Everful

Wholesale heart shaped boxes

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Heart Shaped Boxes

Find the perfect pieces: party gift bags, party favors, gift wrapping supplies and more

All products in heart shaped boxes

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Rotating Stainless Steel Kitchen Utensil Holder Organizer With Removable Dividers For Countertop Storage Crock
Rotating Stainless Steel Kitchen Utensil Holder Organizer With Removable Dividers For Countertop Storage Crock
like
Find Similar
Rotating stainless steel kitchen utensil holder in silver finish with black dividers - Box Packaging / Black
Rotating stainless steel kitchen utensil holder with gray trim and four compartments - Box Packaging / Gray
Rotating stainless steel kitchen utensil holder in beige and brushed silver finish - Box Packaging / Khaki
Rotating Stainless Steel Kitchen Utensil Holder Organizer With Removable Dividers For Countertop Storage Crock
$2.88
Mix MOQ : 2
 · 
13 sold recently
Diatomaceous Mud Bath Mat Irregular Flower Shape Absorbent Fast Drying Non-Slip Bathroom Floor Rug Wabi-Sabi Style
Diatomaceous Mud Bath Mat Irregular Flower Shape Absorbent Fast Drying Non-Slip Bathroom Floor Rug Wabi-Sabi Style
like
Find Similar
Irregular flower rug with grey swirls and gold geometric lines on beige tiles - 40*60cm Absorbent Leather / A-Gray White Swirl & Geometric
Flower shaped non-slip bathroom mat featuring beige and brown geometric tile patterns - 40*60cm Absorbent Leather / B-Beige Solid & Geometric Tile
Wabi-sabi flower shaped non-slip bath mat with green petals and vintage tile patterns - 40*60cm Absorbent Leather / C-Green Flower & Retro Tile Mosaic
Set of two absorbent floral bath mats with blue flower and vintage Moroccan patterns - 40*60cm Absorbent Leather / D-Blue Flower & Vintage Mosaic
+92
Diatomaceous Mud Bath Mat Irregular Flower Shape Absorbent Fast Drying Non-Slip Bathroom Floor Rug Wabi-Sabi Style
-12%
$1.90-6.03
No MOQ
Silicone Molds For Resin Casting DIY Coasters Jewelry Trays Multi Shapes Flexible Durable Handmade Crafting
Silicone Molds For Resin Casting DIY Coasters Jewelry Trays Multi Shapes Flexible Durable Handmade Crafting
like
Find Similar
Oval silicone tray mold with dimensions 10.5x15.6x1.6cm for DIY plaster coaster crafts - Small Oval J-267
Square silicone coaster mold for resin casting with precise interior dimensions - Square J-264
Oval silicone tray mold 9.5x18x1.6cm for DIY resin coasters and gypsum crafts - Oval J-144
Hexagon silicone mold with specific dimensions and weight for resin coaster DIY making - Hexagon J-145
+10
Silicone Molds For Resin Casting DIY Coasters Jewelry Trays Multi Shapes Flexible Durable Handmade Crafting
$0.49-4.18
Mix MOQ : 2
 · 
58 views
Punk Gothic Horror Black White Embroidery Patches Iron On Sew On Embroidered Appliques For Clothing DIY Accessories
Punk Gothic Horror Black White Embroidery Patches Iron On Sew On Embroidered Appliques For Clothing DIY Accessories
like
Find Similar
Punk style black and white embroidered eye lip patch with size and weight dimensions - Lips Patch 1#
Punk style black and white embroidery patch featuring a weeping woman face and rose design - Beauty Face Patch 2#
Detail shot of punk skull and lily embroidery patch with 7.1cm size measurement - Skull Head Patch 3#
Detail of skull in bottle embroidered patch with size dimensions 7.3cm x 4.2cm - Bottle Skull Patch 4#
+9
Punk Gothic Horror Black White Embroidery Patches Iron On Sew On Embroidered Appliques For Clothing DIY Accessories
$0.22-3.99
No MOQ
 · 
93 sold recently
Top 5% Best Sellers
in Arts, Crafts & Sewing
Free Shipping
Embroidery Patches Iron On Cloth Cartoon VSCO Style Beach Outdoor Retro For Clothing Backpack Decoration Accessories
Embroidery Patches Iron On Cloth Cartoon VSCO Style Beach Outdoor Retro For Clothing Backpack Decoration Accessories
like
Find Similar
Rainbow cloud embroidery patch with Be Live text, dimensions 5.8cm x 3.2cm, 0.9g weight - VSCO Patch 3# (Rainbow Cloud)
Detailed close-up of 17 colorful cartoon iron-on embroidery patches with neat stitching - VSCO Style Patch Set (17Pcs)
Detail showing rainbow PEACE & LOVE embroidery patch dimensions 5.9x5.5cm and 2.5g weight - VSCO Patch 5# (Peace Symbol)
Detailed view of water bottle shaped embroidered patch with cactus and desert motif - VSCO Patch 4# (Outdoor Canteen)
+14
Embroidery Patches Iron On Cloth Cartoon VSCO Style Beach Outdoor Retro For Clothing Backpack Decoration Accessories
$0.17-5.44
No MOQ
 · 
448 sold recently
Top 5% Best Sellers
in Arts, Crafts & Sewing
Free Shipping
Vegetable Fruit Shape Cutters Stainless Steel Cookie Molds With Protective Handle Durable Kitchen Tool For Decorative Food
Vegetable Fruit Shape Cutters Stainless Steel Cookie Molds With Protective Handle Durable Kitchen Tool For Decorative Food
like
Find Similar
3-piece heart and flower shaped stainless steel cookie cutters with colorful PP handles - Type C, Heart Shape (Set of 3)
3-piece set of stainless steel cookie cutters with green pink and orange plastic handles - Type A, Rabbit Shape (Set of 3)
3-piece stainless steel cookie cutters set with green, pink, and orange PP handles - Type B, Star Shape (Set of 3)
Vegetable Fruit Shape Cutters Stainless Steel Cookie Molds With Protective Handle Durable Kitchen Tool For Decorative Food
$0.63
Mix MOQ : 2
 · 
15 views
Cute Cartoon Embroidery Cloth Patches Badges Iron On Adhesive Backing For Clothing Bags DIY Colorful Decorative Applique
Cute Cartoon Embroidery Cloth Patches Badges Iron On Adhesive Backing For Clothing Bags DIY Colorful Decorative Applique
like
Find Similar
Detailed view of red lips embroidered patch with 7.1cm x 4.6cm size measurements - Lip
Detail view of Corgi dog embroidery patch with size dimensions 6.8cm and 3.9cm - Corgi
Detail of pink flamingo embroidery patch with skateboard motif and size measurements - Flamingo
Blue sofa cartoon embroidered patch for kids clothing, 7.0cm x 4.2cm size detail - Blue Sofa
+22
Cute Cartoon Embroidery Cloth Patches Badges Iron On Adhesive Backing For Clothing Bags DIY Colorful Decorative Applique
$0.08-4.38
No MOQ
 · 
361 sold recently
Top 10% Best Sellers
in Arts, Crafts & Sewing
Free Shipping
Afro Black Girl Embroidered Patch Iron On Polyester Slogan Queen Melanin Poppin For Clothing Bags DIY Decor
Afro Black Girl Embroidered Patch Iron On Polyester Slogan Queen Melanin Poppin For Clothing Bags DIY Decor
