupcake Liner Silicone Mold Artificial Flower For Celebration
like
Find Similar
Set of 50 white greaseproof paper baking cups, 7x5x4cm size for cupcakes and muffins - Greaseproof Paper Cups / White
Pack of 50 natural brown greaseproof muffin paper cups with pleated edges, 7cm diameter - Greaseproof Paper Cups / Natural
50-pack of brown greaseproof paper muffin cups measuring 7x5x4cm with vertical ridges - Greaseproof Paper Cups / Brown
50-pack red greaseproof paper muffin cups with wavy edges for high-heat baking - Greaseproof Paper Cups / Red
+72
Chinese Wedding Cake Decoration Red Double Happiness Topper Cupcake Liner Silicone Mold Artificial Flower For Celebration
$0.26-13.95
Mix MOQ : 3
 · 
27 views
Free Shipping
St Patricks Day Embroidery Patches Irish Shamrock Leprechaun Rainbow Lucky Gold Pot Decorative Applique For Clothes Bags
St Patricks Day Embroidery Patches Irish Shamrock Leprechaun Rainbow Lucky Gold Pot Decorative Applique For Clothes Bags
like
Find Similar
Daisy embroidery patch double-sided adhesive sheets CROWN #513L size 10x20cm - Strong Adhesive Sheet
Saint Patrick's Day clover and leprechaun embroidery patches collection on white background - Mixed Style Set
Detailed embroidery patch with rainbow and clover patterns showing dimensions 5.8 x 6.3cm - No.1/Rainbow Shamrock
Embroidered beer mug patch for St. Patrick's Day clothing decoration, size 5.8x5.7 cm - Beer Mug (2号)
+26
St Patricks Day Embroidery Patches Irish Shamrock Leprechaun Rainbow Lucky Gold Pot Decorative Applique For Clothes Bags
$0.17-8.11
No MOQ
 · 
14 views
Free Shipping
Retro Groovy Embroidered Patches Iron On Cloth Stickers Bohemian Flower Butterfly For DIY Clothing Backpack Decoration
Retro Groovy Embroidered Patches Iron On Cloth Stickers Bohemian Flower Butterfly For DIY Clothing Backpack Decoration
like
Find Similar
Daisy embroidery patch double-sided adhesive sheets CROWN #513L size 10x20cm - Strong Adhesive Backing Sheet (20*10CM)
Detailed view of 16-piece retro hippie embroidered patches with vivid thread texture - 16-Piece Set (W3HD-179-YT)
Set of colorful embroidered patches including cactus and flowers for DIY clothing - 19-Piece Set (W3HD-193-YT)
Detailed macro view of 6.4cm round sun flower embroidered iron-on patch for clothes - Round Abstract Flower (W3HD-125-01)
+15
Retro Groovy Embroidered Patches Iron On Cloth Stickers Bohemian Flower Butterfly For DIY Clothing Backpack Decoration
$0.19-5.56
No MOQ
 · 
64 sold recently
Free Shipping
Silicone Kitchen Utensil Cooking Tools With Beech Wood Handle Heat Resistant Non Stick Spatula Soup Spoon Whisk Tongs
Silicone Kitchen Utensil Cooking Tools With Beech Wood Handle Heat Resistant Non Stick Spatula Soup Spoon Whisk Tongs
like
Find Similar
Creamy white silicone turner with wooden handle for non-stick pans kitchen tool - Spatula
Cream silicone slotted spoon with natural wooden handle kitchen utensil for non-stick pans - Skimmer
Creamy white silicone cooking spoon with natural wooden handle on white background - Solid Spoon
Cream white silicone slotted spoon with natural wood handle for non-stick cookware - Slotted Spoon
+10
Silicone Kitchen Utensil Cooking Tools With Beech Wood Handle Heat Resistant Non Stick Spatula Soup Spoon Whisk Tongs
-5%
$0.49-14.10
Mix MOQ : 2
 · 
10 views