like
Find Similar
Close-up of Swag embroidery patch featuring a Black girl silhouette and retro stripes - Style 1 SWAG African Girl
Detailed embroidery of heart-shaped Black Princess patch with pink edges and gold crown - Style 2 Black Princess Heart
Close-up of African girl cartoon embroidery patch showing 4.3x5.8cm size and texture - Style 3 Portrait Embroidery Jigsaw
Embroidered black girl patch with Queen text and pink afro hair accessory for clothing - Style 4 Queen Pink Girl
+17
Afro Black Girl Embroidered Patch Iron On Polyester Slogan Queen Melanin Poppin For Clothing Bags DIY Decor
$0.12-5.41
No MOQ
 · 
109 sold recently
Free Shipping
Cartoon 316 Stainless Steel Vacuum Flask With Round Ball Lid Portable Leakproof Water Bottle For Students Kids Women
Cartoon 316 Stainless Steel Vacuum Flask With Round Ball Lid Portable Leakproof Water Bottle For Students Kids Women
like
Find Similar
White cartoon stainless steel thermos with red ball lid and apple print pattern - Red Apple
Ivory stainless steel vacuum flask with puppy camping print and blue ball cap - Blue Tent
Pale yellow cartoon vacuum flask with spherical cap and floral silicone charm - Yellow Dog
Cute cream stainless steel bottle with pink cherry pattern and round spherical cap - Pink Cherry
+4
Cartoon 316 Stainless Steel Vacuum Flask With Round Ball Lid Portable Leakproof Water Bottle For Students Kids Women
$6.20
No MOQ
Vacuum Flask 316 Stainless Steel Insulated Water Bottle Dual Drinking Spout Straw Portable Handle Cute Cartoon For Girls
Vacuum Flask 316 Stainless Steel Insulated Water Bottle Dual Drinking Spout Straw Portable Handle Cute Cartoon For Girls
like
Find Similar
Cute puppy print cream and red stainless steel thermos bottle with handle and straw - 500ml / Red Lid - Apple Puppy
Pink cartoon insulated water bottle with handle and dual-drinking straw for girls - 500ml / White Lid - Plaid Puppy
Cream student thermos with sky blue lid and cute puppy print featuring a handle - 500ml / Blue Lid - Star Puppy
Cute cream-colored thermal water bottle with pink lid and puppy cartoon design - 500ml / Pink Lid - Heart Puppy
Vacuum Flask 316 Stainless Steel Insulated Water Bottle Dual Drinking Spout Straw Portable Handle Cute Cartoon For Girls
$5.36
No MOQ
 · 
16 views
Brownie Baking Pan Non-stick Carbon Steel Rectangular Tray With Detachable Divider Handles For Oven Baking
Brownie Baking Pan Non-stick Carbon Steel Rectangular Tray With Detachable Divider Handles For Oven Baking
like
Find Similar
Non-stick square gold brownie pan with removable dividers and professional packaging - Color Box
Brownie Baking Pan Non-stick Carbon Steel Rectangular Tray With Detachable Divider Handles For Oven Baking
-5%
$4.93
Mix MOQ : 2
Silicone Kitchen Utensils With Beech Wood Handle Non Stick Heat Resistant Cooking Tools Cream White Home Chef
Silicone Kitchen Utensils With Beech Wood Handle Non Stick Heat Resistant Cooking Tools Cream White Home Chef
like
Find Similar
White box packaging for the 10-piece cream silicone kitchen utensil set with wood handles - Packing Box
Single white silicone spatula with wooden handle for non-stick cooking pans - Spatula
Cream silicone soup ladle with natural wooden handle for non-stick cooking - Soup Spoon
Single cream white silicone slotted turner with natural wood handle on white background - Slotted Spatula
+14
Silicone Kitchen Utensils With Beech Wood Handle Non Stick Heat Resistant Cooking Tools Cream White Home Chef
-5%
$0.49-23.78
Mix MOQ : 2
 · 
33 views
Cute Cartoon Cat Embroidery Patches Iron On Sew On Applique DIY Clothes Decoration Repair Polyester Animal Badges Accessory
Cute Cartoon Cat Embroidery Patches Iron On Sew On Applique DIY Clothes Decoration Repair Polyester Animal Badges Accessory
like
Find Similar
Detail of cartoon cat embroidery patch with goldfish bowl and 6.5cm size markings - 1# Calico Cat in Fishbowl
Macro view of calico cat embroidery patch showing measurements of 6.3cm by 3cm size - 13# Side Lying Calico Cat
Detailed view of grey cat and cupcake embroidery patch with 7.5cm by 6cm size dimensions - 18# Standing Grey White Cat
Detail view of cat embroidery patch showing size 6x4cm and fine needlework texture - 17# Grey White Cat Holding Candy
+21
Cute Cartoon Cat Embroidery Patches Iron On Sew On Applique DIY Clothes Decoration Repair Polyester Animal Badges Accessory
$0.20-4.55
No MOQ
 · 
64 sold recently
Free Shipping
Insulated Water Bottle 316 Stainless Steel Vacuum Flask Portable Travel Cup Cute Cartoon With Ball Lid For Girls Students
Insulated Water Bottle 316 Stainless Steel Vacuum Flask Portable Travel Cup Cute Cartoon With Ball Lid For Girls Students
like
Find Similar
Cute 400ml white thermal vacuum cup with red apple cat prints and matching gift box - 400ml / Red Apple
Cute light blue cartoon insulated 400ml vacuum cup with a puppy camping illustration - 400ml / Blue Tent
Cream yellow cartoon vacuum flask 400ml with dog print and flower handle strap - 400ml / Yellow Dog
Cute cherry pattern vacuum insulated 400ml water bottle with a pink spherical lid - 400ml / Pink Cherry
+4
Insulated Water Bottle 316 Stainless Steel Vacuum Flask Portable Travel Cup Cute Cartoon With Ball Lid For Girls Students
$6.20
No MOQ
Bohemian Embroidered Patches Iron On Heat Seal Appliques For Jackets Backpacks Mystic Sun Moon Butterfly DIY Decoration
Bohemian Embroidered Patches Iron On Heat Seal Appliques For Jackets Backpacks Mystic Sun Moon Butterfly DIY Decoration
like
Find Similar
Detailed size measurement of desert night scene iron-on patch for jackets and bags - 1# Desert Night
Bohemian sun and moon embroidered patch with dimensions 6.5cm x 6.5cm for iron-on application - 2# Sun & Moon
Detailed size chart for desert sun mountain embroidery patch with iron-on backing - 3# Desert Sunset
Detail of embroidered patch showing height of 6.5cm and width of 4cm with a vase design - 4# Plant Vase
+9
Bohemian Embroidered Patches Iron On Heat Seal Appliques For Jackets Backpacks Mystic Sun Moon Butterfly DIY Decoration
$0.17-3.72
No MOQ
 · 
39 views
Free Shipping
Manual Lemon Squeezer Stainless Steel Handheld Citrus Juicer Press Fruit Extractor Kitchen Tool Heavy Duty Silver
Manual Lemon Squeezer Stainless Steel Handheld Citrus Juicer Press Fruit Extractor Kitchen Tool Heavy Duty Silver
like
Find Similar
2 options
Manual Lemon Squeezer Stainless Steel Handheld Citrus Juicer Press Fruit Extractor Kitchen Tool Heavy Duty Silver
$0.22-0.26
Mix MOQ : 4
 · 
21 views
Insulated Water Bottle Stainless Steel Vacuum Flask With Straw Lid And Portable Handle Outdoor Sports Travel Aesthetic Prints
Insulated Water Bottle Stainless Steel Vacuum Flask With Straw Lid And Portable Handle Outdoor Sports Travel Aesthetic Prints
like
Find Similar
Pink 1L stainless steel water bottle with checkered smiley face design and straw set - Smiley Checkerboard / Pink - Frosted
Light purple insulated 1L water bottle with daisy prints and a portable handle - Daisy Print / Taro Purple - Frosted
Black matte 1L stainless steel sports bottle with pink bow print and straw kit - Bow Decoration / Black 9L
Matte black 1L stainless steel water bottle with football print and straw brush - Football Smiley Print / Black 9B
+90
Insulated Water Bottle Stainless Steel Vacuum Flask With Straw Lid And Portable Handle Outdoor Sports Travel Aesthetic Prints
$12.10
No MOQ
 · 
18 views
Kitchen Refrigerator Storage Bin Clear Plastic Food Container With Handle For Pantry Cabinet Fridge Organization
Kitchen Refrigerator Storage Bin Clear Plastic Food Container With Handle For Pantry Cabinet Fridge Organization
like
Find Similar
Transparent plastic kitchen storage bin with wheels and dimensions for organization - Large High Basket with Wheels - PET
Small white plastic kitchen storage basket with grey handles and ventilated design - Small Perforated Basket - PP
White plastic storage basket with handles and dimensions for kitchen fridge organization - Medium Perforated Basket - PP
Large white plastic refrigerator organizer bin with handle and breathable mesh design - Large Perforated Basket - PP
+56
Kitchen Refrigerator Storage Bin Clear Plastic Food Container With Handle For Pantry Cabinet Fridge Organization
$0.69-8.65
No MOQ
 · 
75 views
Stainless Steel Canning Rack And Jar Lifter Tongs Anti Scald Heat Resistant Jar Lifting Tool For Home Kitchen Preserving
Stainless Steel Canning Rack And Jar Lifter Tongs Anti Scald Heat Resistant Jar Lifting Tool For Home Kitchen Preserving
like
Find Similar
Kitchen jar lifter with red non-slip handle for safe canning on white background - Red Jar Lifter
Stainless steel canning jar lifter with black handle and green non-slip coating - Green Jar Lifter
Stainless steel canning rack with handles for jar storage and lifting on white background - Canning Rack Bagged
Stainless Steel Canning Rack And Jar Lifter Tongs Anti Scald Heat Resistant Jar Lifting Tool For Home Kitchen Preserving
-4%
$0.44-2.88
No MOQ
 · 
22 views
Cherry Embroidery Patches Polyester Thread Iron On Decorative Fruit Lips Dice Applique For Clothes Bags Hats DIY Cartoon Accessories
Cherry Embroidery Patches Polyester Thread Iron On Decorative Fruit Lips Dice Applique For Clothes Bags Hats DIY Cartoon Accessories
like
Find Similar
Daisy embroidery patch double-sided adhesive sheets CROWN #513L size 10x20cm - One Sheet Strong Adhesive 20*10CM
16pcs cherry embroidery patches set including hearts and lips for clothing decor - Set of 16
Set of 12 red cherry embroidered patches including dice and lip designs for bags - Set of 12
Detail of 6cm round cherry embroidery patch with I Love Cherry text and green leaves - No.1/Round Double Cherry
+11
Cherry Embroidery Patches Polyester Thread Iron On Decorative Fruit Lips Dice Applique For Clothes Bags Hats DIY Cartoon Accessories
$0.20-4.67
No MOQ
 · 
154 sold recently
Top 10% Best Sellers
in Arts, Crafts & Sewing
Free Shipping
Embroidered Patches Iron On Sew On Bohemian Hippie Style Butterfly Rainbow Sun Daisy Flower Peace Sign Apparel Decor DIY Accessories
Embroidered Patches Iron On Sew On Bohemian Hippie Style Butterfly Rainbow Sun Daisy Flower Peace Sign Apparel Decor DIY Accessories
like
Find Similar
Detailed butterfly embroidery patch with yellow pink gradient and dimension 6.1cm by 4.3cm - Butterfly Embroidery Patch
Detail view of colorful rainbow embroidered patch with dimensions 4.3x6cm and weight 1.9g - Rainbow Embroidery Patch
Detail view of ukulele embroidered patch with floral patterns, size 6.2cm x 3.3cm - Floral Ukulele Patch
Detail view of a sun-shaped embroidered patch with 5.9x6.5 cm dimensions and 0.8g weight - Sun Embroidery Patch
+13
Embroidered Patches Iron On Sew On Bohemian Hippie Style Butterfly Rainbow Sun Daisy Flower Peace Sign Apparel Decor DIY Accessories
$0.17-4.86
No MOQ
 · 
54 sold recently
Top 10% Best Sellers
in Arts, Crafts & Sewing
Free Shipping
Ceramic Tea Cup Relief Dragon Pattern Chinese Celadon Porcelain Kung Fu Master Cup Mihe Glaze Traditional Craftsmanship
Ceramic Tea Cup Relief Dragon Pattern Chinese Celadon Porcelain Kung Fu Master Cup Mihe Glaze Traditional Craftsmanship
like
Find Similar
Honey-glaze ceramic tea cup with 140ml capacity and embossed auspicious dragon pattern - Simple Packaging / Beige
Ceramic relief dragon master cup with Mihe glaze and matching traditional gift box - Gift Box / Beige
Celadon ceramic tea cup with embossed dragon motif, diameter 8cm and capacity 140ml - Simple Packaging / Turquoise Green
Celadon ceramic tea cup with embossed dragon pattern and elegant gift box packaging - Gift Box / Turquoise Green
Ceramic Tea Cup Relief Dragon Pattern Chinese Celadon Porcelain Kung Fu Master Cup Mihe Glaze Traditional Craftsmanship
$4.32-5.76
No MOQ
 · 
53 views
Portable Pocket Makeup Mirror Double Sided Folding Compact Square Matte Black Vanity Travel Cosmetic Tool
Portable Pocket Makeup Mirror Double Sided Folding Compact Square Matte Black Vanity Travel Cosmetic Tool
like
Find Similar
Portable folding makeup mirror in black featuring silver moon and love day text - Moon Style
Portable black matte folding mirror with golden star design and Love Day quote - Star Style
Portable square folding makeup mirror in matte black featuring a cyan cat love day design - Cat
Portable double-sided black folding makeup mirror with pink heart and Love Day design - Heart Style
Portable Pocket Makeup Mirror Double Sided Folding Compact Square Matte Black Vanity Travel Cosmetic Tool
$0.02
Mix MOQ : 4
 · 
136 sold recently
Silicone Mold For Nail Art Decoration 3D Bow Star Chain Transparent DIY Resin Craft Tools For Manicure Or Fondant
Silicone Mold For Nail Art Decoration 3D Bow Star Chain Transparent DIY Resin Craft Tools For Manicure Or Fondant
like
Find Similar
Detailed view of clear silicone mold for DIY nail art featuring creative bead chain patterns - 105-Beaded Chain