Double Sided Traceless Transparent Nano Adhesive Tape Dots Removable Strong Sticky For Home Decoration And Festive Couplets
Double Sided Traceless Transparent Nano Adhesive Tape Dots Removable Strong Sticky For Home Decoration And Festive Couplets
like
Find Similar
1 option
Double Sided Traceless Transparent Nano Adhesive Tape Dots Removable Strong Sticky For Home Decoration And Festive Couplets
$0.01
Mix MOQ : 4
 · 
54 sold recently
Angel Cherub Wings Silicone Mold DIY Handmade Chocolate Fondant Cake Decorating Soap Aroma Stone Resin Craft
Angel Cherub Wings Silicone Mold DIY Handmade Chocolate Fondant Cake Decorating Soap Aroma Stone Resin Craft
like
Find Similar
Silicone angel molds for car aromatherapy gypsum and resin crafts with multiple poses - 2# Round / Pink
3-cavity little angel silicone mold for scented plaster, resin, and candle crafts - Style 1-Heart / Gray
Pink heart-shaped silicone mold for creating three mini angel statues in different poses - Style 1-Heart / Pink
Cute angel silicone mold for fondant cake, chocolate and DIY clay crafts, 9cm diameter - 2# Round / Gray
Angel Cherub Wings Silicone Mold DIY Handmade Chocolate Fondant Cake Decorating Soap Aroma Stone Resin Craft
$0.52-1.18
No MOQ
Enamel Pin Brooch Alloy Drip Oil Music Themed Lyric Quote Style Badge Jewelry Accessory Fashion Decorative Pins For Backpack Jacket
Enamel Pin Brooch Alloy Drip Oil Music Themed Lyric Quote Style Badge Jewelry Accessory Fashion Decorative Pins For Backpack Jacket
like
Find Similar
Purple enamel metal brooch featuring 'i was enchanted to meet you' text and golden hearts - Purple Heart-Enchanted Lyrics
Blue enamel pin featuring Would've could've should've text in a wavy border design - Blue Wave-Should've Lyrics
Enamel Pin Brooch Alloy Drip Oil Music Themed Lyric Quote Style Badge Jewelry Accessory Fashion Decorative Pins For Backpack Jacket
-9%
$0.50
No MOQ
 · 
10 views
Free Shipping
Silicone Molds For DIY Miniature Food Cartoon Bear Pig Bread Shapes For Chocolate Fondant Baking
Silicone Molds For DIY Miniature Food Cartoon Bear Pig Bread Shapes For Chocolate Fondant Baking
like
Find Similar
Mini bear silicone food mold for DIY baking and chocolate making with finished product size - 9178-Mini Bear Toast
Food-grade silicone mini bear chocolate mold for baking and clay with size specifications - 9180-Mini Bear Cheese Toast
Detailed food-grade silicone mold for making cute mini cartoon pig resin crafts - 9183-Pig Baguette Bread
Macro detail of a 4-cavity bread silicone mold with yellow resin miniature loaves - 9185-Cat Butter Waffle Pancake
+22
Silicone Molds For DIY Miniature Food Cartoon Bear Pig Bread Shapes For Chocolate Fondant Baking
$0.29-0.84
Mix MOQ : 2
 · 
26 views
French Retro Camellia Cat Ceramic Teapot Cup And Saucer Afternoon Tea Coffee Floral Pattern Elegant Gift
French Retro Camellia Cat Ceramic Teapot Cup And Saucer Afternoon Tea Coffee Floral Pattern Elegant Gift
like
Find Similar
French vintage camellia ceramic cup and saucer set with elegant floral patterns - Camellia Cup & Saucer Set
French retro camellia ceramic tea set with cat patterns in a premium gift box - Teaware Gift Box Set (1 Pot 2 Cups 2 Saucers 2 Spoons)
French Retro Camellia Cat Ceramic Teapot Cup And Saucer Afternoon Tea Coffee Floral Pattern Elegant Gift