Translucent silicone nail art mold featuring starry moon and bead chain patterns - 096-Chain
Handheld silicone nail art mold featuring bow, star, and heart patterns for DIY 3D decoration - 097-Chain
Transparent silicone nail mold for DIY 3D bow and star shapes, shown held over a grey surface - 103-Heart Star
+1
Silicone Mold For Nail Art Decoration 3D Bow Star Chain Transparent DIY Resin Craft Tools For Manicure Or Fondant
-5%
$0.52-0.61
Mix MOQ : 2
 · 
35 views
Cute Cartoon Embroidery Patches Flower Fairy Bunny Strawberry Decorative Appliques Fabric Sewing Iron On For Clothing Bag Hat
Cute Cartoon Embroidery Patches Flower Fairy Bunny Strawberry Decorative Appliques Fabric Sewing Iron On For Clothing Bag Hat
like
Find Similar
Daisy embroidery patch double-sided adhesive sheets CROWN #513L size 10x20cm - Strong Adhesive Sheet (20x10cm)
Assorted embroidered iron-on patches featuring flowers, rabbits and cartoon icons - Set of 29 Mixed Styles (S30HXZ-265-YT)
Detail showing 6.3cm cute cartoon mushroom embroidered patch for clothing decoration - Pink Mushroom (S30HXZ-09-01)
Detailed size view of a retro camera embroidery patch with precise needlework - Camera Shape (S30HXZ-096-02)
+27
Cute Cartoon Embroidery Patches Flower Fairy Bunny Strawberry Decorative Appliques Fabric Sewing Iron On For Clothing Bag Hat
$0.19-7.65
No MOQ
 · 
137 sold recently
Top 10% Best Sellers
in Arts, Crafts & Sewing
Free Shipping
Large Capacity Makeup Bag Portable Toiletry Travel Cosmetic Case Partitioned Storage Color Block Polyester Denim Organizer
Large Capacity Makeup Bag Portable Toiletry Travel Cosmetic Case Partitioned Storage Color Block Polyester Denim Organizer
like
Find Similar
Pink nylon cosmetic bag with yellow handles and embroidered text for travel storage - Rose Red
Blue denim texture travel cosmetic bag with pink handle and creative letter embroidery - Blue Denim
Quilted purple toiletry bag with green handle and heart charm in 24x14x9cm size - Light Purple Handbag
Pink striped portable cosmetic bag with Milo Bliss lettering and red handle, 22x12x15cm - Pink Striped Bucket Bag
+10
Large Capacity Makeup Bag Portable Toiletry Travel Cosmetic Case Partitioned Storage Color Block Polyester Denim Organizer
-4%
$3.46-5.19
No MOQ
Western Cowboy Embroidery Patches For Clothing Polyester Fabric Iron On Decorative Appliques Jackets Hats DIY Crafting
Western Cowboy Embroidery Patches For Clothing Polyester Fabric Iron On Decorative Appliques Jackets Hats DIY Crafting
like
Find Similar
Daisy embroidery patch double-sided adhesive sheets CROWN #513L size 10x20cm - One Sheet Strong Adhesive 20*10CM
52Pcs brown western cowboy embroidered patches set featuring horses hats and boots - Set of 52 Pieces
Detail view of 26-piece brown western cowboy embroidery patches with cactus and horse - Set of 26 Pieces Style A
Detail showing 26PCS brown western cowboy embroidery patches with boots and hats - Set of 26 Pieces Style B
+50
Western Cowboy Embroidery Patches For Clothing Polyester Fabric Iron On Decorative Appliques Jackets Hats DIY Crafting
-11%
$0.15-13.54
No MOQ
 · 
1K+ sold recently
Top 1% Best Sellers
in Arts, Crafts & Sewing
Free Shipping
Filigree Enamel Teacup Ceramic Silver Plated Traditional Chinese Style Kung Fu Tea Cup Vintage Flower Bird Design Master Cup
Filigree Enamel Teacup Ceramic Silver Plated Traditional Chinese Style Kung Fu Tea Cup Vintage Flower Bird Design Master Cup
like
Find Similar
Silver 999 tea cup with blue filigree enamel floral pattern and 40ml capacity - 999 Gilded Silver Filigree Intertwining Lotus - Simple Pack
Silver Filigree Magpie Tea Cup with Enamel Finish, 40ml Handcrafted Kung Fu Teaware - 999 Gilded Silver Filigree Magpie - Simple Pack
Silver-plated cloisonné tea cup with lotus pattern in an elegant gift box - 999 Gilded Silver Filigree Intertwining Lotus - Gift Box
Silver-plated filigree teacup with magpie and flower pattern in a premium gift box - 999 Gilded Silver Filigree Magpie - Gift Box
Filigree Enamel Teacup Ceramic Silver Plated Traditional Chinese Style Kung Fu Tea Cup Vintage Flower Bird Design Master Cup
$8.65-10.66
No MOQ
 · 
23 views
Free Shipping
Padded Fabric Flowers DIY Cloth Charms For Hair Accessories Clothing Decor Houndstooth Checkerboard Vintage Style
Padded Fabric Flowers DIY Cloth Charms For Hair Accessories Clothing Decor Houndstooth Checkerboard Vintage Style
like
Find Similar
Detailed view of a 5.5cm handmade padded fabric flower with brown polka dots for DIY crafts - Standard Type / Beige Polka Dot
Close-up of 5.5cm padded plaid cotton flower accessory in camel and coffee brown dots - Standard Type / Khaki Polka Dot
Close-up of a 5.5cm beige plaid fabric flower with a brown plush center for DIY crafts - Standard Type / Off-white Grid
Detail view of 5.5cm plaid fabric flower accessory with measurements on textured background - Standard Type / Khaki Grid
+18
Padded Fabric Flowers DIY Cloth Charms For Hair Accessories Clothing Decor Houndstooth Checkerboard Vintage Style
$0.24-0.27
Mix MOQ : 10
 · 
10 views
Gun Grey Kitchen Storage Rack Wall Mounted Space Aluminum Spice Organizer Punch-Free Knife Holder Multipurpose Heavy Duty Modern
Gun Grey Kitchen Storage Rack Wall Mounted Space Aluminum Spice Organizer Punch-Free Knife Holder Multipurpose Heavy Duty Modern
like
Find Similar
Wall-mounted gunmetal grey kitchen spice rack set with hooks and knife holder - 7-Piece Set Deluxe
Wall-mounted gunmetal kitchen spice rack with 5 hooks and 300mm storage shelf - Gun Grey Rack 30cm - Single Layer 5 Hooks
Gunmetal grey wall-mounted kitchen spice rack 40cm with 5 hooks and sleek finish - Gun Grey Rack 40cm - Single Layer 5 Hooks
50cm gun grey wall-mounted kitchen spice rack with 6 hooks and metal construction - Gun Grey Rack 50cm - Single Layer 5 Hooks
+12
Gun Grey Kitchen Storage Rack Wall Mounted Space Aluminum Spice Organizer Punch-Free Knife Holder Multipurpose Heavy Duty Modern
-4%
$4.08-43.30
No MOQ
 · 
14 views
Rotating Kitchen Hooks Multifunctional Punch-Free Storage Rack Suction Cup Wall Mounted Plastic Utensil Organizer
Rotating Kitchen Hooks Multifunctional Punch-Free Storage Rack Suction Cup Wall Mounted Plastic Utensil Organizer
like
Find Similar
White 360-degree rotating 6-claw kitchen hook with self-adhesive wall mount design - [Economy] 1pc 6-Claw Rotating Hook
Set of 10 transparent self-adhesive hooks with 5.8cm square PVC back and steel hook - Transparent No-trace Hooks 10 Pcs Bag (Iron Hook)
Pack of 8 transparent kitchen hooks with 6x6cm square base and durable metal hooks - Transparent No-trace Hooks 8 Pcs Box (Stainless Steel Hook)
Self-adhesive wood wall hooks for hanging, set of 4, minimalist seamless wooden storage hooks - Original Wood No-trace Hooks 4 Pcs Pack
+5
Rotating Kitchen Hooks Multifunctional Punch-Free Storage Rack Suction Cup Wall Mounted Plastic Utensil Organizer
-5%
$0.60-1.92
No MOQ
Mesh Laundry Bag Polyester Protective Washing Machine 3D Handheld Cartoon Print Bra Underwear Fine Mesh Travel Storage
Mesh Laundry Bag Polyester Protective Washing Machine 3D Handheld Cartoon Print Bra Underwear Fine Mesh Travel Storage
like
Find Similar
Mesh laundry bag size chart for delicates, bra washing bags and large bedding mesh nets - 30x20x8cm / Honeycomb White - Small
Size chart for 3D mesh laundry bags with handles for bras and delicate clothing - 20x30x8cm
Mesh laundry bag set with 4 sizes including bra bag and large tote with dog prints - Swimming Dog - Small
Detailed size chart for four polyester mesh laundry bags featuring cute rabbit prints - 30x20x8cm / Pink Car - Small
+30
Mesh Laundry Bag Polyester Protective Washing Machine 3D Handheld Cartoon Print Bra Underwear Fine Mesh Travel Storage
-5%
$0.66-27.10
No MOQ
Free Shipping
Basketball Embroidery Patches Chenille Sequin Iron On Sew On Decorative DIY Clothing Jacket Backpack Sports Theme
Basketball Embroidery Patches Chenille Sequin Iron On Sew On Decorative DIY Clothing Jacket Backpack Sports Theme
like
Find Similar
Daisy embroidery patch double-sided adhesive sheets CROWN #513L size 10x20cm - Strong Adhesive Backing Sheet
Set of 20 basketball embroidery patches including sequin and towel styles on white backdrop - Basketball Theme Embroidery Patch Set
Detail of basketball love chenille patch with dimensions 7x5.8cm for iron-on application - No.1-Chenille LOVE
Macro shot of basketball heart patch with Love embroidery and gold sequins, 7x6cm size - Heart Basketball LOVE Style
+20
Basketball Embroidery Patches Chenille Sequin Iron On Sew On Decorative DIY Clothing Jacket Backpack Sports Theme
$0.19-6.49
No MOQ
 · 
313 sold recently
Top 10% Best Sellers
in Arts, Crafts & Sewing
Free Shipping
Gothic Skeleton Skull Embroidered Patches Iron On Applique For Clothes DIY Repair Dark Rock Style Black White
Gothic Skeleton Skull Embroidered Patches Iron On Applique For Clothes DIY Repair Dark Rock Style Black White
like
Find Similar
Detail showing dimensions of moon skull embroidered patch 6cm by 5.4cm in black and white - Moon Skull (1#)
Detail of human rib cage embroidered patch with precise black and white stitching and dimensions - Human Ribs (2#)
Close-up of black and white skull embroidery patch with size measurements 6.1cm x 5cm - Classic Skull (3#)
Detail view showing dimensions of a skull and rose embroidered patch in black and white - Skull Rose (4#)
+6
Gothic Skeleton Skull Embroidered Patches Iron On Applique For Clothes DIY Repair Dark Rock Style Black White
$0.27-3.00
No MOQ
 · 
79 sold recently
Free Shipping
French Retro Floral Rose Absorbent PU Leather Coasters Heat Resistant Non Slip Waterproof Table Decorative Placemats
French Retro Floral Rose Absorbent PU Leather Coasters Heat Resistant Non Slip Waterproof Table Decorative Placemats
like
Find Similar
Vintage French round coaster with white rose pattern and dragonfly border on wood - 20*20cm [Absorbent Leather] / French Medieval Style-Type B [Round]
French vintage style round green floral drink coaster with Happy Every Day text - 20*20cm [Absorbent Leather] / French Medieval Style-Type E [Round]
Retro round leather placemat with black rose floral pattern and dark brown border - 20*20cm [Absorbent Leather] / French Medieval Style-Type G [Round]
French vintage round floral placemat with leather edge for coffee cups and dining tables - 20*20cm [Absorbent Leather] / French Medieval Style-Type H [Round]
+260
French Retro Floral Rose Absorbent PU Leather Coasters Heat Resistant Non Slip Waterproof Table Decorative Placemats
-12%
$0.58-3.42
No MOQ
 · 
23 views
Mini Resin Charms DIY Crafts Accessories Cartoon Mushroom Bee Flower House Honey Pot For Scrapbooking Phone Case Decor
Mini Resin Charms DIY Crafts Accessories Cartoon Mushroom Bee Flower House Honey Pot For Scrapbooking Phone Case Decor
like
Find Similar
Detailed macro view of a 1cm mini bee honey jar resin charm on a grid ruler mat - Honey Jar
Macro shot of a tiny pink resin mushroom charm on a measuring mat for nail art use - Mini Mushroom
Mini glossy strawberry resin charms showing 1.5cm size measurement on scale mat - Double Strawberry
Detailed view of a mini pink resin peach charm with green leaves on a measuring mat - Pink Flower
+5
Mini Resin Charms DIY Crafts Accessories Cartoon Mushroom Bee Flower House Honey Pot For Scrapbooking Phone Case Decor
$0.03
Mix MOQ : 2
 · 
175 sold recently
Silicone Mold Flower Bee Butterfly Pattern For DIY Handmade Soap Cake Chocolate Candle Making Flexible Heat Resistant
Silicone Mold Flower Bee Butterfly Pattern For DIY Handmade Soap Cake Chocolate Candle Making Flexible Heat Resistant
like
Find Similar
Pink 6-cavity rose flower silicone mold for DIY soap and cakes, 24.2x16x3.2cm size - 7241-6-Cavity Rose Flower
Purple silicone mold with four flower cavities for DIY handmade soap and cake baking - 7242-Carnation
Purple 6-cavity silicone flower mold for soap making and DIY baking crafts - 7229-Sunflower
Brown 12-cavity rectangular silicone mold for handmade soap and DIY cake baking - 7231-Rounded Rectangle
+13
Silicone Mold Flower Bee Butterfly Pattern For DIY Handmade Soap Cake Chocolate Candle Making Flexible Heat Resistant
$0.84-2.31
Mix MOQ : 5
 · 
40 sold recently
Western Cowboy Embroidery Patches Iron On Heat Melt Adhesive Retro Style Decoration For Clothing Bags Cactus Saddle Pattern
Western Cowboy Embroidery Patches Iron On Heat Melt Adhesive Retro Style Decoration For Clothing Bags Cactus Saddle Pattern
like
Find Similar
Embroidered desert cactus iron-on patch for clothing DIY, measuring 7.8cm by 6.7cm - Cowboy Patch 1#-Desert Cactus
Brown western saddle embroidered patch with precise size dimensions on white background - Cowboy Patch 2#-Saddle
Detail view of horseshoe embroidery patch with dimensions 6.8x6.1cm for clothing - Cowboy Patch 3#-Horseshoe
Detail showing dimensions of cowboy bull skull and wheel embroidery patch for clothing - Cowboy Patch 4#-Bull Skull & Wheel