$5.04-27.38
Mix MOQ : 9
 · 
132 views
Transparent Toothpick Holder Cotton Swab Storage Jar Crystal Handle Minimalist Dustproof Container For Home Vanity Decor
Transparent Toothpick Holder Cotton Swab Storage Jar Crystal Handle Minimalist Dustproof Container For Home Vanity Decor
like
Find Similar
Luxe acrylic cotton swab holder with crystal lid handle and creamy white inner cylinder - Cotton Swab Box / White
Transparent acrylic cotton swab container with black insert and crystal lid knob, size 11.3cm - Cotton Swab Box / Black
Transparent Toothpick Holder Cotton Swab Storage Jar Crystal Handle Minimalist Dustproof Container For Home Vanity Decor
$0.95
No MOQ
 · 
10 sold recently
Polyester Printed Ribbons Colorful Gift Wrapping Decorative For Birthday Childrens Day Party DIY Crafting
Polyester Printed Ribbons Colorful Gift Wrapping Decorative For Birthday Childrens Day Party DIY Crafting
like
Find Similar
Rainbow heart printed ribbon roll on white background for gift wrapping and DIY crafts - Heart / 2.5cm
Roll of polyester ribbon with Just For You print and balloons for gift wrapping - Just For You / 2.5cm
White polyester Happy Birthday ribbon roll with colorful prints for gift box wrapping - Happy Birthday Bold / 1.5cm
Polka dot pattern polyester ribbon roll for gift wrapping and birthday cake packaging - Polka Dot / 2.5cm
+56
Polyester Printed Ribbons Colorful Gift Wrapping Decorative For Birthday Childrens Day Party DIY Crafting
-7%
$4.19-7.54
No MOQ
 · 
11 views
DIY Silicone Mold Christmas Tree Elk Unicorn Pattern Hanging Tag For Resin Wax Scent Tablets Jewelry Making Ornaments
DIY Silicone Mold Christmas Tree Elk Unicorn Pattern Hanging Tag For Resin Wax Scent Tablets Jewelry Making Ornaments
like
Find Similar
Unicorn oval silicone mold for DIY resin and soap crafts with detailed dimensions - Oval Unicorn Tag GP#01
Santa Claus rectangular silicone mold for DIY resin ornaments, size 82x50mm - Oval Santa Claus Tag GP#02
Silicone resin mold for snowflake Christmas tag ornament featuring circular design - Round Snowflake Tag GP#03
Heart-shaped silicone mold with snow scene and house relief for DIY resin crafts - Heart Snow Scene Tag GP#04
+3
DIY Silicone Mold Christmas Tree Elk Unicorn Pattern Hanging Tag For Resin Wax Scent Tablets Jewelry Making Ornaments
$0.52
Mix MOQ : 2
 · 
11 views
Alcohol Prep Pads 75 Percent Ethyl Alcohol Disinfecting Wipes Disposable Cleaning For Screen Phone Jewelry Sterile Individually Wrapped
Alcohol Prep Pads 75 Percent Ethyl Alcohol Disinfecting Wipes Disposable Cleaning For Screen Phone Jewelry Sterile Individually Wrapped
like
Find Similar
1 option
Alcohol Prep Pads 75 Percent Ethyl Alcohol Disinfecting Wipes Disposable Cleaning For Screen Phone Jewelry Sterile Individually Wrapped
$0.04
Mix MOQ : 4
 · 
12 views
Silicone Spatulas And Scrapers With Wooden Handles Heat Resistant Non Stick For Baking Mixing Cream Cake DIY Dessert Modern
Silicone Spatulas And Scrapers With Wooden Handles Heat Resistant Non Stick For Baking Mixing Cream Cake DIY Dessert Modern
like
Find Similar
5-piece heat resistant beige silicone spatula set with ergonomic wooden handles - White 5-Piece Set
Single cream silicone spatula with wooden handle for baking and mixing cakes - White Large Spatula