+8
Western Cowboy Embroidery Patches Iron On Heat Melt Adhesive Retro Style Decoration For Clothing Bags Cactus Saddle Pattern
$0.23-3.54
No MOQ
 · 
331 sold recently
Top 5% Best Sellers
in Arts, Crafts & Sewing
Free Shipping
Cartoon Character Stickers PVC Anime Girl Retro Fashion DIY Scrapbooking Journal Decoration
Cartoon Character Stickers PVC Anime Girl Retro Fashion DIY Scrapbooking Journal Decoration
like
Find Similar
Detail of traditional Chinese hanfu stickers showing solar terms and floral illustrations - Xinfu Girls Style 1 (Ancient Style Solar Terms)
Detail view of Chinese Hanfu themed stickers featuring 24 solar terms illustrations - Xinfu Girls Style 2 (Ancient Style Solar Terms)
Set of trendy Korean style cartoon girl stickers for phone case DIY and scrapbooking - Black Pink Girls (Sweet Cool Style)
Set of 8 Y2K aesthetic girl stickers for DIY scrapbooking and phone case decor - Y2k Girls
+14
Cartoon Character Stickers PVC Anime Girl Retro Fashion DIY Scrapbooking Journal Decoration
$0.86
No MOQ
 · 
1 reviews
Heat Resistant Ironing Mat Belgian Velvet TPR Non Slip Foldable Tabletop Ironing Board Alternative Cartoon Decorative
Heat Resistant Ironing Mat Belgian Velvet TPR Non Slip Foldable Tabletop Ironing Board Alternative Cartoon Decorative
like
Find Similar
Heat resistant ironing mat with panda print for tabletop use on a wooden desk - 50*70CM / Panda Athens
Heat resistant grey ironing mat featuring a white puppy pattern and floral border trim - 50*70CM / Cute Dog Time
Foldable heat-resistant ironing mat with daisy pattern and Have A Nice Day slogan - 50*70CM / Elegant Daisy
Foldable khaki heat-resistant ironing mat with floral print and Good Day text - 50*70CM / Floral Bloom
+20
Heat Resistant Ironing Mat Belgian Velvet TPR Non Slip Foldable Tabletop Ironing Board Alternative Cartoon Decorative
$3.23-6.66
No MOQ
 · 
10 views
Soap Dispensing Dish Brush Long Handle Refillable Kitchen Cleaning Scrubber Plastic Nylon Sponge Heads Pot Pan Sink
Soap Dispensing Dish Brush Long Handle Refillable Kitchen Cleaning Scrubber Plastic Nylon Sponge Heads Pot Pan Sink
like
Find Similar
Gray liquid soap dispensing dish brush set with bristle head and sponge replacement - Box Packaging / Grey (1 Handle + 1 Brush)
Gray long-handle dish brush set with interchangeable nylon and sponge heads - Box Packaging / Grey (1 Handle + 1 Brush + 1 Sponge)
Soap Dispensing Dish Brush Long Handle Refillable Kitchen Cleaning Scrubber Plastic Nylon Sponge Heads Pot Pan Sink
$0.08-0.10
Mix MOQ : 4
 · 
15 sold recently
Isometric Deco Scene Stickers PET Cardboard DIY Scrapbooking Stationery Aesthetic Miniature Room Themes Creative Craft Decals
Isometric Deco Scene Stickers PET Cardboard DIY Scrapbooking Stationery Aesthetic Miniature Room Themes Creative Craft Decals
like
Find Similar
Sweet Clinic PET 2.5D scene stickers set with scene card and decorative stickers - Heart Clinic
Ghost Hotel 2.5D landscape stickers set with PET deco sheets for DIY miniature scenes - Ghost Hotel
Deco Scene Stickers set in Disco Theme with PET stickers and 2.5D background card - Disco Hall
3D Tomato Express deco stickers set with 1 scene card and 3 PET sheets for journaling - Tomato Express
Isometric Deco Scene Stickers PET Cardboard DIY Scrapbooking Stationery Aesthetic Miniature Room Themes Creative Craft Decals
$1.18
No MOQ
 · 
17 views
Silicone Mold DIY Resin Coaster Tray Jewelry Storage Plaster Casting Craft Multi Shape Round Hexagon Oval
Silicone Mold DIY Resin Coaster Tray Jewelry Storage Plaster Casting Craft Multi Shape Round Hexagon Oval
like
Find Similar
DIY silicone coaster molds set of 3 including round hexagonal and oval shapes for resin - Round + Hexagon + Oval Set
Set of 3 oval silicone resin molds in semi-transparent white for DIY coaster crafts - Oval 3-Piece Set
Rectangle silicone mold for resin coaster with size measurements and finished white tray - Rectangle J-269
Rectangular silicone resin mold for DIY trays with blue marble effect tray result - Rectangle J-270
+9
Silicone Mold DIY Resin Coaster Tray Jewelry Storage Plaster Casting Craft Multi Shape Round Hexagon Oval
$0.49-3.40
Mix MOQ : 2
 · 
115 views
Poker Card Embroidery Patches Iron On Adhesive Applique For Clothing Bags Hats DIY Decorative Punk Retro Style
Poker Card Embroidery Patches Iron On Adhesive Applique For Clothing Bags Hats DIY Decorative Punk Retro Style
like
Find Similar
Embroidered Ace of Spades poker patch with flame design and measurement dimensions - Style 1 (Flame Ace of Spades)
Detail showing dimensions of playing card suit embroidery patch with arrow patterns - Style 2 (Poker Suits Arrows)
Detailed embroidery texture of Ace of Spades patch with dimensions and 3.1g weight info - Style 3 (Poker and Dice)
Macro detail of Ace of Spades embroidery patch with dimensions 8.5cm by 4cm and weight - Style 4 (Burning Ace of Spades Hand)
+12
Poker Card Embroidery Patches Iron On Adhesive Applique For Clothing Bags Hats DIY Decorative Punk Retro Style
$0.20-5.10
No MOQ
 · 
398 sold recently
Top 3% Best Sellers
in Arts, Crafts & Sewing
Free Shipping
Apple Slicer Corer Multi-Blade Stainless Steel Fruit Divider With Zinc Alloy Anti-Slip Handle Kitchen Tool Modern
Apple Slicer Corer Multi-Blade Stainless Steel Fruit Divider With Zinc Alloy Anti-Slip Handle Kitchen Tool Modern
like
Find Similar
Zinc alloy apple slicer with 8 stainless steel blades and anti-slip handles for coring - Bubble Bag Pack / Upgrade-8 Blades / Chrome
Silver zinc alloy apple slicer with 12 blades and non-slip handles for easy coring - Bubble Bag Pack / Upgrade-12 Blades / Chrome
Black 8-blade zinc alloy apple slicer corer with non-slip handles and 2.5cm center - Bubble Bag Pack / Upgrade-8 Blades / Black
Zinc alloy 12-blade apple slicer with black floral handles and stainless steel blades - Bubble Bag Pack / Upgrade-12 Blades / Black
+6
Apple Slicer Corer Multi-Blade Stainless Steel Fruit Divider With Zinc Alloy Anti-Slip Handle Kitchen Tool Modern
$3.89-5.33
No MOQ
 · 
10 views
3D Nail Art Silicone Mold Transparent Flower Ocean Shell DIY Craft Jewelry Decoration Manicure Accessory Tool
3D Nail Art Silicone Mold Transparent Flower Ocean Shell DIY Craft Jewelry Decoration Manicure Accessory Tool
like
Find Similar
Detail of transparent silicone nail art mold featuring four sizes of rose flower shapes - #177 Crystal Faceted Flower