Beige silicone spatula with wooden handle from the 5-piece heat-resistant baking set - White Small Spatula
Silicone spatula with wooden handle in beige for professional cake baking and mixing - White Large T-Shaped Scraper
+14
Silicone Spatulas And Scrapers With Wooden Handles Heat Resistant Non Stick For Baking Mixing Cream Cake DIY Dessert Modern
$0.61-3.72
Mix MOQ : 2
 · 
84 sold recently
Cute Cartoon Dog Embroidered Patches Puppy Paws Shiba Inu Corgi Iron On Sew On Polyester Fabric Decorative Appliques
Cute Cartoon Dog Embroidered Patches Puppy Paws Shiba Inu Corgi Iron On Sew On Polyester Fabric Decorative Appliques
like
Find Similar
Daisy embroidery patch double-sided adhesive sheets CROWN #513L size 10x20cm - One Sheet Strong Adhesive 20*10CM
Assorted cartoon puppy embroidery patches featuring Corgi and Shiba Inu on white background - Set of 23 Dog and Paw Series (W17XG-168-YT)
Cute Corgi dog cartoon embroidery patch for clothing DIY crafts, size 4.4cm by 5.8cm - Waving Corgi Style (W17XG-085-01)
Embroidered Corgi dog iron-on patch, high density 5.5x4.5cm animal applique for clothing - Corgi Head Style (W17XG-08-02)
+21
Cute Cartoon Dog Embroidered Patches Puppy Paws Shiba Inu Corgi Iron On Sew On Polyester Fabric Decorative Appliques
$0.20-4.84
No MOQ
Free Shipping
Stainless Steel Peeler And Julienne Shredder Double Head Fruit Vegetable Peeling Knife Multifunctional Kitchen Gadget
Stainless Steel Peeler And Julienne Shredder Double Head Fruit Vegetable Peeling Knife Multifunctional Kitchen Gadget
like
Find Similar
Dual-head stainless steel smiley peeler and grater for fruits and vegetables - Stainless Steel / Smiley Face Peeler / Silver
Stainless steel peeler with dark green plastic handle for kitchen use on white background - Stainless Steel/Plastic / Y-shaped Peeler / Dark Green
Pink handle stainless steel vegetable peeler for potatoes and fruit on white background - Stainless Steel/Plastic / Y-shaped Peeler / Pink
Blue ergonomic stainless steel vegetable peeler with a smiley design for kitchen use - Stainless Steel/Plastic / Y-shaped Peeler / Blue
+1
Stainless Steel Peeler And Julienne Shredder Double Head Fruit Vegetable Peeling Knife Multifunctional Kitchen Gadget
$0.11-0.24
Mix MOQ : 4
 · 
19 sold recently
American Football Chenille Embroidery Patches Glitter Sport Theme Iron On Decorative Applique For Clothes
American Football Chenille Embroidery Patches Glitter Sport Theme Iron On Decorative Applique For Clothes
like
Find Similar
Daisy embroidery patch double-sided adhesive sheets CROWN #513L size 10x20cm - Strong Adhesive Backing
Rugby theme chenille patches set with Game Day text and glittery gold borders - American Football Full Series Set
Detail of rugby helmet embroidery patch with Game Day text and size dimensions - Blue and White Star Sports Helmet
Glitter embroidered football helmet patch with Game Day text for apparel decoration - Red Star Sports Helmet
+8
American Football Chenille Embroidery Patches Glitter Sport Theme Iron On Decorative Applique For Clothes
$0.33-5.91
No MOQ
 · 
16 views
Free Shipping
Multi-Functional Kitchen Cleaning Brush Long Handle Cup Scrubber Lobster Cleaning Tool Plastic Gap Grooving Cleaner
Multi-Functional Kitchen Cleaning Brush Long Handle Cup Scrubber Lobster Cleaning Tool Plastic Gap Grooving Cleaner
like
Find Similar
White and grey long-handle kitchen cleaning brush set with hanging hole for storage - L-shaped Long Handle Cup Brush / White (High Quality)
Window groove cleaning brush with gray plastic handle and sturdy black bristles - Plastic Crevice Brush / Gray
Japanese style cleaning brush with black bristles and long plastic handle on white background - Large Metal Crevice Brush / Black
Japanese style black plastic long handle kitchen cleaning brush for blender and seafood - Metal Crevice Brush / Black
+1
Multi-Functional Kitchen Cleaning Brush Long Handle Cup Scrubber Lobster Cleaning Tool Plastic Gap Grooving Cleaner
$0.01-0.02
Mix MOQ : 4
 · 
41 views
Enamel Brooch Pins Medical Theme Zinc Alloy Stethoscope Nurse Hat Angel Doctor Badges For Nurses Day Gift Cute Cartoon
Enamel Brooch Pins Medical Theme Zinc Alloy Stethoscope Nurse Hat Angel Doctor Badges For Nurses Day Gift Cute Cartoon
like
Find Similar
Pink nurse scrub enamel pin with red heart and gold metal trim medical badge - Pink Scrub Suit
Nurse girl enamel pin featuring red heart and cross medical theme on gold alloy - Pigtail Nurse
Cartoon enamel angel medical pin with blue nurse hat and red heart first aid box charm - Blue Angel Doctor
Nurse cap enamel pin with red cross design and gold trim for healthcare professionals - Nurse Hat
+2
Enamel Brooch Pins Medical Theme Zinc Alloy Stethoscope Nurse Hat Angel Doctor Badges For Nurses Day Gift Cute Cartoon
-8%
$0.34
No MOQ
 · 
15 sold recently
Halloween Resin Charms Flatback Cabochons Skull Ghost Pumpkin Witch For DIY Hair Clips Phone Case Decoration Party Favors
Halloween Resin Charms Flatback Cabochons Skull Ghost Pumpkin Witch For DIY Hair Clips Phone Case Decoration Party Favors
like
Find Similar
24-piece Halloween resin flatback charms set with pumpkin and skull for DIY crafts - Multicolor
Large black resin skull charm for Halloween DIY crafts with size measurements shown - Black Skull White Veins
Detailed view of resin skull charm with dimensions 2.5cm height and 2.3cm width on yellow backdrop - White Skull Black Veins
Cartoon white ghost resin flatback charm for Halloween DIY hair clips and party decor - White Skull Red Veins
+19
Halloween Resin Charms Flatback Cabochons Skull Ghost Pumpkin Witch For DIY Hair Clips Phone Case Decoration Party Favors
$0.07-0.12
Mix MOQ : 10
 · 
11 views
Autism Awareness Embroidered Patches Iron On Colorful Puzzle Fabric Decorative Appliques For Clothing Bags Jackets DIY
Autism Awareness Embroidered Patches Iron On Colorful Puzzle Fabric Decorative Appliques For Clothing Bags Jackets DIY
like
Find Similar
Daisy embroidery patch double-sided adhesive sheets CROWN #513L size 10x20cm - Strong Adhesive Backing Sheet
Various autism awareness embroidery patches featuring puzzle hearts and colorful dinosaurs - Autism Awareness Embroidery Patch Collection
Colorful dinosaur puzzle embroidery patch for autism awareness, iron-on sticker 6.5x6.3cm - Multicolor Puzzle Dinosaur Style (No. 1)
Detail of heart-shaped puzzle embroidery patch with Different is Beautiful slogan - No.2-Puzzle Heart (Different is Beautiful)
+32
Autism Awareness Embroidered Patches Iron On Colorful Puzzle Fabric Decorative Appliques For Clothing Bags Jackets DIY
$0.25-10.90
No MOQ
 · 
47 sold recently