Detailed size measurement of a clear silicone flower nail mold with a ruler on top - #178 Flower
Macro view of transparent silicone flower mold for nail art with size measurement ruler - #179 Peach Blossom
Macro shot showing dimensions of a 3D rose nail art silicone mold with ruler - #180 Camellia
+15
3D Nail Art Silicone Mold Transparent Flower Ocean Shell DIY Craft Jewelry Decoration Manicure Accessory Tool
$0.32-0.63
Mix MOQ : 2
 · 
75 views
Free Shipping
Rustic Burlap Lace Cutlery Holder Jute Tableware Pouch For Wedding Christmas Party Table Decoration Vintage Style
Rustic Burlap Lace Cutlery Holder Jute Tableware Pouch For Wedding Christmas Party Table Decoration Vintage Style
like
Find Similar
Rustic burlap cutlery holder with white lace trim for festive table settings - Basic Lace Burlap Style
Rustic jute burlap cutlery pouch with white lace edge for wedding or party tableware - New Lace Burlap Style
Linen cutlery holder with white lace and bow for rustic wedding or festive tables - Twine Bow Knot Style
Rustic burlap cutlery holder with white lace and silk bow for wedding tableware - White Bow With 3 Flowers
+2
Rustic Burlap Lace Cutlery Holder Jute Tableware Pouch For Wedding Christmas Party Table Decoration Vintage Style
$0.22-0.29
No MOQ
 · 
211 sold recently
Pink Embroidered Patches Polyester Surf Girl Dolphin Shark Crab Cowboy Boots Butterfly Iron On Appliques DIY Accessories
Pink Embroidered Patches Polyester Surf Girl Dolphin Shark Crab Cowboy Boots Butterfly Iron On Appliques DIY Accessories
like
Find Similar
Daisy embroidery patch double-sided adhesive sheets CROWN #513L size 10x20cm - Strong Adhesive Sheet
Pink theme embroidery patches set with starfish dolphin crab and butterfly iron-on appliques - Full Set Style
Pink wave embroidery patch 6cm round iron-on badge for clothing with white stitched edge - Mountain Wave Style (1号)
Detail of pink embroidered patch featuring surfing girl and Howdy text with dimensions - No. 2 Western Surfing Girl
+18
Pink Embroidered Patches Polyester Surf Girl Dolphin Shark Crab Cowboy Boots Butterfly Iron On Appliques DIY Accessories
$0.22-5.62
No MOQ
 · 
203 sold recently
Top 10% Best Sellers
in Arts, Crafts & Sewing
Free Shipping
Embroidered Patches Colorful Cartoon VSCO Summer Style Iron On For Clothing Bags DIY Decoration Sew On Decorative Badge
Embroidered Patches Colorful Cartoon VSCO Summer Style Iron On For Clothing Bags DIY Decoration Sew On Decorative Badge
like
Find Similar
Detailed flat lay of 20 summer beach theme iron-on embroidery patches with a mini sewing kit - Style 1 VSCO Patches Set 20Pcs
Cartoon embroidered patch featuring No Bad Vibes text with dimensions 6.7x6.3cm - Style 2 NO BAD VIBES Letter Patch
Detailed view of positive energy embroidered patch with 7.6cm width and 4.1cm height - Style 3 Positive Energy Letter Patch
Detail showing Hawaii sunrise license plate embroidery patch with 7.1x4cm size specs - Style 4 Hawaii Sunrise Rainbow Plate Patch
+17
Embroidered Patches Colorful Cartoon VSCO Summer Style Iron On For Clothing Bags DIY Decoration Sew On Decorative Badge
$0.16-5.00
No MOQ
 · 
497 sold recently
Top 5% Best Sellers
in Arts, Crafts & Sewing
Free Shipping
Embroidered Patches Decorative Iron On Sew On Appliques For Clothing Bags Jackets Retro Hippie Butterfly Flower Designs
Embroidered Patches Decorative Iron On Sew On Appliques For Clothing Bags Jackets Retro Hippie Butterfly Flower Designs
like
Find Similar
Adhesive sheets for strawberry alphabet patches, application guide 20cm x 10cm - Adhesive Sheet / 1 Piece 20*10CM
Close-up of retro hippie embroidery patches including rainbow, butterfly and van shapes - Set of 16 (W9HD-157-YT)
Pink embroidery patch set with heart, rainbow, smiley, and leopard patterns on white background - Set of 20 (W9HD-170-YT)
Rainbow butterfly heart and peace letter embroidered iron-on patches set for bag decoration - Set of 15 (W9HD-148-YT)
+16
Embroidered Patches Decorative Iron On Sew On Appliques For Clothing Bags Jackets Retro Hippie Butterfly Flower Designs
$0.21-4.88
No MOQ
 · 
35 sold recently
Free Shipping
Cartoon Yellow Duck Embroidery Patches Adorable Animal Iron On Sew On Applique For Kids Clothing DIY Decoration Fabric
Cartoon Yellow Duck Embroidery Patches Adorable Animal Iron On Sew On Applique For Kids Clothing DIY Decoration Fabric
like
Find Similar
Daisy embroidery patch double-sided adhesive sheets CROWN #513L size 10x20cm - Adhesive Sheet
Set of 12 cute yellow duck embroidery patches for children clothing decoration - Cartoon Yellow Duck Style Combination
Set of 12 cute yellow duck embroidered patches for children's clothing decoration - Creative Pattern Yellow Duck Combination
Detail view of cartoon duck embroidery patch with dimensions 7cm by 6cm on white background - Swimming Duck
+11
Cartoon Yellow Duck Embroidery Patches Adorable Animal Iron On Sew On Applique For Kids Clothing DIY Decoration Fabric
$0.19-3.98
No MOQ
 · 
11 sold recently
Free Shipping
Glass Oil Sprayer Bottle For Cooking BBQ Salad Baking Stainless Steel Press Type Precise Mist Vinegar Dispenser Modern
Glass Oil Sprayer Bottle For Cooking BBQ Salad Baking Stainless Steel Press Type Precise Mist Vinegar Dispenser Modern
like
Find Similar
Kitchen oil sprayer with premium rose gold pump cap and clear glass bottle for cooking - Gift Box Packaging / Rose Gold
Press-type glass oil sprayer bottle with elegant gold lid for kitchen cooking and BBQ - Gift Box Packaging / Gold
Glass Oil Sprayer Bottle For Cooking BBQ Salad Baking Stainless Steel Press Type Precise Mist Vinegar Dispenser Modern
$0.17
Mix MOQ : 4
 · 
14 sold recently
Kitchen Scraper Silicone Flexible Heat Resistant Cleaning Spatula For Pan Pot Baking Cream Spreader With Hanging Hole
Kitchen Scraper Silicone Flexible Heat Resistant Cleaning Spatula For Pan Pot Baking Cream Spreader With Hanging Hole
like
Find Similar
White silicone scraper spatula KM 1325 with hanging hole in retail packaging - White Silicone Short Style
Silicone pan scraper with yellow handle and white flexible blade for cleaning - Yellow Soft Rubber Long Scraper
White kitchen silicone scraper No.1124 with ergonomic handle and soft flexible blade - White Soft Rubber Long Scraper
White standing silicone spatula scraper with cat ear design for kitchen baking and spreads - Standing Silicone Scraper Spoon - White
+4
Kitchen Scraper Silicone Flexible Heat Resistant Cleaning Spatula For Pan Pot Baking Cream Spreader With Hanging Hole