Top 10% Best Sellers
in Arts, Crafts & Sewing
Free Shipping
Chinese Dragon Relief Sterling Silver Plated Porcelain Tea Cup Master Cup For Gongfu Tea Ceremony Retro Luxury Gift
Chinese Dragon Relief Sterling Silver Plated Porcelain Tea Cup Master Cup For Gongfu Tea Ceremony Retro Luxury Gift
like
Find Similar
Silver-plated 999 sterling silver tea cup with dragon motif in a premium gift box - 100ml Gift Box Set / Silver-plated Dragon Pattern
Chinese Dragon Relief Sterling Silver Plated Porcelain Tea Cup Master Cup For Gongfu Tea Ceremony Retro Luxury Gift
-5%
$16.70
No MOQ
 · 
21 views
Vintage Ceramic Mug Hand Painted Gold Trace Wisteria Flower Matte Rock Texture Water Cup With Handle For Tea Coffee
Vintage Ceramic Mug Hand Painted Gold Trace Wisteria Flower Matte Rock Texture Water Cup With Handle For Tea Coffee
like
Find Similar
Ceramic wisteria bell cup with gold trim and textured finish, 169ml capacity - Simple Packaging / Blue and White Flint Red Hand-painted Gold Wisteria
Blue and white ceramic wisteria cup with gold detailing and matching gift box - Gift Box / Blue and White Flint Red Hand-painted Gold Wisteria
Vintage Ceramic Mug Hand Painted Gold Trace Wisteria Flower Matte Rock Texture Water Cup With Handle For Tea Coffee
-4%
$8.76-12.05
No MOQ
 · 
31 views
Silicone Baking Pans Molds Muffin Pan Loaf Pan Round Square Cake Molds Spatulas Oil Brush Measuring Utensils Tools Grey
Silicone Baking Pans Molds Muffin Pan Loaf Pan Round Square Cake Molds Spatulas Oil Brush Measuring Utensils Tools Grey
like
Find Similar
Grey round silicone baking mold with double handles for cake and bread baking - Round Cake Pan
Grey square silicone baking pan for cakes and bread on a clean white background - Square Cake Pan
Gray rectangular silicone baking mold with small handles on a white background - Rectangular Loaf Pan
Grey silicone bundt cake pan with swirl texture and side handles for baking - Spiral Bundt Pan
+7
Silicone Baking Pans Molds Muffin Pan Loaf Pan Round Square Cake Molds Spatulas Oil Brush Measuring Utensils Tools Grey
$0.29-7.49
No MOQ
 · 
53 views
Solid Ebony Wood Cutting Board Chopping Block With Handle And Hanging Hole Serving Tray Pizza Plate Kitchen Tool
Solid Ebony Wood Cutting Board Chopping Block With Handle And Hanging Hole Serving Tray Pizza Plate Kitchen Tool
like
Find Similar
Ebony wood cutting board, 40x15x2 cm variant with handle and natural wood grain - Slender Tray 40*15*2cm
Solid ebony wood serving board with divided compartments for snacks and sauces - Steak Plate 36*15*2cm
Ebony wood irregular wave cutting board set with natural grain and ergonomic handle - Butterfly Plate 35*18*2cm
Handcrafted ebony wood cutting board set with natural grain and practical handles - Butterfly Plate 40*23*2cm
+17
Solid Ebony Wood Cutting Board Chopping Block With Handle And Hanging Hole Serving Tray Pizza Plate Kitchen Tool
$7.43-19.06
No MOQ
 · 
26 sold recently
Ceramic Teapot Ru Kiln Hand Painted Cute Cat And Yellow Flower Xishi Tea Kettle With Wood Knob For Gongfu Tea
Ceramic Teapot Ru Kiln Hand Painted Cute Cat And Yellow Flower Xishi Tea Kettle With Wood Knob For Gongfu Tea
like
Find Similar
Ru-kiln ceramic Xishi teapot with cute yellow flower cat pattern on a wooden table - Imperial Yellow Ru Kiln Xishi Teapot - Yellow Flower Cat
Ru-kiln ceramic Xishi teapot with hand-painted yellow flowers and cat in a gift box - Imperial Yellow Ru Kiln Xishi Teapot - Yellow Flower Cat [Gift Box Set]
Ru-kiln ceramic tea set featuring cat and flower patterns with 1 teapot and 2 cups - Imperial Yellow Ru Kiln - 1 Pot 2 Cups + Begonia Tray
Ru-kiln ceramic travel tea set with hand-painted cat and yellow flower patterns - Imperial Yellow Ru Kiln - 1 Pot 5 Cups [Brocade Bag Set]
Ceramic Teapot Ru Kiln Hand Painted Cute Cat And Yellow Flower Xishi Tea Kettle With Wood Knob For Gongfu Tea
$10.66-29.97
No MOQ
 · 
35 views
Chinese Wedding Cake Toppers And Silicone Molds Double Happiness Xi Character Decoration Felt Gold Acrylic For Engagement Traditional Dessert Baking Decor
Chinese Wedding Cake Toppers And Silicone Molds Double Happiness Xi Character Decoration Felt Gold Acrylic For Engagement Traditional Dessert Baking Decor
like
Find Similar
Red felt Double Happiness cake toppers on wooden sticks for Chinese wedding decor - Felt Square Double Happiness 5Pcs
5-piece red felt heart cake toppers with Chinese Double Happiness cutout design - Felt Heart Double Happiness 5Pcs
5-pack red felt Double Happiness cake toppers with wooden sticks for wedding cakes - Felt Ring Double Happiness 5Pcs
Red felt Double Happiness cake topper for Chinese weddings, size 4.7cm by 4.7cm - Felt Round Double Happiness 5Pcs
+24
Chinese Wedding Cake Toppers And Silicone Molds Double Happiness Xi Character Decoration Felt Gold Acrylic For Engagement Traditional Dessert Baking Decor
-6%
$0.22-1.04
Mix MOQ : 3
Dental Floss Picks High Strength Polyethylene Fiber Toothpicks Disposable Portable Oral Care Teeth Cleaning Picks
Dental Floss Picks High Strength Polyethylene Fiber Toothpicks Disposable Portable Oral Care Teeth Cleaning Picks
like
Find Similar
50 Pieces high strength dental floss picks in blue resealable bag packaging - 50 Pcs/Bag
Portable pack of 50 white high-tension dental floss picks in a clear plastic box - 50 Pcs/Box
Pack of 100 white dental floss picks with high tension elastic rod for oral cleaning - 100 Pcs/Bag
Pack of 20 high-tension dental floss picks in white and pink portable bags - 20 Pcs/Bag / Mixed White/Pink
+1
Dental Floss Picks High Strength Polyethylene Fiber Toothpicks Disposable Portable Oral Care Teeth Cleaning Picks
$0.15-0.62
Mix MOQ : 2
 · 
113 sold recently
Cute Cartoon Embroidery Patches Iron On Appliques For Clothing Bag Decoration Kawaii Animal Bear Duck Fabric Repairing
Cute Cartoon Embroidery Patches Iron On Appliques For Clothing Bag Decoration Kawaii Animal Bear Duck Fabric Repairing
like
Find Similar
Daisy embroidery patch double-sided adhesive sheets CROWN #513L size 10x20cm - Adhesive Sheet
Colorful DIY cartoon embroidery patch set with bear, duck and heart shapes on white background - Cartoon Embroidery Patch Combination
Detail of pink embroidered bear patch with I Love You text and 5cm height dimensions - Pink I LOVE YOU Bear
Cute cartoon chick embroidered patch for DIY crafts 4x3.8cm fabric sewing applique - Colorful Chick
+30
Cute Cartoon Embroidery Patches Iron On Appliques For Clothing Bag Decoration Kawaii Animal Bear Duck Fabric Repairing
$0.12-5.58
No MOQ
 · 
11 views
Free Shipping
Happy Birthday Letter Silicone Mold Cake Decorating Tool Fondant Chocolate DIY Baking Kitchen Supplies