$1.15-2.36
No MOQ
Motivational Quotes Embroidery Patches Iron On Letter Patches For Clothes DIY Decoration Polyester Fabric Pink Colorful
Motivational Quotes Embroidery Patches Iron On Letter Patches For Clothes DIY Decoration Polyester Fabric Pink Colorful
like
Find Similar
Daisy embroidery patch double-sided adhesive sheets CROWN #513L size 10x20cm - One Sheet Strong Adhesive 20*10CM
Various motivational quote embroidered patches in colorful heart and speech bubble shapes - Assorted Inspirational Slogan Styles
Macro shot of a blue five-pointed star embroidery patch with size dimensions - Blue Star Style
Detail view of pink star embroidered patch with dimensions 2.1cm by 2.2cm on white background - Pink Star Style
+20
Motivational Quotes Embroidery Patches Iron On Letter Patches For Clothes DIY Decoration Polyester Fabric Pink Colorful
$0.09-4.52
No MOQ
 · 
57 sold recently
Free Shipping
Electric Milk Frother Handheld Egg Beater Stainless Steel Portable Mini Mixer For Coffee Eggs Kitchen Gadget
Electric Milk Frother Handheld Egg Beater Stainless Steel Portable Mini Mixer For Coffee Eggs Kitchen Gadget
like
Find Similar
Electric handheld milk frother and egg whisker with stainless steel head in action - Blue Box
Pink handheld electric milk frother and egg beater stirring in a glass bowl - Pink Box
Handheld electric milk frother in neon green mixing eggs in a clear glass bowl - Boxed Green
Handheld black electric milk frother and egg beater used in a kitchen setting - Boxed Black
+3
Electric Milk Frother Handheld Egg Beater Stainless Steel Portable Mini Mixer For Coffee Eggs Kitchen Gadget
$0.68-1.00
Mix MOQ : 3
 · 
36 views
DIY Scene Stickers My Small House Series PET Material Waterproof Decorative Decals For Scrapbooking Journaling Novelty
DIY Scene Stickers My Small House Series PET Material Waterproof Decorative Decals For Scrapbooking Journaling Novelty
like
Find Similar
DIY tree house scene sticker kit with 2 PET sheets and cardstock base for journals - Tree Hole Cabin (My Small House Series 7)
DIY Cave Dweller scene stickers with PET sheets and folding cardboard for 2.5D decoration - Cave Residents (My Small House Series 7)
DIY rock pit scene sticker set with 2 PET sheets and 1 pop-up card for journaling - Rock Pit (My Small House Series 7)
DIY scene sticker set with Galaxy Traveler theme 3 PET sheets and 1 background card - Galaxy Traveler (My Small House Series 6)
+67
DIY Scene Stickers My Small House Series PET Material Waterproof Decorative Decals For Scrapbooking Journaling Novelty
-4%
$0.60-1.62
No MOQ
 · 
85 sold recently
Waterproof Kitchen Apron Vest Style Polyester Oilproof Hand Wiping Towel Large Pocket Cartoon Rabbit Pattern Home Cooking
Waterproof Kitchen Apron Vest Style Polyester Oilproof Hand Wiping Towel Large Pocket Cartoon Rabbit Pattern Home Cooking
like
Find Similar
Breathable pink mesh apron with star pattern and beige pockets for kitchen use - One Size / Beige Starry Sky-Mesh Breathable-No Wiping
Pink breathable mesh apron with heart pattern and front pocket for home kitchen - One Size / Pink Heart-Mesh Breathable-No Wiping
Beige breathable mesh apron with star pattern and pockets for home kitchen use - One Size / Beige Starry Sky-Mesh Breathable-With Wiping
Pink waterproof kitchen apron with white heart patterns and large front pocket - One Size / Pink Heart-Mesh Breathable-With Wiping
+8
Waterproof Kitchen Apron Vest Style Polyester Oilproof Hand Wiping Towel Large Pocket Cartoon Rabbit Pattern Home Cooking
$2.16-2.82
No MOQ
 · 
32 views
Colorful Plastic Cookie Cutters Nested Baking Molds For Biscuits Fondant Fruit Shapes Various Shape Kitchen Tools
Colorful Plastic Cookie Cutters Nested Baking Molds For Biscuits Fondant Fruit Shapes Various Shape Kitchen Tools
like
Find Similar
Detailed view of 5-piece colorful heart-shaped plastic cookie cutters in nested sizes - Heart Shape/5-Piece Set
Macro shot of 5 nested colorful plastic square cookie cutters with fluted edges - Square Shape/5-Piece Set
5-piece set of star-shaped plastic cookie cutters in vibrant nesting colors - Star Shape/5-Piece Set
Set of 5 colorful round scalloped cookie cutters nested in a red storage container - Round Shape/5-6 Piece Set
+4
Colorful Plastic Cookie Cutters Nested Baking Molds For Biscuits Fondant Fruit Shapes Various Shape Kitchen Tools
-5%
$0.38
Mix MOQ : 2
 · 
33 views
Diatomaceous Earth Coaster Placemat Absorbent Heat Insulated Non Slip Diatom Mud Mat Cartoon Smile Flower Rainbow Retro
Diatomaceous Earth Coaster Placemat Absorbent Heat Insulated Non Slip Diatom Mud Mat Cartoon Smile Flower Rainbow Retro
like
Find Similar
Absorbent diatomite coaster 19.5cm featuring yellow stripes and smiley flower design - Square 19.5cm / Striped Flowers
Blue 19.5cm diatom mud kitchen mat with smiling white flower pattern design - Round 19.5cm / Blue Sky Flowers
Rainbow flower diatomaceous earth kitchen mat with fancy bloom text and 19.5cm size - Square 19.5cm / Rainbow Flowers
Absorbent diatom mud mat with heart flower design and Favored by Luck text 19.5cm - Round 19.5cm / Heart Flowers
Diatomaceous Earth Coaster Placemat Absorbent Heat Insulated Non Slip Diatom Mud Mat Cartoon Smile Flower Rainbow Retro
$0.84
Mix MOQ : 2
 · 
13 sold recently
Strawberry Bear Cartoon Embroidery Patches Iron On Decorative Appliques For Clothes DIY Fabric Sewing Ornaments
Strawberry Bear Cartoon Embroidery Patches Iron On Decorative Appliques For Clothes DIY Fabric Sewing Ornaments
like
Find Similar
Detail of red strawberry embroidery patch showing 6.4x5cm dimensions on white background - Strawberry Shape 1#
Detail of pink strawberry stamp embroidery patch with dimension marks 6.3cm x 5cm - Stamp Style 2#
Macro detail of red strawberry embroidery patch showing 6.8cm x 6.6cm dimensions - Large Strawberry 3#
Cute pink strawberry ice cream embroidered patch with dimensions for clothing DIY - Ice Cream Style 4#
+9
Strawberry Bear Cartoon Embroidery Patches Iron On Decorative Appliques For Clothes DIY Fabric Sewing Ornaments
$0.26-4.38
No MOQ
 · 
105 sold recently
Top 10% Best Sellers
in Arts, Crafts & Sewing
Free Shipping
Go to

More in party supplies

Explore more in heart shaped boxes

hearthollowgoldwindoweveningartificial pearldiyhomeday giftearrings necklaces
partycrossbodyartificialmetaldesigngirlskidsstyletravelbands

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access