Happy Birthday Letter Silicone Mold Cake Decorating Tool Fondant Chocolate DIY Baking Kitchen Supplies
like
Find Similar
Pink silicone Happy Birthday letter mold for chocolate and fondant cake decoration - Large Uppercase Letters
Silicone happy birthday cake mold for chocolate fondant decoration with 8x8cm dimensions - Candle Cake
Silicone Happy Birthday cake mold for chocolate fondant decoration with size details - Heart Cake
Pink silicone Happy Birthday mold with bow and heart details for cake decorating - Bowknot Heart Necklace
Happy Birthday Letter Silicone Mold Cake Decorating Tool Fondant Chocolate DIY Baking Kitchen Supplies
$0.18-0.90
No MOQ
Colorful Embroidered Patches With Inspirational Quotes Polyester Thread Iron On Sew On Apparel Decoration DIY Accessories
Colorful Embroidered Patches With Inspirational Quotes Polyester Thread Iron On Sew On Apparel Decoration DIY Accessories
like
Find Similar
Daisy embroidery patch double-sided adhesive sheets CROWN #513L size 10x20cm - Strong Adhesive Sheet
Detailed view of embroidered patches featuring rainbow, sun, and motivational quotes - Set of 30
Collection of 17 colorful embroidered motivational phrase patches for clothes - Embroidered Patch Set
Set of 20 colorful inspirational embroidered patches with quotes for clothing and bags - 19Pcs Set
+39
Colorful Embroidered Patches With Inspirational Quotes Polyester Thread Iron On Sew On Apparel Decoration DIY Accessories
$0.14-6.23
No MOQ
 · 
420 sold recently
Top 5% Best Sellers
in Arts, Crafts & Sewing
Free Shipping
Wall Mounted Kitchen Spice Rack Carbon Steel Seasoning Organizer With Transparent Compartments Drill Free Gun Grey
Wall Mounted Kitchen Spice Rack Carbon Steel Seasoning Organizer With Transparent Compartments Drill Free Gun Grey
like
Find Similar
Gunmetal wall-mounted kitchen spice rack with 5 sealed boxes and storage shelves - 5-Box Set / Gunmetal
Gunmetal grey wall-mounted kitchen spice rack with 6 clear storage boxes for seasoning - 6-Box Set / Gunmetal
Wall Mounted Kitchen Spice Rack Carbon Steel Seasoning Organizer With Transparent Compartments Drill Free Gun Grey
-7%
$11.77-12.87
No MOQ
 · 
13 views
Laundry Basket Large Cotton Linen Hamper Foldable Storage Bin With Rope Handles Cartoon Puppy Bear Pattern For Clothes Toys
Laundry Basket Large Cotton Linen Hamper Foldable Storage Bin With Rope Handles Cartoon Puppy Bear Pattern For Clothes Toys
like
Find Similar
Close-up of puppy print storage basket with soft cotton rope handles and fabric texture - Westie
Pink foldable laundry basket with cute cat print and rope handles for toy storage - Bowknot Cat
Black canvas laundry basket with vintage cartoon motifs and rope handles for home storage - Vintage Heart
Pink laundry basket with teddy bear print and rope handles for home organization - Twin Bears
+1
Laundry Basket Large Cotton Linen Hamper Foldable Storage Bin With Rope Handles Cartoon Puppy Bear Pattern For Clothes Toys
$4.47
No MOQ
 · 
18 views
Go to

More in party supplies

Explore more in heart shaped boxes

hearthollowgoldwindoweveningartificial pearldiyhomeday giftearrings necklaces
partycrossbodyartificialmetaldesigngirlskidsstyletravelbands

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access